HHsearch alignment for GI: peg_472 and conserved domain: PRK04841

>PRK04841 transcriptional regulator MalT; Provisional.
Probab=98.15  E-value=0.00048  Score=50.00  Aligned_cols=182  Identities=12%  Similarity=0.153  Sum_probs=95.6

Q ss_pred             HHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHH------HHHHHC---CCCCCCCCC
Q ss_conf             99999982876706201078798888999999999614687778866587899977------999977---987782224
Q 537021.9.peg.4   10 TLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEH------CQAIIR---GNHVDVVEL   80 (369)
Q Consensus        10 ~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~------c~~i~~---~~~~d~~e~   80 (369)
T Consensus        21 rL~~~L~~~~~~~l~lv~APaG~GKTtl~a~w~~~~~--~~~Wl--sld~~d~~~~~f~~~l~~al~~~~~~~~~~~~~~   96 (903)
T PRK04841         21 RLLAKLSGANNYRLVLVRSPAGYGKTTLASQWAAGKN--NVGWY--SLDESDNQPERFASYLIAALQQATNGHCSKSEAL   96 (903)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCC--CEEEE--ECCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHC
T ss_conf             7999998515899799977999889999999983499--85998--5885448999999999999998565433112311


Q ss_pred             -CCCCCCCHHHH-HHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHH-HHHHCCCCCCEEEEECC-CCCCCHHHHHH
Q ss_conf             -53322334555-6655544565420465237751156648001678999-99721221114665067-54330356754
Q 537021.9.peg.4   81 -DAASHTSIDDV-REIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLK-TLEEPPPHVKFIFATTE-IRKIPITVLSR  156 (369)
Q Consensus        81 -~~~s~~~id~i-r~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK-~lEEPp~~~~fil~t~~-~~~ll~TI~SR  156 (369)
T Consensus        97 ~~~~~~~~~~~~~~~l~~~l~---~~~~~~~lvlDD~h~i~~~~~~~~l~~Ll~~~p~~l~lvl~sR~~p~l~l~~l~~~  173 (903)
T PRK04841         97 AEKRQYASLTSLFAQLFIELS---DWHQPLYLVLDDYHLITNPEIHEAMRFFLRHQPENLTLVVLSRNLPPLGIANLRVR  173 (903)
T ss_pred             CCCCCCCCHHHHHHHHHHHHH---CCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHC
T ss_conf             355665549999999999975---58998699986836488868999999999838988389987689998752457745


Q ss_pred             HHHHHCC----CCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCC
Q ss_conf             3332102----45400135678764310134562566445653167642
Q 537021.9.peg.4  157 CQRFDLH----RISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSA  201 (369)
Q Consensus       157 cq~~~f~----~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~Gsl  201 (369)
T Consensus       174 ~~l~~i~~~dL~Ft~~E~~~~~~~---~~g~~l~~~~~~~l~~~TeGW~  219 (903)
T PRK04841        174 DQLLEIGSQQLAFDHQEAQQFFDQ---RLSSPIEAAESSRLCDRVEGWP  219 (903)
T ss_pred             CEEEEECHHHCCCCHHHHHHHHHH---CCCCCCCHHHHHHHHHHHCCHH
T ss_conf             956998688759999999999986---2599999999999999708789