HHsearch alignment for GI: peg_472 and conserved domain: PRK00440

>PRK00440 rfc replication factor C small subunit; Reviewed.
Probab=100.00  E-value=0  Score=410.76  Aligned_cols=296  Identities=23%  Similarity=0.346  Sum_probs=261.8

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC
Q ss_conf             92848999999999982876706201078798888999999999614687778866587899977999977987782224
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVEL   80 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~   80 (369)
T Consensus        18 i~g~~~~~~~L~~~i~~~~~ph-lLf~GppG~GKTt~a~~la~~l~~~~~~-----------------------~~~lel   73 (318)
T PRK00440         18 VVGQEEIVERLKSFVKEKNMPH-LLFAGPPGTGKTTAALALARELYGEYWR-----------------------ENFLEL   73 (318)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCE-EEEECCCCCCHHHHHHHHHHHHCCCCCC-----------------------CCEEEE
T ss_conf             4196999999999998799866-9888959988999999999997698643-----------------------476895


Q ss_pred             CCCCCCCHHHHHHHHH-HHHHHHHC-CCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             5332233455566555-44565420-465237751156648001678999997212211146650675433035675433
Q 537021.9.peg.4   81 DAASHTSIDDVREIID-QIYYKPIS-ARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQ  158 (369)
Q Consensus        81 ~~~s~~~id~ir~l~~-~~~~~p~~-~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq  158 (369)
T Consensus        74 nasd~r~id~vr~~i~~~~~~~~~~~~~~kiiiiDE~d~l~~~aq~aL~~~mE~~~~~~~fil~~n~~~kii~~i~SRc~  153 (318)
T PRK00440         74 NASDERGIDVIRNKIKEFARTAPVGGAPFKIIFLDEADNLTSDAQQALRRTMEMYSQTTRFILSCNYSSKIIDPIQSRCA  153 (318)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHE
T ss_conf             16456671789999999997267789973899986855322556788876431056662588634883337615565510


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHH
Q ss_conf             32102454001356787643101345625664456531676420011000111000000121032200013567777788
Q 537021.9.peg.4  159 RFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD  238 (369)
Q Consensus       159 ~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~  238 (369)
T Consensus       154 ~i~f~~~~~~~i~~~L~~I~~~E~i~~~~~~l~~i~~~s~gdlR~ain~L-q~~~~~~~~it~~~v~~~~~~~~~~~i~~  232 (318)
T PRK00440        154 VFRFSPLPKEAVIERLRYIAKNEGLEITDDALEAIYYVSEGDMRKAINAL-QAAAATGKEVTEEAVYKITGTARPEEIRE  232 (318)
T ss_pred             EEECCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHH-HHHHHCCCCCCHHHHHHHHCCCCHHHHHH
T ss_conf             11157899999999999999985999899999999986499899999999-99997489878999999976999899999


Q ss_pred             HHHHHHCCCHHHHHHHHHHH-HHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHH
Q ss_conf             88763013633467887654-30476213578777534899999974574122344998899999999862998999999
Q 537021.9.peg.4  239 LFGYLIKGDIINVLQEFSSQ-YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRF  317 (369)
Q Consensus       239 Ll~ai~~~d~~~al~~l~~l-~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a~~i~~~~L~~~  317 (369)
T Consensus       233 ii~~~~~~~~~~~~~~l~~ll~~~g~~~~dIi~~l~~---~l~~~-------------------------~~~~~~k~~i  284 (318)
T PRK00440        233 MINLALNGDFTEAREKLRELMIDYGLSGEDIIKQIHR---EVLRL-------------------------DIPEDLKVEL  284 (318)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH---HHHHC-------------------------CCCHHHHHHH
T ss_conf             9999970899999999999998659999999999999---99845-------------------------9998999999


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHC
Q ss_conf             99999999983027888999999999995330
Q 537021.9.peg.4  318 WQMILKGISEIEGFSRPMEAVEMVLIRLAHAV  349 (369)
Q Consensus       318 lq~l~~a~~~Lk~n~np~L~lE~lLlkL~~~~  349 (369)
T Consensus       285 i~~ia~~e~rl~~g~~~~lqLe~lla~l~~l~  316 (318)
T PRK00440        285 IDAIGEADFRITEGANERIQLEALLAKLALLG  316 (318)
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             99999999998707999999999999999861