HHsearch alignment for GI: peg_472 and conserved domain: PRK07764

>PRK07764 DNA polymerase III subunits gamma and tau; Validated.
Probab=100.00  E-value=0  Score=690.16  Aligned_cols=360  Identities=32%  Similarity=0.512  Sum_probs=340.8

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCC--CCCCC
Q ss_conf             9284899999999998287670620107879888899999999961468777886658789997799997798--77822
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGN--HVDVV   78 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~--~~d~~   78 (369)
T Consensus        17 viGQe~v~~~L~~Ai~~gri~HAYLFsGprG~GKTt~ARilAkaLNC~~~~----~~~PCg~C~sC~~i~~g~~~~~Dvi   92 (775)
T PRK07764         17 VVGQEHVTEPLSTALDSGRINHAYLFSGPRGCGKTSSARILARSLNCAQGP----TSTPCGVCDSCVALAPGGPGSLDVV   92 (775)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC----CCCCCCCCHHHHHHHCCCCCCCCEE
T ss_conf             228599999999999819976337623788878889999999996689999----9898888763788863898888668


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             24533223345556655544565420465237751156648001678999997212211146650675433035675433
Q 537021.9.peg.4   79 ELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQ  158 (369)
Q Consensus        79 e~~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq  158 (369)
T Consensus        93 EiDAAS~~gVddiReL~e~~~y~P~~~ryKVyIIDEaHmls~~afNALLKtLEEPP~hvvFIlaTTep~kip~TI~SRcq  172 (775)
T PRK07764         93 EIDAASHGGVDDARELRERAFFAPAQSRYRIFIIDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVIGTIRSRTH  172 (775)
T ss_pred             EECCCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEECHHHHCHHHHHHHHHHHCCCCCCEEEEEECCCHHHCCHHHHHHCC
T ss_conf             73156556889999999854768767863599985354407999999988622786462799954873547167764102


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHH-CCCCHHHHHHCCCCCCHHHHH
Q ss_conf             3210245400135678764310134562566445653167642001100011100000-012103220001356777778
Q 537021.9.peg.4  159 RFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DKIVTSSVRLMLALADRNRIM  237 (369)
Q Consensus       159 ~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~-~~i~~e~v~~llg~~~~~~i~  237 (369)
T Consensus       173 ~f~Fr~i~~~~~~~~l~~i~~~E~i~~~~~al~li~r~~~Gs~RDalS~ldQl~a~~~~~~v~~~~a~~llG~~~~~~l~  252 (775)
T PRK07764        173 HYPFRLVPPGTMRPYLERICAQEGVVVDDAVLPLVIRAGGGSPRDTLSVLDQLLAGAGDDGVTYERAVALLGVTDVALID  252 (775)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEHHHHHHHHCCCCHHHHH
T ss_conf             34526699999999999999983998798999999998289667689999999840488841099999985888589999


Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCC--CCCCCHHHHHHHHHHHHHCCHHHHH
Q ss_conf             88876301363346788765430476213578777534899999974574122--3449988999999998629989999
Q 537021.9.peg.4  238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMAD--TLLYSEAENARALQYSKEVSITFLS  315 (369)
Q Consensus       238 ~Ll~ai~~~d~~~al~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~--~~~~~~~e~~~i~~~a~~i~~~~L~  315 (369)
T Consensus       253 ~~~~al~~~d~~~~~~~v~~~~~~G~d~~rf~~dLl~~~Rdl~~~~~~~~~~~~~l~~~~~~~~~~~~~qa~~~~~~~l~  332 (775)
T PRK07764        253 DAVDALAAGDGAALFGVVDRVIEAGHDPRRFAEDLLERFRDLIVLQAVPDAAERGLVDAPEDVLDRMREQAARLGAAELT  332 (775)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHH
T ss_conf             99999983789999999999998287889999999999999999986106665125568888999999999860999999


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             9999999999983027888999999999995330499989999976555
Q 537021.9.peg.4  316 RFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEE  364 (369)
Q Consensus       316 ~~lq~l~~a~~~Lk~n~np~L~lE~lLlkL~~~~~~~s~~~~~~~~~~~  364 (369)
T Consensus       333 r~a~~~~~~l~~m~ga~~prl~le~~~ar~l~p~~~~~~~~~~~r~~~~  381 (775)
T PRK07764        333 RYAEVVNAGLGEMRGATSPRLLLELLCARLLLPSASDTERALLARVERL  381 (775)
T ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHH
T ss_conf             9999999999874278975689999999870777674357899889987