HHsearch alignment for GI: peg_472 and conserved domain: PRK07914

>PRK07914 hypothetical protein; Reviewed.
Probab=99.85  E-value=5.4e-19  Score=160.26  Aligned_cols=301  Identities=16%  Similarity=0.164  Sum_probs=243.0

Q ss_pred             CCEEEHHCCCCCCCHHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC--CCCCCCCCCCCHHHHHHHHH
Q ss_conf             670620107879888899-999999961468777886658789997799997798778--22245332233455566555
Q 537021.9.peg.4   20 IAQSYMLSGTRGIGKTTT-ARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVD--VVELDAASHTSIDDVREIID   96 (369)
Q Consensus        20 ~~ha~lf~G~~G~GK~~~-a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d--~~e~~~~s~~~id~ir~l~~   96 (369)
T Consensus         4 pAPvyLi~G~E~~L~erav~~~~~~ar------------------------~~~~~~d~~~~~l~a~~-~~~~~---l~~   55 (320)
T PRK07914          4 PSPLHLVLGDEELLVERAVAAVLRSAR------------------------KRAGTADVPVDRLRAGD-VSTYE---LAE   55 (320)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHHH------------------------HHCCCCCCEEEEECCCC-CCHHH---HHH
T ss_conf             998799970819999999999999998------------------------50379984346621466-88889---998


Q ss_pred             HHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCC---CCCCHHHHHH-HHHHHCCCC-CCHHHH
Q ss_conf             44565420465237751156648001678999997212211146650675---4330356754-333210245-400135
Q 537021.9.peg.4   97 QIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEI---RKIPITVLSR-CQRFDLHRI-SIGDLI  171 (369)
Q Consensus        97 ~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~---~~ll~TI~SR-cq~~~f~~l-~~~~i~  171 (369)
T Consensus        56 ~~s-pSLFae~RlVvv~~~~~~~~~~~~~l~~yl~~p~~~t~LV~~h~gg~k~Kkl~~~lkk~ga~v~~~~~l~k~~e~~  134 (320)
T PRK07914         56 LLS-PSLFAEERVVVLEAAAEAGKDAVALIESAAADLPAGTVLVVVHSGGGRAKALANQLRKLGAQVHPCARITKASERA  134 (320)
T ss_pred             HHC-CCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHHHCCCEEEECCCCCCHHHHH
T ss_conf             718-6766884499983611026889999999852999980899970587404679999997699898655658868999


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHH
Q ss_conf             67876431013456256644565316764200110001110000001210322000135677777888876301363346
Q 537021.9.peg.4  172 ELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINV  251 (369)
Q Consensus       172 ~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~Ll~ai~~~d~~~a  251 (369)
T Consensus       135 ~~v~~e~~~~g~~i~~~A~~~Lv~~vG~dl~eLaae~~qL~~d~~g~It~~~V~~~~~g~~e~~~F~vaDaa~~g~~~~A  214 (320)
T PRK07914        135 DFVRKEFRSLRVKVDDETVTALLDAVGSDIRELASACSQLVADTGGAVDAAAVRRYHSGKAEVKGFDIADKAVAGDVAGA  214 (320)
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCEEEHHHHHHHHHCCCHHHH
T ss_conf             99999999859999999999999998623999999999996057997369999999289712209999999987899999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCC----CCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             788765430476213578777534899999974574----1223449988999999998629989999999999999998
Q 537021.9.peg.4  252 LQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE----MADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISE  327 (369)
Q Consensus       252 l~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~----~~~~~~~~~~e~~~i~~~a~~i~~~~L~~~lq~l~~a~~~  327 (369)
T Consensus       215 L~~lr~al~~G~~pv~i~~alA~~~R~la~v~~~~~~~~~~A~~lg~~Pw~v~ka~~qar~ws~~~l~~ai~~la~~D~~  294 (320)
T PRK07914        215 AEALRWAMMRGEPHVVLADALAEAVHTIGRVGPLSGDPYRLAGQLGMPPWRVQKAQKQARRWSRDTVATAMRVVAALNAD  294 (320)
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999999749974999999999999999988613998999988299959999999998179999999999999999998


Q ss_pred             HHCCC-CHHHHHHHHHHHHHHHC
Q ss_conf             30278-88999999999995330
Q 537021.9.peg.4  328 IEGFS-RPMEAVEMVLIRLAHAV  349 (369)
Q Consensus       328 Lk~n~-np~L~lE~lLlkL~~~~  349 (369)
T Consensus       295 vKg~~~dp~~alE~~v~~ia~~~  317 (320)
T PRK07914        295 VKGAAADADYALESAVRRVAELV  317 (320)
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHH
T ss_conf             54788887889999999999984