HHsearch alignment for GI: peg_472 and conserved domain: PRK05896

>PRK05896 DNA polymerase III subunits gamma and tau; Validated.
Probab=100.00  E-value=0  Score=626.46  Aligned_cols=344  Identities=33%  Similarity=0.514  Sum_probs=312.6

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC
Q ss_conf             92848999999999982876706201078798888999999999614687778866587899977999977987782224
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVEL   80 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~   80 (369)
T Consensus        18 IIGQe~iv~~L~nAI~~~RiaHAYLFsGPrGvGKTTlArifAkaLnC~~~~~~----dpCg~C~sC~~I~~g~h~DviEI   93 (613)
T PRK05896         18 IIGQELIKKILVNAILNNKLTHAYIFSGPRGIGKTSIAKIFAKAINCLNPKDG----DCCNSCSVCESINTNQSVDIVEL   93 (613)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCC----CCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             23829999999999984997622775589984889999999999669999999----98888878999856999986884


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             53322334555665554456542046523775115664800167899999721221114665067543303567543332
Q 537021.9.peg.4   81 DAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRF  160 (369)
Q Consensus        81 ~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq~~  160 (369)
T Consensus        94 daasn~gIDeIReLie~~~~~P~~gkyKV~IIDEah~Ln~~AaNALLKtLEEPP~~viFIL~Ttep~KLLpTIlSRCQrf  173 (613)
T PRK05896         94 DAASNNGVDEIRNIIDNINYLPTTFKYKVYIIDEAHMLSTSAWNALLKTLEEPPKHVVFIFATTEFQKIPLTIISRCQRY  173 (613)
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEECCHHHCCHHHHHHHHHHCCCCCCCCEEEEEECCHHHCCHHHHHCCCCE
T ss_conf             06555788999999997085875799459998162217999999999853489878379998288154937664035500


Q ss_pred             HCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHHHH
Q ss_conf             10245400135678764310134562566445653167642001100011100000012103220001356777778888
Q 537021.9.peg.4  161 DLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF  240 (369)
Q Consensus       161 ~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~Ll  240 (369)
T Consensus       174 ~Fkri~~~~I~~~L~~I~~kE~i~ie~~AL~~Ia~~adGs~RDAlslLdQ~~~~~~~~it~~~v~~~~g~~~~~~~~~~~  253 (613)
T PRK05896        174 NFKKLNNSELQELLKSIAKKEKIKIEDNAIDKIADLADGSLRDGLSILDQLSTFKNKKIDIEDINKTFGLVDNNKKINLI  253 (613)
T ss_pred             ECCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHH
T ss_conf             17889989999999999997399878999999999768848789889999998356886299999996777689999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH-HHCC-HHHHHHHH
Q ss_conf             763013633467887654304762135787775348999999745741223449988999999998-6299-89999999
Q 537021.9.peg.4  241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYS-KEVS-ITFLSRFW  318 (369)
Q Consensus       241 ~ai~~~d~~~al~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a-~~i~-~~~L~~~l  318 (369)
T Consensus       254 ~~i~~~d~~~~~~~~~~~~~~g~~~~~~~~~li~~l~d~~~y~~~~~~~~l~~~~~e~~~~~~~~~~k~l~~~f~~n~~l  333 (613)
T PRK05896        254 ELIQKNDIEELRNLINELESKGINFEAFCRDLINLLIDLLVYQKTKNINLLKKLSKEQLKTLNLEKQKLLSIEFNTNFLL  333 (613)
T ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99985589999999999998067899999999999999987332275788753789998887655656643201278999


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             999999998302788899999999999533
Q 537021.9.peg.4  319 QMILKGISEIEGFSRPMEAVEMVLIRLAHA  348 (369)
Q Consensus       319 q~l~~a~~~Lk~n~np~L~lE~lLlkL~~~  348 (369)
T Consensus       334 ~~~~~~~~~~~~~~n~~~~~~i~~~~~in~  363 (613)
T PRK05896        334 NNFVSLFNNLKKSVNQVKEFEIYVYKIFNQ  363 (613)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHC
T ss_conf             999999999998744026899999999850