HHsearch alignment for GI: peg_472 and conserved domain: PRK04328

>PRK04328 hypothetical protein; Provisional.
Probab=94.30  E-value=0.035  Score=36.20  Aligned_cols=33  Identities=24%  Similarity=0.397  Sum_probs=23.9

Q ss_pred             HHHHHHCCCCC--EEEHHCCCCCCCHHHHHHHHHHH
Q ss_conf             99999828767--06201078798888999999999
Q 537021.9.peg.4   11 LTNAFKSGRIA--QSYMLSGTRGIGKTTTARIIARS   44 (369)
Q Consensus        11 l~~~~~~~~~~--ha~lf~G~~G~GK~~~a~~~A~~   44 (369)
T Consensus        13 LD~lL~-GGlp~gs~~Lv~G~pGtGKT~la~qFl~~   47 (250)
T PRK04328         13 MDEILY-GGIPERNVVLLSGGPGTGKSIFSQQFLWN   47 (250)
T ss_pred             HHHHCC-CCCCCCEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             787515-99879969999828999989999999999