HHsearch alignment for GI: peg_472 and conserved domain: TIGR02639

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=98.82  E-value=2.1e-08  Score=82.13  Aligned_cols=168  Identities=20%  Similarity=0.321  Sum_probs=115.7

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCC-CCCCC--
Q ss_conf             928489999999999828767062010787988889999999996146877788665878999779999779-87782--
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRG-NHVDV--   77 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~-~~~d~--   77 (369)
T Consensus       210 LIGRE~EleRtiQvLCRR~KNN-Pl~VGEPGVGKTAI~EGLA~~I------------------------~~~~kvPe~Lk  264 (774)
T TIGR02639       210 LIGREDELERTIQVLCRRKKNN-PLLVGEPGVGKTAIVEGLAQRI------------------------AEGQKVPEVLK  264 (774)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCC-CCEECCCCCCHHHHHHHHHHHH------------------------HCCCCCCHHHC
T ss_conf             3456688742333203456788-7204488864489999999986------------------------41564670024


Q ss_pred             ----CCCCC----CC--CCC-H-HHHHHHHHHHHHHHHCCCCC-EEEEECHHHC---------CCCHHHHHHHHHHHCCC
Q ss_conf             ----22453----32--233-4-55566555445654204652-3775115664---------80016789999972122
Q 537021.9.peg.4   78 ----VELDA----AS--HTS-I-DDVREIIDQIYYKPISARFR-VYIMDEVQML---------STAAFNGLLKTLEEPPP  135 (369)
Q Consensus        78 ----~e~~~----~s--~~~-i-d~ir~l~~~~~~~p~~~~~k-v~iid~a~~m---------~~~a~NaLLK~lEEPp~  135 (369)
T Consensus       265 n~~IY~LDmG~LLAGTKYRGDFE~RLK~V~~Ei~~~~----~anILFIDEIHTIVGAGATSGGsmDASNLLKPaL~~--G  338 (774)
T TIGR02639       265 NAKIYSLDMGTLLAGTKYRGDFEERLKAVVSEIEKEP----NANILFIDEIHTIVGAGATSGGSMDASNLLKPALAS--G  338 (774)
T ss_pred             CCCEEEECHHHHHHHCCCCCHHHHHHHHHHHHHHCCC----CCCEEEEECCCCEEECCCCCCHHHHHHHHHHHHHHC--C
T ss_conf             7834540434564102454247899999999985289----995466411010331787875155244321125307--8


Q ss_pred             CCCEEEEECCCC--CCC---HHHHHHHHHHHCCCCCCHHHHHHHHHHHHH----CCCCCCHHHHHHHHHCCCC
Q ss_conf             111466506754--330---356754333210245400135678764310----1345625664456531676
Q 537021.9.peg.4  136 HVKFIFATTEIR--KIP---ITVLSRCQRFDLHRISIGDLIELFTKILQE----ESIEFDPEAVAMIARASDG  199 (369)
Q Consensus       136 ~~~fil~t~~~~--~ll---~TI~SRcq~~~f~~l~~~~i~~~L~~i~~~----E~i~~d~~~l~~ia~~s~G  199 (369)
T Consensus       339 ~iRCIGsTTy~EY~~~FeKDrALsRRFQKIDv~EPs~eet~~ILkGLk~~YE~fH~V~Y~~eal~~Av~LS~r  411 (774)
T TIGR02639       339 KIRCIGSTTYEEYKNHFEKDRALSRRFQKIDVGEPSIEETVKILKGLKEQYEEFHHVKYSDEALEAAVELSAR  411 (774)
T ss_pred             CEEEECCCCHHHHHCHHHCCCCCCCCCCEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHH
T ss_conf             7786226524864111010202165423311795788899999986554201325011386999999999888