HHsearch alignment for GI: peg_472 and conserved domain: PRK09111

>PRK09111 DNA polymerase III subunits gamma and tau; Validated.
Probab=100.00  E-value=0  Score=753.54  Aligned_cols=365  Identities=59%  Similarity=0.990  Sum_probs=356.8

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCCCCCCCHHHHHHHCCCCCCCCC
Q ss_conf             928489999999999828767062010787988889999999996146877-7886658789997799997798778222
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAH-IDVPTVEFEGFGEHCQAIIRGNHVDVVE   79 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~-~~~~~~~~c~~c~~c~~i~~~~~~d~~e   79 (369)
T Consensus        25 ~~gq~~~~~~l~~~~~~~~~~~a~l~~g~rg~gktt~ari~a~~lnc~~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e  104 (600)
T PRK09111         25 LIGQEAMVRTLRNAFETGRIAQAFMLTGVRGVGKTTTARILARALNYKGPDGVGGPTIDPCGVGEHCQAIMEGRHVDVIE  104 (600)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
T ss_conf             33859999999999972984204764578987899999999999669887666899889899886589886689987588


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             45332233455566555445654204652377511566480016789999972122111466506754330356754333
Q 537021.9.peg.4   80 LDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQR  159 (369)
Q Consensus        80 ~~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq~  159 (369)
T Consensus       105 ~daas~~~v~~~r~~~~~~~~~p~~~~~kv~iidevhmls~~afnallktleepp~~~~fi~att~~~k~p~ti~src~~  184 (600)
T PRK09111        105 MDAASHTGVDDIREIIESVRYRPVSARYKVYIIDEVHMLSTAAFNALLKTLEEPPPHVKFIFATTEIRKVPVTVLSRCQR  184 (600)
T ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCHHHCCHHHHHHHHE
T ss_conf             51554578889999998605388777546999600110579999999987625986549999628534375899854412


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHHH
Q ss_conf             21024540013567876431013456256644565316764200110001110000001210322000135677777888
Q 537021.9.peg.4  160 FDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL  239 (369)
Q Consensus       160 ~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~L  239 (369)
T Consensus       185 f~~~~~~~~~~~~~l~~i~~~e~~~~~~~al~~ia~~a~GS~RDaLSlLDQai~~~~~~i~~~~v~~mLGl~d~~~i~~L  264 (600)
T PRK09111        185 FDLRRIEAEVLAAHLARIAEKEGVEVEPDALALIARAAEGSVRDGLSLLDQAIAHGAGEVTAEQVRDMLGLADRARVIDL  264 (600)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHH
T ss_conf             01057999999999999998607686677999999974898421899999999727987569999998688767789999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             87630136334678876543047621357877753489999997457412234499889999999986299899999999
Q 537021.9.peg.4  240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQ  319 (369)
Q Consensus       240 l~ai~~~d~~~al~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a~~i~~~~L~~~lq  319 (369)
T Consensus       265 l~~i~~Gd~~~aL~~~~~l~~~G~Dp~~iL~dLLeilh~is~~k~~~~~~~~~~lse~E~~~i~~LA~~ls~~~L~~~wQ  344 (600)
T PRK09111        265 FEALMRGDVAAALAEFRAQYDAGADPVVVLRDLAEFVHLVTRLKIVPDAAEDPSLSEDERTRGAEFAKKLSMRVLSRMWQ  344 (600)
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             99998558688999999999859899999999999999999997467510145689999999999985089999999999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             9999999830278889999999999953304999899999765555
Q 537021.9.peg.4  320 MILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEK  365 (369)
Q Consensus       320 ~l~~a~~~Lk~n~np~L~lE~lLlkL~~~~~~~s~~~~~~~~~~~~  365 (369)
T Consensus       345 ilLkg~~El~~a~~p~~alEM~LiRL~~~~~lP~peELLKkL~~~~  390 (600)
T PRK09111        345 MLLKGIAEVQGAPRPLAAAEMVLIRLAHAADLPTPDEAIRRLEEGP  390 (600)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCC
T ss_conf             9998999973089835869999999997233899899999986157