HHsearch alignment for GI: peg_472 and conserved domain: PRK05506

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.
Probab=94.57  E-value=0.037  Score=36.02  Aligned_cols=34  Identities=29%  Similarity=0.520  Sum_probs=16.0

Q ss_pred             HHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHH
Q ss_conf             9999828767062010787988889999999996
Q 537021.9.peg.4   12 TNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSL   45 (369)
Q Consensus        12 ~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l   45 (369)
T Consensus       434 ~R~~~~g~~~~~iw~tGlsgsGKstiA~~le~~L  467 (613)
T PRK05506        434 ARAARKGQKPATVWFTGLSGSGKSTIANLVERRL  467 (613)
T ss_pred             HHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9999748997699997789897479999999999