HHsearch alignment for GI: peg_472 and conserved domain: PRK10875

>PRK10875 recD exonuclease V subunit alpha; Provisional.
Probab=97.90  E-value=9.5e-05  Score=55.16  Aligned_cols=111  Identities=23%  Similarity=0.340  Sum_probs=56.1

Q ss_pred             EEHHCCCCCCCHHHHH-HHHHHHHCCCCCCCCCCCCCCCC-CCHHHHHHHCCC---------CCCCCCCCCCCCCCHHHH
Q ss_conf             6201078798888999-99999961468777886658789-997799997798---------778222453322334555
Q 537021.9.peg.4   23 SYMLSGTRGIGKTTTA-RIIARSLNYKTAHIDVPTVEFEG-FGEHCQAIIRGN---------HVDVVELDAASHTSIDDV   91 (369)
Q Consensus        23 a~lf~G~~G~GK~~~a-~~~A~~l~c~~~~~~~~~~~~c~-~c~~c~~i~~~~---------~~d~~e~~~~s~~~id~i   91 (369)
T Consensus       164 ~~vIsGGPGTGKTttV~~lLa~-l~~~~~~~~-l~I~LaAPTGKAAaRL~Esi~~~~~~l~~~~~~~~~-----~p-~~a  235 (607)
T PRK10875        164 ISVISGGPGTGKTTTVAKLLAA-LIQLADGER-CRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKR-----IP-EDA  235 (607)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH-HHHHCCCCC-CEEEEECCHHHHHHHHHHHHHHHHHHCCCCHHHHHC-----CC-CCC
T ss_conf             7899679998778899999999-999645899-708998822899999999998787534766566633-----76-556


Q ss_pred             HHHHHHHHHHHHCCC----------CCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             665554456542046----------52377511566480016789999972122111466506
Q 537021.9.peg.4   92 REIIDQIYYKPISAR----------FRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATT  144 (369)
Q Consensus        92 r~l~~~~~~~p~~~~----------~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~  144 (369)
T Consensus       236 ~TiHRLLg~~p~~~~f~~~~~nPL~~DvlIVDEASMVDl~Lm~~LL~Al---p~~aRLILvGD  295 (607)
T PRK10875        236 STLHRLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDAL---PDHARVIFLGD  295 (607)
T ss_pred             EEHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC---CCCCEEEEECC
T ss_conf             6589752967898765657799998898999073366599999999828---99988999656