HHsearch alignment for GI: peg_472 and conserved domain: TIGR00635

>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.; GO: 0003677 DNA binding, 0005524 ATP binding, 0009378 Holliday junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination.
Probab=99.69  E-value=1.4e-16  Score=142.37  Aligned_cols=174  Identities=25%  Similarity=0.296  Sum_probs=132.0

Q ss_pred             CCHHHHHHHHHHHHH-----CCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC
Q ss_conf             284899999999998-----287670620107879888899999999961468777886658789997799997798778
Q 537021.9.peg.4    2 IGQKPMIKTLTNAFK-----SGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVD   76 (369)
Q Consensus         2 iGq~~~~~~l~~~~~-----~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d   76 (369)
T Consensus         7 iGQ~~vk~~L~l~I~AAk~R~e~LDH-~LL~GPPGLGKTTLA~IiA~Emg~~l~iTsGP~L~------------------   67 (305)
T TIGR00635         7 IGQEKVKEQLQLFIEAAKMRQEALDH-LLLYGPPGLGKTTLAHIIANEMGVNLKITSGPALE------------------   67 (305)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCC-EEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCC------------------
T ss_conf             58288999999999999824897341-66317568746789999999838932674067554------------------


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCC----------CC--------CC
Q ss_conf             2224533223345556655544565420465237751156648001678999997212----------21--------11
Q 537021.9.peg.4   77 VVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPP----------PH--------VK  138 (369)
Q Consensus        77 ~~e~~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp----------~~--------~~  138 (369)
T Consensus        68 -------------kPgDlaaiLt~L-~~gD--VLFIDEIHRL~p~~EE~LYpAMEDF~lDi~IG~Gp~Ar~v~ldLpPFT  131 (305)
T TIGR00635        68 -------------KPGDLAAILTNL-EEGD--VLFIDEIHRLSPAIEELLYPAMEDFRLDIVIGKGPSARSVRLDLPPFT  131 (305)
T ss_pred             -------------CHHHHHHHHHHC-CCCC--EEECCHHHHCCHHHHHHCCCCCCCEEEEEEEECCCCCCEEEECCCCCC
T ss_conf             -------------757899999705-6896--310125650483345310530012178778712898525760686944


Q ss_pred             EEEEECCCCCCCHHHHHHH-HHHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCC
Q ss_conf             4665067543303567543-33210245400135678764310134562566445653167642001100011
Q 537021.9.peg.4  139 FIFATTEIRKIPITVLSRC-QRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQ  210 (369)
Q Consensus       139 fil~t~~~~~ll~TI~SRc-q~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq  210 (369)
T Consensus       132 LvGATTR~G~lt~PLrdRFG~~~rl~fY~~~EL~~Iv~R~A~~L~~ei~~~~a~~IArrSRGTPRIAnRLLRR  204 (305)
T TIGR00635       132 LVGATTRAGMLTSPLRDRFGIILRLEFYTPEELAEIVSRSAGLLNIEIEQEAALEIARRSRGTPRIANRLLRR  204 (305)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             2000034774103133454474540268987899998753344143007789999987547863788877676