HHsearch alignment for GI: peg_472 and conserved domain: PRK11361

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional.
Probab=98.54  E-value=2.9e-07  Score=73.67  Aligned_cols=206  Identities=19%  Similarity=0.251  Sum_probs=112.1

Q ss_pred             CCCHHHHHHHHHHHHHCC-CCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCCHHHHHHHC--CCCCC
Q ss_conf             928489999999999828-767062010787988889999999996146877788665-87899977999977--98778
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSG-RIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTV-EFEGFGEHCQAIIR--GNHVD   76 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~-~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~-~~c~~c~~c~~i~~--~~~~d   76 (369)
T Consensus       145 lig~S~~m~~v~~~i~~~A~s~~~VLI~GEsGTGKe~~Ar~IH~~----S~r~~~pFv~vnc~ai~~-~l~eseLFG~--  217 (457)
T PRK11361        145 ILTNSPAMMDICKDTAKIALSQASVLISGESGTGKELIARAIHYN----SRRAKGPFIKVNCAALPE-SLLESELFGH--  217 (457)
T ss_pred             CEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHH----CCCCCCCEEEEECCCCCH-HHHHHHHHCC--
T ss_conf             454699999999999998488995899889985789999999983----798899838764787985-7789997187--


Q ss_pred             CCCCCCCCCCCHHHHH-HHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHC-----------CCCCCEEEEEC
Q ss_conf             2224533223345556-65554456542046523775115664800167899999721-----------22111466506
Q 537021.9.peg.4   77 VVELDAASHTSIDDVR-EIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEP-----------PPHVKFIFATT  144 (369)
Q Consensus        77 ~~e~~~~s~~~id~ir-~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEP-----------p~~~~fil~t~  144 (369)
T Consensus       218 --~-kga-ftga~~~~~G~~e-------~A~gGTLfLdeI~~l~~~~Q~kLLr~L~~~~~~~~g~~~~~~~dvRiIaaT~  286 (457)
T PRK11361        218 --E-KGA-FTGAQTLRQGLFE-------RANEGTLLLDEIGEMPLVLQAKLLRILQEREFERIGGHQTIKVDIRIIAATN  286 (457)
T ss_pred             --C-CCC-CCCCCCCCCCCHH-------HCCCCCEECCCHHHHHHHHHHHHHHHHHCCCEEECCCCCEEEECCEEEECCC
T ss_conf             --6-678-7885314698613-------3599826314664523999999999986492785699713665348996578


Q ss_pred             CC-CC------CCHHHHHHHHH--HHCCCCCC--HHHHH----HHHHHHHHCCC---CCCHHHHHHH-HHCCCCCCCHHH
Q ss_conf             75-43------30356754333--21024540--01356----78764310134---5625664456-531676420011
Q 537021.9.peg.4  145 EI-RK------IPITVLSRCQR--FDLHRISI--GDLIE----LFTKILQEESI---EFDPEAVAMI-ARASDGSARDGL  205 (369)
Q Consensus       145 ~~-~~------ll~TI~SRcq~--~~f~~l~~--~~i~~----~L~~i~~~E~i---~~d~~~l~~i-a~~s~GslR~Al  205 (369)
T Consensus       287 ~~L~~~v~~g~Fr~DLyyrL~~~~i~lPpLReR~eDI~~L~~~fl~~~~~~~~~~~~~~s~~a~~~L~~y~WPGNvREL~  366 (457)
T PRK11361        287 RDLQAMVKEGTFREDLFYRLNVIHLILPPLRDRREDISLLANHFLQKFSSENQRDIIDIDPMAMSLLTAWSWPGNIRELS  366 (457)
T ss_pred             CCHHHHHHCCCCHHHHHHHHCEEEEECCCHHHCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCHHHHHH
T ss_conf             78599987583238899530221251738545875499999999999999749998988999999995699997999999


Q ss_pred             HCCCCCCCHHHCC-CCHHHH
Q ss_conf             0001110000001-210322
Q 537021.9.peg.4  206 SLLDQAIARCNDK-IVTSSV  224 (369)
Q Consensus       206 ~lLeq~i~~~~~~-i~~e~v  224 (369)
T Consensus       367 n~ierav~~~~~~~i~~~~l  386 (457)
T PRK11361        367 NVIERAVVMNSGPIIFSEDL  386 (457)
T ss_pred             HHHHHHHHHCCCCCCCHHHC
T ss_conf             99999998289981566768