HHsearch alignment for GI: peg_472 and conserved domain: PRK06526

>PRK06526 transposase; Provisional.
Probab=97.53  E-value=0.00031  Score=51.36  Aligned_cols=101  Identities=21%  Similarity=0.235  Sum_probs=60.4

Q ss_pred             CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCC-CCCCCCCCCHHHHHHHHHHHH
Q ss_conf             7062010787988889999999996146877788665878999779999779877822-245332233455566555445
Q 537021.9.peg.4   21 AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVV-ELDAASHTSIDDVREIIDQIY   99 (369)
Q Consensus        21 ~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~-e~~~~s~~~id~ir~l~~~~~   99 (369)
T Consensus        98 ~~Nvil~G~~GtGKThLA~Alg~~A-~~~G~~v~-----f~~~~-----------~L~~~L~~a~~~-----g~~~~~--  153 (254)
T PRK06526         98 KENVVFLGPPGTGKTHLAIGLGIRA-CQAGHRVL-----FATAA-----------QWVARLAAAHHA-----GRLQDE--  153 (254)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH-HHCCCCEE-----EEEHH-----------HHHHHHHHHHHC-----CCHHHH--
T ss_conf             8878998999986899999999999-98699679-----98779-----------999999998855-----809999--


Q ss_pred             HHHHCCCCCEEEEECHH--HCCCCHHHHHHHHHHHCCCCCCEEEEECCC
Q ss_conf             65420465237751156--648001678999997212211146650675
Q 537021.9.peg.4  100 YKPISARFRVYIMDEVQ--MLSTAAFNGLLKTLEEPPPHVKFIFATTEI  146 (369)
Q Consensus       100 ~~p~~~~~kv~iid~a~--~m~~~a~NaLLK~lEEPp~~~~fil~t~~~  146 (369)
T Consensus       154 ~~-~l~~~dLLIiDe~g~~~~~~~~a~~lf~li~~Rye~~S~IiTSn~~  201 (254)
T PRK06526        154 LV-KLGRIPLLIVDEVGYIPFEAEAANLFFQLVSSRYERASLIVTSNKP  201 (254)
T ss_pred             HH-HHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99-8513687765021364478899999999999997458867665898