HHsearch alignment for GI: peg_472 and conserved domain: PRK08181

>PRK08181 transposase; Validated.
Probab=97.41  E-value=0.00049  Score=49.88  Aligned_cols=104  Identities=14%  Similarity=0.174  Sum_probs=61.7

Q ss_pred             HHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             99982876706201078798888999999999614687778866587899977999977987782224533223345556
Q 537021.9.peg.4   13 NAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVR   92 (369)
Q Consensus        13 ~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir   92 (369)
T Consensus       101 ~fi~~~---~Nvil~Gp~GtGKThLA~Alg~~A-~~~G~~------------------------V~f~~~~--~L~~~L~  150 (269)
T PRK08181        101 SWLAKG---ANLLLFGPPGGGKSHLAAAIGLAL-IENGWR------------------------VLFTRTT--DLVQKLQ  150 (269)
T ss_pred             HHHHCC---CEEEEECCCCCCHHHHHHHHHHHH-HHCCCE------------------------EEEEEHH--HHHHHHH
T ss_conf             588648---708998999987889999999999-987993------------------------9997899--9999999


Q ss_pred             HHH---HHHHHHHHCCCCCEEEEECHH--HCCCCHHHHHHHHHHHCCCCCCEEEEECCC
Q ss_conf             655---544565420465237751156--648001678999997212211146650675
Q 537021.9.peg.4   93 EII---DQIYYKPISARFRVYIMDEVQ--MLSTAAFNGLLKTLEEPPPHVKFIFATTEI  146 (369)
Q Consensus        93 ~l~---~~~~~~p~~~~~kv~iid~a~--~m~~~a~NaLLK~lEEPp~~~~fil~t~~~  146 (369)
T Consensus       151 ~a~~~~~~~~~~~~l~~~dLLIiDe~G~~~~~~~~~~~lf~lI~~Rye~~S~IITSn~~  209 (269)
T PRK08181        151 VARRELQLESAIAKLDKFDLLILDDLAYVTKDQAETSVLFELISARYERRSILITANQP  209 (269)
T ss_pred             HHHHCCCHHHHHHHHHCCCEEEEHHCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             97755839999999744460122010566799899999999999985788889988999