HHsearch alignment for GI: peg_472 and conserved domain: TIGR01447

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. C-terminal part of the protein matches a domain found in viral RNA helicase, superfamily 1, IPR000606 from INTERPRO. ; GO: 0008854 exodeoxyribonuclease V activity, 0009338 exodeoxyribonuclease V complex.
Probab=96.22  E-value=0.026  Score=37.13  Aligned_cols=139  Identities=19%  Similarity=0.316  Sum_probs=67.9

Q ss_pred             EEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC-----CCCCCCCHH-HHHHHCCCCCCCC-C---CCCCC----CCCH
Q ss_conf             6201078798888999999999614687778866-----587899977-9999779877822-2---45332----2334
Q 537021.9.peg.4   23 SYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPT-----VEFEGFGEH-CQAIIRGNHVDVV-E---LDAAS----HTSI   88 (369)
Q Consensus        23 a~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~-----~~~c~~c~~-c~~i~~~~~~d~~-e---~~~~s----~~~i   88 (369)
T Consensus       244 f~li~GGPGTGKTTTv~~LL~al~~~~~~~G~~~~~I~l~APTGKAa~RL~esl~~~~~~L~~~~~aid~~~~~~~~~~~  323 (753)
T TIGR01447       244 FSLITGGPGTGKTTTVARLLLALIKQSPKQGKPRLRIALAAPTGKAAARLAESLRKAVKKLAAENMAIDEDLIAALPSEA  323 (753)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCHHH
T ss_conf             68998798897789999999999998986499740478866844799999999998863223423665879854872045


Q ss_pred             HHHHHHHHHHH-----HHHHCC---CCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCC--------EEEEECCCCCCCHH
Q ss_conf             55566555445-----654204---652377511566480016789999972122111--------46650675433035
Q 537021.9.peg.4   89 DDVREIIDQIY-----YKPISA---RFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVK--------FIFATTEIRKIPIT  152 (369)
Q Consensus        89 d~ir~l~~~~~-----~~p~~~---~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~--------fil~t~~~~~ll~T  152 (369)
T Consensus       324 ~TiHrLLG~~~I~~~~fr~h~~N~L~~DVLvvDEaSMVdl~lm~kL~~A~---~~~~k~~KLy~~~LIllGD~-nQL---  396 (753)
T TIGR01447       324 TTIHRLLGIKPIDTKRFRHHERNPLPLDVLVVDEASMVDLPLMAKLLKAL---PPNTKDKKLYADRLILLGDK-NQL---  396 (753)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEECCCHHCCHHHHHHHHHHC---CCCCCCCCHHHCCCCEECCC-CCC---
T ss_conf             68888616614787677677778898552787060022679999999722---63001320101020012267-888---


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             67543332102454001356787643
Q 537021.9.peg.4  153 VLSRCQRFDLHRISIGDLIELFTKIL  178 (369)
Q Consensus       153 I~SRcq~~~f~~l~~~~i~~~L~~i~  178 (369)
T Consensus       397 ----------~sveaG~Vl~~l~~~~  412 (753)
T TIGR01447       397 ----------PSVEAGAVLGDLCELA  412 (753)
T ss_pred             ----------CCCCHHHHHHHHHHHH
T ss_conf             ----------8754355579999997