HHsearch alignment for GI: peg_472 and conserved domain: PRK12727

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional.
Probab=95.78  E-value=0.056  Score=34.74  Aligned_cols=59  Identities=12%  Similarity=0.086  Sum_probs=36.3

Q ss_pred             CCCCCEEEEECHHHCCCC-HHHHHHHHHHH-CCCCCCEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             046523775115664800-16789999972-122111466506754330356754333210
Q 537021.9.peg.4  104 SARFRVYIMDEVQMLSTA-AFNGLLKTLEE-PPPHVKFIFATTEIRKIPITVLSRCQRFDL  162 (369)
Q Consensus       104 ~~~~kv~iid~a~~m~~~-a~NaLLK~lEE-Pp~~~~fil~t~~~~~ll~TI~SRcq~~~f  162 (369)
T Consensus       424 l~~~~lvliDTaG~~~rd~~~~~~~~~l~~~~~~~~~Lvl~a~~~~~~l~~~~~~~~~~~~  484 (557)
T PRK12727        424 LRDYKLVLIDTAGMGQRDRALAAQLNWLRAARQVTSLLVLPANAHFSDLDEVVRRFAHAKP  484 (557)
T ss_pred             HCCCCEEEEECCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCC
T ss_conf             3699989994999884699999999987514776359999688998999999998537998