HHsearch alignment for GI: peg_472 and conserved domain: PRK10636

>PRK10636 putative ABC transporter ATP-binding protein; Provisional.
Probab=93.17  E-value=0.19  Score=30.77  Aligned_cols=50  Identities=18%  Similarity=0.170  Sum_probs=31.1

Q ss_pred             CCCCEEEEECHH-HCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHH
Q ss_conf             465237751156-64800167899999721221114665067543303567543
Q 537021.9.peg.4  105 ARFRVYIMDEVQ-MLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRC  157 (369)
Q Consensus       105 ~~~kv~iid~a~-~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRc  157 (369)
T Consensus       166 ~~PdlLLLDEPTnhLD~~~i~~L~~~L~~~~g--tvilVSHDr~-fL~~v~dri  216 (638)
T PRK10636        166 CRSDLLLLDEPTNHLDLDAVIWLEKWLKSYQG--TLILISHDRD-FLDPIVDKI  216 (638)
T ss_pred             CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCC--EEEEEECCHH-HHHHCCCCE
T ss_conf             89998997088888998999999999997698--1999966689-887147716