HHsearch alignment for GI: peg_472 and conserved domain: PRK08058

>PRK08058 DNA polymerase III subunit delta'; Validated.
Probab=100.00  E-value=0  Score=542.28  Aligned_cols=316  Identities=23%  Similarity=0.321  Sum_probs=271.7

Q ss_pred             CCC-HHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCC
Q ss_conf             928-4899999999998287670620107879888899999999961468777886658789997799997798778222
Q 537021.9.peg.4    1 MIG-QKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVE   79 (369)
Q Consensus         1 iiG-q~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e   79 (369)
T Consensus         7 ~~~~Q~~i~~~L~~~i~~~rl~HA~Lf~Gp~G~GK~~~A~~~A~~LlC~~~~~~----~~Cg~C~~C~~~~~~~HPD~~~   82 (329)
T PRK08058          7 LTALQPIVVKMLQNSIAKNRLAHAYLFEGAKGTGKKATALWLAKSLFCLERNGV----EPCGTCTNCKRIESGNHPDVHL   82 (329)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCC----CCCCCCHHHHHHHCCCCCCEEE
T ss_conf             883189999999999985996615655789998899999999999739999999----9887888999987699997677


Q ss_pred             CCCCCC-CCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHH
Q ss_conf             453322-3345556655544565420465237751156648001678999997212211146650675433035675433
Q 537021.9.peg.4   80 LDAASH-TSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQ  158 (369)
Q Consensus        80 ~~~~s~-~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq  158 (369)
T Consensus        83 i~p~~~~i~idqiR~L~~~~~~~p~~g~~KV~II~~Ae~m~~~AaNALLKtLEEPp~~t~fIL~t~~~~~lLpTI~SRCq  162 (329)
T PRK08058         83 VAPDGQSIKKDQIRYLKEEFSKSGVESNKKVYIIEHADKMTASAANSLLKFLEEPSGDTTAILLTENKHQILPTILSRCQ  162 (329)
T ss_pred             ECCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECHHHHCHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHCCE
T ss_conf             45661407799999999996438757886799973477629999999999864689786799872996664368863142


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHH
Q ss_conf             32102454001356787643101345625664456531676420011000111000000121032200013567777788
Q 537021.9.peg.4  159 RFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD  238 (369)
Q Consensus       159 ~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~  238 (369)
T Consensus       163 ~i~f~~~~~~~i~~~L~~----~~i--~~~~a~l~a~~~-gs~~~A~~l~~~------~~-~~~---------~~~~~~~  219 (329)
T PRK08058        163 VVEFRPLPPESLIQRLQE----EGI--SESLATLLAQLT-NSVEEALALSED------DW-FAQ---------ARALVIK  219 (329)
T ss_pred             EEECCCCCHHHHHHHHHH----CCC--CHHHHHHHHHHC-CCHHHHHHHHCC------HH-HHH---------HHHHHHH
T ss_conf             565889999999999998----799--989999999878-999999988426------15-899---------9999999


Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHC---CCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHH
Q ss_conf             88763013633467887654304---762135787775348999999745741223449988999999998629989999
Q 537021.9.peg.4  239 LFGYLIKGDIINVLQEFSSQYDS---GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLS  315 (369)
Q Consensus       239 Ll~ai~~~d~~~al~~l~~l~~~---g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a~~i~~~~L~  315 (369)
T Consensus       220 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~~~~rD~l~~~~~~~---~~~~~~d~~~~l~~~a~~~~~~~l~  296 (329)
T PRK08058        220 LYEALHKGDLLSFVFVQTKWMPLFKEKDQQQLGLDLLLLIYRDLLYVQLGEE---DRLVFREQKEELQQLALSYSQQQIV  296 (329)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCC---CHHHCHHHHHHHHHHHHCCCHHHHH
T ss_conf             9999976889999999999998701889999999999999999998741752---0011799999999998539999999


Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             9999999999983027888999999999995
Q 537021.9.peg.4  316 RFWQMILKGISEIEGFSRPMEAVEMVLIRLA  346 (369)
Q Consensus       316 ~~lq~l~~a~~~Lk~n~np~L~lE~lLlkL~  346 (369)
T Consensus       297 ~~~~~i~e~~~~l~~N~N~~L~lE~lll~L~  327 (329)
T PRK08058        297 AALELILEAKRRLNSNVNFQLVMEQLVLRLQ  327 (329)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             9999999999999855899999999999642