HHsearch alignment for GI: peg_472 and conserved domain: PRK13946

>PRK13946 shikimate kinase; Provisional.
Probab=96.15  E-value=0.037  Score=36.08  Aligned_cols=39  Identities=28%  Similarity=0.377  Sum_probs=28.9

Q ss_pred             HHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9999982876706201078798888999999999614687778
Q 537021.9.peg.4   11 LTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHID   53 (369)
Q Consensus        11 l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~   53 (369)
T Consensus        14 ~~~~l~kk----nIvLIG~mGsGKStvGk~LA~~L~~~fiD~D   52 (195)
T PRK13946         14 IRAALGKR----TVVLVGLMGAGKSTVGRRLATMLGLPFLDAD   52 (195)
T ss_pred             HHHHHCCC----CEEEECCCCCCHHHHHHHHHHHHCCCEEECH
T ss_conf             99985899----5899899999889999999999797989885