HHsearch alignment for GI: peg_472 and conserved domain: PRK06835

>PRK06835 DNA replication protein DnaC; Validated.
Probab=96.97  E-value=0.0054  Score=42.23  Aligned_cols=41  Identities=24%  Similarity=0.340  Sum_probs=26.7

Q ss_pred             HHHHHHHHHHHCC-CCCEEEHHCCCCCCCHHHHHHHHHHHHC
Q ss_conf             9999999999828-7670620107879888899999999961
Q 537021.9.peg.4    6 PMIKTLTNAFKSG-RIAQSYMLSGTRGIGKTTTARIIARSLN   46 (369)
Q Consensus         6 ~~~~~l~~~~~~~-~~~ha~lf~G~~G~GK~~~a~~~A~~l~   46 (369)
T Consensus       167 ~i~~~~~~fi~~F~~~~~nLlf~G~~G~GKTfLa~~IA~ell  208 (330)
T PRK06835        167 NILEKCLNFIKNFDKNNENLLFYGNTGTGKTFLSNCIAKELL  208 (330)
T ss_pred             HHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             999999999872478888669889999988999999999999