HHsearch alignment for GI: peg_472 and conserved domain: TIGR01967

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222 This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterised, is about 800 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing.; GO: 0005524 ATP binding, 0008026 ATP-dependent helicase activity.
Probab=96.61  E-value=0.011  Score=40.05  Aligned_cols=142  Identities=20%  Similarity=0.304  Sum_probs=72.9

Q ss_pred             HHHHHHHHCCCCCEEEHHCCCCCCCHHH-------------------------HHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             9999999828767062010787988889-------------------------999999996146877788665878999
Q 537021.9.peg.4    9 KTLTNAFKSGRIAQSYMLSGTRGIGKTT-------------------------TARIIARSLNYKTAHIDVPTVEFEGFG   63 (369)
Q Consensus         9 ~~l~~~~~~~~~~ha~lf~G~~G~GK~~-------------------------~a~~~A~~l~c~~~~~~~~~~~~c~~c   63 (369)
T Consensus        75 edI~~AI~~nQ---VviiAGETGSGKTTQLPKICLELGrG~~GlIGHTQPRRlAAR~VA~R~AeELgt-------plGe~  144 (1320)
T TIGR01967        75 EDIAKAIAENQ---VVIIAGETGSGKTTQLPKICLELGRGSRGLIGHTQPRRLAARSVAERVAEELGT-------PLGEL  144 (1320)
T ss_pred             HHHHHHHHHCC---EEEEECCCCCCCCCCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCC-------CCCCC
T ss_conf             99999998489---899972448762023216777542787654124714688999999999998388-------98861


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCHHHHHH--HHHHHHHHHHCCCCCEEEEECHH--HCCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             779999779877822245332233455566--55544565420465237751156--64800167899999721221114
Q 537021.9.peg.4   64 EHCQAIIRGNHVDVVELDAASHTSIDDVRE--IIDQIYYKPISARFRVYIMDEVQ--MLSTAAFNGLLKTLEEPPPHVKF  139 (369)
Q Consensus        64 ~~c~~i~~~~~~d~~e~~~~s~~~id~ir~--l~~~~~~~p~~~~~kv~iid~a~--~m~~~a~NaLLK~lEEPp~~~~f  139 (369)
T Consensus       145 VG---Y-kVRF~D~v----~~~t~VKLmTDGiLLAE~Q~DRfL~~YDTIIIDEAHERSLNIDFLLGYLK~lL~rRPDLKi  216 (1320)
T TIGR01967       145 VG---Y-KVRFEDQV----SSNTLVKLMTDGILLAETQQDRFLERYDTIIIDEAHERSLNIDFLLGYLKQLLPRRPDLKI  216 (1320)
T ss_pred             CC---C-EEEECCCC----CCCCEEEEHHHHHHHHHHHHHHHHHHCCCEEECCHHHHHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             32---0-36631426----8854363032235899852002221067336511231123388999888763266886525


Q ss_pred             EEEE--CCCCC----------CCHHHHH---HHHHHHC--CCCCCH
Q ss_conf             6650--67543----------3035675---4333210--245400
Q 537021.9.peg.4  140 IFAT--TEIRK----------IPITVLS---RCQRFDL--HRISIG  168 (369)
Q Consensus       140 il~t--~~~~~----------ll~TI~S---Rcq~~~f--~~l~~~  168 (369)
T Consensus       217 IITSATID~ERFs~HFn~AeGkPaPIIEVSGRTyPVe~RYRPL~~~  262 (1320)
T TIGR01967       217 IITSATIDPERFSRHFNNAEGKPAPIIEVSGRTYPVEVRYRPLVEE  262 (1320)
T ss_pred             EEECCCCCHHHHHHHHCCCCCCCCCEEEECCCCCCCCEEECCCCCC
T ss_conf             7400235744687862278889887555278546651111687644