HHsearch alignment for GI: peg_472 and conserved domain: PRK09087

>PRK09087 hypothetical protein; Validated.
Probab=98.45  E-value=2.2e-06  Score=67.26  Aligned_cols=181  Identities=12%  Similarity=0.149  Sum_probs=112.8

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCC
Q ss_conf             48999999999982876706201078798888999999999614687778866587899977999977987782224533
Q 537021.9.peg.4    4 QKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAA   83 (369)
Q Consensus         4 q~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~   83 (369)
T Consensus        29 N~~a~~~l~~-~~~w~~~-~~~L~Gp~gsGKTHL~~~~~~~~~a~~------------------------------~~~-   75 (226)
T PRK09087         29 NRAAVSLVDR-WPNWPSP-VVVLAGPVGSGKTHLASIWREKADALL------------------------------VHP-   75 (226)
T ss_pred             HHHHHHHHHH-CCCCCCC-EEEEECCCCCCHHHHHHHHHHHHCCEE------------------------------ECH-
T ss_conf             9999999984-7267777-589989999988699999999809968------------------------------366-


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCC-CCCCEEEEECC-CCC---CCHHHHHHH-
Q ss_conf             223345556655544565420465237751156648001678999997212-21114665067-543---303567543-
Q 537021.9.peg.4   84 SHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPP-PHVKFIFATTE-IRK---IPITVLSRC-  157 (369)
Q Consensus        84 s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp-~~~~fil~t~~-~~~---ll~TI~SRc-  157 (369)
T Consensus        76 ~~~~~~----~---~----~~~~~~~~~idd~d~~~~d-Ee~LFhl~N~~~~~~~~LLlts~~~p~~l~~~L~DL~SRL~  143 (226)
T PRK09087         76 NEIGSD----A---A----NAAAERPVLIEDIDAGGFD-ETGLFHLINSVRQAGTSLLMTSRLWPSAWNVKLPDLKSRLK  143 (226)
T ss_pred             HHCCHH----H---H----HHHCCCCEEEECCCCCCCC-HHHHHHHHHHHHHCCCEEEEECCCCHHHCCCCCHHHHHHHH
T ss_conf             874746----6---7----6532798899748777747-89999999999853987999889895666762468999985


Q ss_pred             --HHHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCC---CCCHHHCCCCHHHHHHCCC
Q ss_conf             --33210245400135678764310134562566445653167642001100011---1000000121032200013
Q 537021.9.peg.4  158 --QRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQ---AIARCNDKIVTSSVRLMLA  229 (369)
Q Consensus       158 --q~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq---~i~~~~~~i~~e~v~~llg  229 (369)
T Consensus       144 ~~~~~~I~~pdD~ll~~~L~k~~~~r~l~l~~~v~~yll~r~~Rs~~~l~~~l~~LD~~SL~~kr~ITiplikevL~  220 (226)
T PRK09087        144 AATVVEIGEPDDALLSGVIFKLFADRQLYVEPHVVYYLVSRMERSLFAAQTIVERLDRLALERKSRITRALAAEVLN  220 (226)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             78579835999899999999998757657888899999984588999999999999999998189998999999998