HHsearch alignment for GI: peg_472 and conserved domain: PRK11889

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional.
Probab=97.14  E-value=0.0022  Score=45.08  Aligned_cols=119  Identities=18%  Similarity=0.298  Sum_probs=61.8

Q ss_pred             CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHH-------
Q ss_conf             7062010787988889999999996146877788665878999779999779877822245332233455566-------
Q 537021.9.peg.4   21 AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVRE-------   93 (369)
Q Consensus        21 ~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir~-------   93 (369)
T Consensus       241 ~q~IALVGPTGVGKTTTIAKLAArf~~~~KkVALIT------------------tDTYRIG-----AVEQLKTYAeIMgV  297 (436)
T PRK11889        241 VQTIALIGPTGVGKTTTLAKMAWQFHGKKKTVGFIT------------------TDHSRIG-----TVQQLQDYVKTIGF  297 (436)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEE------------------CCCCHHH-----HHHHHHHHHHHHCC
T ss_conf             717999899998889999999999861698089998------------------0663476-----99999999998499


Q ss_pred             ----------HHHHHHHHHHCCCCCEEEEECHHHCCC--CHHHHHHHHHHH-CCCCCCEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             ----------555445654204652377511566480--016789999972-1221114665067543303567543332
Q 537021.9.peg.4   94 ----------IIDQIYYKPISARFRVYIMDEVQMLST--AAFNGLLKTLEE-PPPHVKFIFATTEIRKIPITVLSRCQRF  160 (369)
Q Consensus        94 ----------l~~~~~~~p~~~~~kv~iid~a~~m~~--~a~NaLLK~lEE-Pp~~~~fil~t~~~~~ll~TI~SRcq~~  160 (369)
T Consensus       298 PV~VV~dp~eL~~AL~~lkdka~~DLILIDTAGRS~RD~~~I~EL~~~l~~~~p~ev~LVLSATTK~~DL~eIi~rF~~l  377 (436)
T PRK11889        298 EVIAVRDEAAMTRALTYFKEEARVDYILIDTAGKNYRASETVEEMIETMGQVEPDYICLTLSASMKSKDMIEIITNFKDI  377 (436)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHCCC
T ss_conf             43996888999999998763368888999298988468999999999985127771699997889989999999972579


Q ss_pred             HC
Q ss_conf             10
Q 537021.9.peg.4  161 DL  162 (369)
Q Consensus       161 ~f  162 (369)
T Consensus       378 ~i  379 (436)
T PRK11889        378 HI  379 (436)
T ss_pred             CC
T ss_conf             98