HHsearch alignment for GI: peg_472 and conserved domain: PRK11192

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional.
Probab=93.23  E-value=0.66  Score=26.82  Aligned_cols=51  Identities=14%  Similarity=0.072  Sum_probs=29.5

Q ss_pred             CCCEEEEECHHHCCCCH-HHHHHHHHHHCCCCCCEE-EEECCCCCCCHHHHHH
Q ss_conf             65237751156648001-678999997212211146-6506754330356754
Q 537021.9.peg.4  106 RFRVYIMDEVQMLSTAA-FNGLLKTLEEPPPHVKFI-FATTEIRKIPITVLSR  156 (369)
Q Consensus       106 ~~kv~iid~a~~m~~~a-~NaLLK~lEEPp~~~~fi-l~t~~~~~ll~TI~SR  156 (369)
T Consensus       149 ~l~~lVlDEAD~mld~gF~~~i~~I~~~~~~~~Q~llfSATl~~~~v~~l~~~  201 (417)
T PRK11192        149 AVETLILDEADRMLDMGFAQDVEHIAAETRWRKQTLLFSATLEGDGVQDFAER  201 (417)
T ss_pred             CCCEEEEECCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHHH
T ss_conf             57489996755211135478999998647677238999732684789999998