HHsearch alignment for GI: peg_472 and conserved domain: PRK08691

>PRK08691 DNA polymerase III subunits gamma and tau; Validated.
Probab=100.00  E-value=0  Score=689.57  Aligned_cols=343  Identities=36%  Similarity=0.604  Sum_probs=329.6

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC
Q ss_conf             92848999999999982876706201078798888999999999614687778866587899977999977987782224
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVEL   80 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~   80 (369)
T Consensus        18 ~vGQ~~v~~~L~nal~~~rl~haylf~G~rGvGKTt~Ari~Ak~lNC~~~~~~----~pCg~C~~C~~i~~g~~~D~~Ei   93 (704)
T PRK08691         18 LVGQEHVVKALQNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHG----EPCGVCQSCTQIDAGRYVDLLEI   93 (704)
T ss_pred             HCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCC----CCCCCCHHHHHHHCCCCCCEEEE
T ss_conf             41869999999999981997523750278987888999999999679999999----97877776787855899874774


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             53322334555665554456542046523775115664800167899999721221114665067543303567543332
Q 537021.9.peg.4   81 DAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRF  160 (369)
Q Consensus        81 ~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq~~  160 (369)
T Consensus        94 DaAs~~~vdd~R~l~~~~~y~P~~~~yKVyiiDEvhmLs~~afNAlLKtLEEPP~~v~FilaTTdp~Klp~TIlSRC~~f  173 (704)
T PRK08691         94 DAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSKSAFNAMLKTLEEPPEHVKFILATTDPHKVPVTVLSRCLQF  173 (704)
T ss_pred             ECCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEECHHHCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHCCHHHHHHHHHH
T ss_conf             24544588999999985346886785359998315443899999999861479756089985488464758999888771


Q ss_pred             HCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHHHH
Q ss_conf             10245400135678764310134562566445653167642001100011100000012103220001356777778888
Q 537021.9.peg.4  161 DLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF  240 (369)
Q Consensus       161 ~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~Ll  240 (369)
T Consensus       174 ~l~~~~~~~i~~~L~~i~~~E~i~~e~~al~~ia~~a~Gs~RDalslldQaia~~~g~~~~~~v~~mLG~~d~~~~~~ll  253 (704)
T PRK08691        174 VLRNMTAQQVADHLAHVLDSEKIAYEPPALQLLGRAAAGSMRDALSLLDQAIALGSGKVAENDVRQMIGAVDKQYLYELL  253 (704)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHH
T ss_conf             02689999999999999998398568999999999757857779889999999648962699999985888778999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHH
Q ss_conf             76301363346788765430476213578777534899999974574122344998899999999862998999999999
Q 537021.9.peg.4  241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQM  320 (369)
Q Consensus       241 ~ai~~~d~~~al~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a~~i~~~~L~~~lq~  320 (369)
T Consensus       254 ~al~~~d~~~~~~~~~~~~~~~~~~~~~l~~l~~~lh~ia~~q~~p~~~~~---~~~~~~~~~~la~~~~~e~~Ql~Yqi  330 (704)
T PRK08691        254 TGIINQDGAALTAKAQEMAACAVGFDNALGELAILLQQLALIQAVPNALAH---DDPDSDILHRLAQTISGEQIQLYYQI  330 (704)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCHHHCCC---CCCCHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999955899999999999986899999999999999999999858131045---67108999999970899999999999


Q ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             999999830278889999999999953304
Q 537021.9.peg.4  321 ILKGISEIEGFSRPMEAVEMVLIRLAHAVQ  350 (369)
Q Consensus       321 l~~a~~~Lk~n~np~L~lE~lLlkL~~~~~  350 (369)
T Consensus       331 ~l~gr~dl~~ap~~~~g~eM~lLRmlaF~P  360 (704)
T PRK08691        331 AVHGKRDLSLAPDEYAGFMMTLLRMLAFAP  360 (704)
T ss_pred             HHHCCCCCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             982202255699702539999999984588