HHsearch alignment for GI: peg_472 and conserved domain: TIGR01242

>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system. The 26S proteasome (a 2 MDa complex) is made up of two subcomplexes: the 20S proteasome and the regulatory complex. The former is a 700 kDa cylindrical protease complex consisting of four stacks of heptameric rings with 28 subunits (i.e., 7777) with molecular masses of about 20-35 kDa, whereas the latter is a 700-1000 kDa complex consisting of at least 18 subunits with molecular masses of 28-110 kDa, including 6 putative ATPases (Rpt1-Rpt6) and 12 non-ATPase subunits (Rpn1-12). Members of the 26S proteasome subunit P45 family: ATPase p45/Sug1/Rpt6 may be phosphorylated within the proteasome. This phosphorylation event may play a key role in ATP-dependent proteolysis because a good correlation exists between the inhibition pattern of protein kinase inhibitors against the phosphorylation of p45 and that against the ATP-dependent proteolytic activity , . More information about these protein can be found at Protein of the Month: AAA ATPases .; GO: 0016787 hydrolase activity, 0030163 protein catabolic process, 0005634 nucleus, 0005737 cytoplasm.
Probab=97.95  E-value=2.8e-05  Score=59.13  Aligned_cols=156  Identities=21%  Similarity=0.301  Sum_probs=90.7

Q ss_pred             CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCC-CCCCCCCHHHHHHHHHHHH
Q ss_conf             706201078798888999999999614687778866587899977999977987782224-5332233455566555445
Q 537021.9.peg.4   21 AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVEL-DAASHTSIDDVREIIDQIY   99 (369)
Q Consensus        21 ~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~-~~~s~~~id~ir~l~~~~~   99 (369)
T Consensus       156 PKGvLLyGPPGtGKTLlAKAvA~et~ATFIrvV-------g-----SElV~------KyIGE-----GArLV~~~F~LAk  212 (364)
T TIGR01242       156 PKGVLLYGPPGTGKTLLAKAVAHETNATFIRVV-------G-----SELVR------KYIGE-----GARLVREVFELAK  212 (364)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHCCCCCEEEEEE-------H-----HHHHH------HHHCC-----HHHHHHHHHHHHH
T ss_conf             986570075797688999986314551268860-------4-----44444------44133-----1689999999853


Q ss_pred             HHHHCCCCCEEEEECHHHCC-----------CCHHHHHHHHHHH-----CCCCCCEEEEECCCCCCCHHHHHHH---HHH
Q ss_conf             65420465237751156648-----------0016789999972-----1221114665067543303567543---332
Q 537021.9.peg.4  100 YKPISARFRVYIMDEVQMLS-----------TAAFNGLLKTLEE-----PPPHVKFIFATTEIRKIPITVLSRC---QRF  160 (369)
Q Consensus       100 ~~p~~~~~kv~iid~a~~m~-----------~~a~NaLLK~lEE-----Pp~~~~fil~t~~~~~ll~TI~SRc---q~~  160 (369)
T Consensus       213 ----EKaPsIiFIDEiDAiaakR~~~~TsGdREV~RTlmQLLAElDGFd~rg~VkviaATNR~DilDPA~LRPGRFDR~I  288 (364)
T TIGR01242       213 ----EKAPSIIFIDEIDAIAAKRVDSSTSGDREVQRTLMQLLAELDGFDPRGNVKVIAATNRPDILDPAILRPGRFDRII  288 (364)
T ss_pred             ----CCCCCEEEEECHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCHHCCCCCCCCCCCCCEE
T ss_conf             ----0698168610133354321146778731578899999975248887676168872076202043214888613257


Q ss_pred             HCCCCCCHHHHHHHHHHHHHCCCCCCHH-HHHHHHHCCCCCCCHHH
Q ss_conf             1024540013567876431013456256-64456531676420011
Q 537021.9.peg.4  161 DLHRISIGDLIELFTKILQEESIEFDPE-AVAMIARASDGSARDGL  205 (369)
Q Consensus       161 ~f~~l~~~~i~~~L~~i~~~E~i~~d~~-~l~~ia~~s~GslR~Al  205 (369)
T Consensus       289 EV-PlP~~~GR~eIlki-HTr~~~la~dVdl~~~A~~TeG~sGAdl  332 (364)
T TIGR01242       289 EV-PLPDFEGRLEILKI-HTRKMKLAEDVDLEAIAKLTEGASGADL  332 (364)
T ss_pred             EC-CCCCCCCHHHHHHH-HHCCCCCCCCCCHHHHHHHHCCCCCCHH
T ss_conf             31-69783220566555-2100001235687999987478866304