HHsearch alignment for GI: peg_472 and conserved domain: PRK12323

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional.
Probab=100.00  E-value=0  Score=698.43  Aligned_cols=347  Identities=36%  Similarity=0.549  Sum_probs=333.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCC-CCCCCCCCCCCHHHHHHHCCCCCCCCC
Q ss_conf             9284899999999998287670620107879888899999999961468777-886658789997799997798778222
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHI-DVPTVEFEGFGEHCQAIIRGNHVDVVE   79 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~-~~~~~~~c~~c~~c~~i~~~~~~d~~e   79 (369)
T Consensus        18 ~vGQ~~v~~~l~na~~~~r~~haylf~G~rGvGKTt~ari~Ak~lnc~~~~~~~g~~~~pcg~C~~C~~i~~g~~~d~~E   97 (721)
T PRK12323         18 LVGQEHVVRALTHALEQQRLHHAYLFTGTRGVGKTTLSRILAKSLNCTGPDGEGGITAQPCGQCRACTEIDAGRFVDYIE   97 (721)
T ss_pred             HCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE
T ss_conf             32859999999999971997544750279988898999999999768998667898788787765468775689876477


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHH
Q ss_conf             45332233455566555445654204652377511566480016789999972122111466506754330356754333
Q 537021.9.peg.4   80 LDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQR  159 (369)
Q Consensus        80 ~~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~TI~SRcq~  159 (369)
T Consensus        98 iDaas~~~v~~~r~l~~~~~y~P~~~~~KvyiiDevhmls~~afnalLKtlEePP~hv~FilaTT~~~Kip~TilSRc~~  177 (721)
T PRK12323         98 MDAASNRGVDEMAQLLDQAVYAPTAGRFKVYMIDEVHMLTNHAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQ  177 (721)
T ss_pred             EECCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHCCHHHHHHHHH
T ss_conf             43676788899999998545588766446999854000589999999984017975538999438634485889877654


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHHCCCCHHHHHHCCCCCCHHHHHHH
Q ss_conf             21024540013567876431013456256644565316764200110001110000001210322000135677777888
Q 537021.9.peg.4  160 FDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL  239 (369)
Q Consensus       160 ~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~~~i~~e~v~~llg~~~~~~i~~L  239 (369)
T Consensus       178 f~~~~~~~~~i~~~l~~i~~~E~i~~~~~al~~ia~~a~Gs~RDalslldQaia~~~g~~~~~~v~~mlg~~d~~~~~~l  257 (721)
T PRK12323        178 FNLKQMPPGHIVSHLDAILGQEGIGHEGNALRLLAQAAHGSMRDALSLTDQAIAYSAGNVSEEAVRGMLGAIDQRYLVRL  257 (721)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHH
T ss_conf             23478999999999999999839977999999999975896476888999999865896269999998688877899999


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             87630136334678876543047621357877753489999997457412234499889999999986299899999999
Q 537021.9.peg.4  240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQ  319 (369)
Q Consensus       240 l~ai~~~d~~~al~~l~~l~~~g~d~~~iL~~Ll~~~rdll~~k~~~~~~~~~~~~~~e~~~i~~~a~~i~~~~L~~~lq  319 (369)
T Consensus       258 l~al~~~d~~~~~~~~~~~~~~~~d~~~~l~~l~~~lh~ia~~q~~p~~~~---~~~~~~~~~~~la~~~~~e~~Ql~yq  334 (721)
T PRK12323        258 LDALAAEDGAAVLAIADEMADRSLSFAGALQDLASLLSKVALAQRVPAAVQ---DDWPEADDIRRLAGVFDAQAVQLFYQ  334 (721)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCC---CCCHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             999995589999999999998688999999999999999999985620013---55500899999996299999999999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             9999999830278889999999999953304
Q 537021.9.peg.4  320 MILKGISEIEGFSRPMEAVEMVLIRLAHAVQ  350 (369)
Q Consensus       320 ~l~~a~~~Lk~n~np~L~lE~lLlkL~~~~~  350 (369)
T Consensus       335 i~l~gr~dl~~ap~~~~g~eM~lLRmlaf~p  365 (721)
T PRK12323        335 VANLGRSELALAPDEYAGFTMTLLRMLAFNP  365 (721)
T ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHCCC
T ss_conf             9983176651198802509999999985698