HHsearch alignment for GI: peg_472 and conserved domain: PRK08533

>PRK08533 flagellar accessory protein FlaH; Reviewed.
Probab=96.07  E-value=0.046  Score=35.36  Aligned_cols=137  Identities=15%  Similarity=0.188  Sum_probs=63.3

Q ss_pred             HHHHHHCCCCC--EEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHH-HHHCCCCCCCC---------
Q ss_conf             99999828767--0620107879888899999999961468777886658789997799-99779877822---------
Q 537021.9.peg.4   11 LTNAFKSGRIA--QSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQ-AIIRGNHVDVV---------   78 (369)
Q Consensus        11 l~~~~~~~~~~--ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~-~i~~~~~~d~~---------   78 (369)
T Consensus        13 ld~~lg-gGip~gs~~li~G~~GtGKsi~~~~~~~~~-l~~g~~~~y-is~e~t~~~~i~qm~s-~g~di~~~~~~G~l~   88 (230)
T PRK08533         13 LHKRLG-GGIPFGSIILIEGDESTGKSILSQRLAYGF-LQNGYSVSY-VSSQLTTTEFIKQMMS-LGYDINKKLISGKLL   88 (230)
T ss_pred             HHHHHC-CCCCCCCEEEEECCCCCCHHHHHHHHHHHH-HHCCCEEEE-EEECCCHHHHHHHHHH-CCCCCHHHHHCCCEE
T ss_conf             788717-898898489998689987899999999999-878986999-9943899999999998-699817997579679


Q ss_pred             CCCCCC-CCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHC-----CCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCH
Q ss_conf             245332-2334555665554456542046523775115664-----800167899999721221114665067543303
Q 537021.9.peg.4   79 ELDAAS-HTSIDDVREIIDQIYYKPISARFRVYIMDEVQML-----STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPI  151 (369)
Q Consensus        79 e~~~~s-~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m-----~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~  151 (369)
T Consensus        89 ~i~~~~~~~~~~~~~~~L~~ll~~~~~~~~dvIIIDSlS~l~~~~~~~~~~~~~~~~lk~l~s~gktIilTv~p~~~~e  167 (230)
T PRK08533         89 YIPVYPLLSGNSEKRDFLDKLMNTRRFYEKDVVIIDSLSSLVSRDASEVQIRDLMAFFKRISSLNKVIILTANPKELPE  167 (230)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCH
T ss_conf             9961343354045789999997326643798999905318851677789999999999999858988999956331362