HHsearch alignment for GI: peg_472 and conserved domain: PRK00131

>PRK00131 aroK shikimate kinase; Reviewed.
Probab=96.35  E-value=0.034  Score=36.31  Aligned_cols=30  Identities=37%  Similarity=0.634  Sum_probs=25.2

Q ss_pred             EHHCCCCCCCHHHHHHHHHHHHCCCCCCCC
Q ss_conf             201078798888999999999614687778
Q 537021.9.peg.4   24 YMLSGTRGIGKTTTARIIARSLNYKTAHID   53 (369)
Q Consensus        24 ~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~   53 (369)
T Consensus         7 I~liG~~GsGKTtvgk~LA~~L~~~fiD~D   36 (175)
T PRK00131          7 IVLIGMMGAGKSTIGRLLAKRLGYEFIDTD   36 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             898889999989999999999596902398