HHsearch alignment for GI: peg_472 and conserved domain: TIGR00602

>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582 To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage. In Saccharomyces cerevisiae the Ddc1/Rad17/Mec3 complex and Rad24 are DNA damage checkpoint components which may promote checkpoint activation by "sensing" DNA damage directly . Rad24 shares sequence homology with RF-c, a protein that recognises DNA template/RNA primer hybrids during DNA replication. The Ddc1 complex has structural homology to proliferating-cell nuclear antigen (PCNA), which clamps onto DNA and confers processivity to DNA polymerases delta and epsilon. Rad24 is postulated to recognise DNA lesions and then recruit the Ddc1 complex to generate checkpoint signals. ; GO: 0006281 DNA repair, 0007049 cell cycle, 0005634 nucleus.
Probab=98.66  E-value=6.2e-07  Score=71.30  Aligned_cols=189  Identities=17%  Similarity=0.246  Sum_probs=108.1

Q ss_pred             EEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCC-CCCCCCCCCCCCCCCHHHHHHHHH----
Q ss_conf             062010787988889999999996146877788665878999779999779-877822245332233455566555----
Q 537021.9.peg.4   22 QSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRG-NHVDVVELDAASHTSIDDVREIID----   96 (369)
Q Consensus        22 ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~-~~~d~~e~~~~s~~~id~ir~l~~----   96 (369)
T Consensus       119 s~LLi~GPsGCgKsT~~k~LsKelg~~~~ew~Np~~~~~~~n~~k~~~~~~~~f~~~PY~---s--q~e~f~efll~a~k  193 (670)
T TIGR00602       119 SILLITGPSGCGKSTTIKILSKELGIKVQEWLNPVLLKEQKNDEKDTLSLESKFSRFPYL---S--QIEVFSEFLLRATK  193 (670)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCEEECCCC---C--HHHHHHHHHHHHHH
T ss_conf             378841755884478999998886445655407878888851244442125402216763---1--45546787642123


Q ss_pred             --HHHHH--HHCCCCCEEEEECHHHCC-----C--CHHHHHHH--HHHHCCCC-CCEEEEECC---------C-----CC
Q ss_conf             --44565--420465237751156648-----0--01678999--99721221-114665067---------5-----43
Q 537021.9.peg.4   97 --QIYYK--PISARFRVYIMDEVQMLS-----T--AAFNGLLK--TLEEPPPH-VKFIFATTE---------I-----RK  148 (369)
Q Consensus        97 --~~~~~--p~~~~~kv~iid~a~~m~-----~--~a~NaLLK--~lEEPp~~-~~fil~t~~---------~-----~~  148 (369)
T Consensus       194 Y~~lQ~lG~~~~~~kk~Il~e~lPhln~F~~d~~rr~~~~vlr~~~~~~g~~pPlv~~~te~~~~nlegdNnq~kfGir~  273 (670)
T TIGR00602       194 YNKLQKLGDDLQTDKKLILVEDLPHLNKFYRDLDRRALREVLRTKYVSEGRLPPLVIIITESELNNLEGDNNQDKFGIRL  273 (670)
T ss_pred             HHHHHHCCCCCCCCCCEEEECCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCHHCCCCC
T ss_conf             46664214110247545772137640221366126899999999862378988358997124344457755510104101


Q ss_pred             CCH--H-----HHHHH--HHHHCCCCCCHHHHHHHHHHHHHCCCCC-------CHHHHHHHHHCCCCCCCHHHHCCCCCC
Q ss_conf             303--5-----67543--3321024540013567876431013456-------256644565316764200110001110
Q 537021.9.peg.4  149 IPI--T-----VLSRC--QRFDLHRISIGDLIELFTKILQEESIEF-------DPEAVAMIARASDGSARDGLSLLDQAI  212 (369)
Q Consensus       149 ll~--T-----I~SRc--q~~~f~~l~~~~i~~~L~~i~~~E~i~~-------d~~~l~~ia~~s~GslR~Al~lLeq~i  212 (369)
T Consensus       274 ~F~~~~IM~~~il~~pr~~~i~FNPiapT~mkK~L~~I~~~e~~~~~~K~~~~~~~~ve~~c~~~~GDiRSAInsL-Qfs  352 (670)
T TIGR00602       274 LFPAVTIMNKEILEEPRVSNIKFNPIAPTLMKKFLNRIVTKEAKKKGEKILVPKKTSVEDLCQGESGDIRSAINSL-QFS  352 (670)
T ss_pred             CCCHHHHHHHHHHCCCCCCCEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHH-HHH
T ss_conf             3525777526654077613100178717899998555621314346785446634689999710688478888888-864


Q ss_pred             CHHH
Q ss_conf             0000
Q 537021.9.peg.4  213 ARCN  216 (369)
Q Consensus       213 ~~~~  216 (369)
T Consensus       353 ~s~s  356 (670)
T TIGR00602       353 SSKS  356 (670)
T ss_pred             HHHC
T ss_conf             3202