HHsearch alignment for GI: peg_472 and conserved domain: TIGR01243

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR005938 The ATPase Cdc48 is required for membrane fusion and protein degradation. It possesses chaperone-like activities and can functionally interact with Hsc70. Yeast CDC48 plays a role in cell division control whereas eukaryotic homologues are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.; GO: 0016787 hydrolase activity.
Probab=97.22  E-value=0.0012  Score=46.98  Aligned_cols=112  Identities=20%  Similarity=0.234  Sum_probs=66.5

Q ss_pred             CCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             67062010787988889999999996146877788665878999779999779877822245332233455566555445
Q 537021.9.peg.4   20 IAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIY   99 (369)
Q Consensus        20 ~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir~l~~~~~   99 (369)
T Consensus       239 PPkG~ll~GPPGtGktllaka~ane~~a~f~~inGPei------------msky------~-G---e~e~~lr~if~eae  296 (980)
T TIGR01243       239 PPKGVLLYGPPGTGKTLLAKAVANEAGAYFIAINGPEI------------MSKY------Y-G---ESEERLREIFKEAE  296 (980)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCHH------------HHHH------C-C---CCHHHHHHHHHHHH
T ss_conf             98735875589861789999987530551788506034------------4331------3-6---30789999998653


Q ss_pred             HHHHCCCCCEEEEECHHHCCC-----------CHHHHHHHHHHH--CCCCCCEEEEECCCCCCCHHHHHHH
Q ss_conf             654204652377511566480-----------016789999972--1221114665067543303567543
Q 537021.9.peg.4  100 YKPISARFRVYIMDEVQMLST-----------AAFNGLLKTLEE--PPPHVKFIFATTEIRKIPITVLSRC  157 (369)
Q Consensus       100 ~~p~~~~~kv~iid~a~~m~~-----------~a~NaLLK~lEE--Pp~~~~fil~t~~~~~ll~TI~SRc  157 (369)
T Consensus       297 ----enaP~iifideidaiaPkr~e~~Geve~r~v~qlltlmdGlk~rG~v~viGatnrP~a~dPalrrPG  363 (980)
T TIGR01243       297 ----ENAPSIIFIDEIDAIAPKREEVTGEVEKRVVAQLLTLMDGLKGRGKVIVIGATNRPDALDPALRRPG  363 (980)
T ss_pred             ----HCCCCEEEEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHCCCC
T ss_conf             ----0587078741211007641000016889999999999740024872899814688500262242788