HHsearch alignment for GI: peg_472 and conserved domain: PRK13833

>PRK13833 conjugal transfer protein TrbB; Provisional.
Probab=93.72  E-value=0.11  Score=32.49  Aligned_cols=109  Identities=23%  Similarity=0.260  Sum_probs=53.3

Q ss_pred             HHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC--CCCCCHHHHHHHCCCCCCCCCCCCC
Q ss_conf             99999999998287670620107879888899999999961468777886658--7899977999977987782224533
Q 537021.9.peg.4    6 PMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVE--FEGFGEHCQAIIRGNHVDVVELDAA   83 (369)
Q Consensus         6 ~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~--~c~~c~~c~~i~~~~~~d~~e~~~~   83 (369)
T Consensus       132 ~~~~~L~~aV~~r~---nilVsGgTGSGKTTllnaL~~~i~~~~p~eRivtIEDt~EL~~---------~~~n~v~l~~~  199 (323)
T PRK13833        132 AQASTIRSAISSRL---NIVISGGTGSGKTTLANAVIAEIVASAPEDRLVILEDTAEIQC---------AAENAVLLHTS  199 (323)
T ss_pred             HHHHHHHHHHHCCC---CEEEECCCCCCHHHHHHHHHHHHCCCCCHHEEEEECCCCCCCC---------CCCCEEEEECC
T ss_conf             99999999998189---6899917777568999999986402893233999457501146---------78877787516


Q ss_pred             CCCCHHHHHHHHH-HHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCC
Q ss_conf             2233455566555-44565420465237751156648001678999997212211
Q 537021.9.peg.4   84 SHTSIDDVREIID-QIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHV  137 (369)
Q Consensus        84 s~~~id~ir~l~~-~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~  137 (369)
T Consensus       200 ~--~v~-~~~Ll~~aLRmrPD-----RIivGEvR---G~EA~~~L~A~nTGH~Gs  243 (323)
T PRK13833        200 D--TVD-MARLLKSTMRLRPD-----RIIVGEVR---DGAALTLLKAWNTGHPGG  243 (323)
T ss_pred             C--CCC-HHHHHHHHHCCCCC-----EEEEECCC---CHHHHHHHHHHHCCCCCC
T ss_conf             9--869-99999997446997-----58883006---599999999982799986