HHsearch alignment for GI: peg_472 and conserved domain: TIGR02903

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria. Proteins in this entry are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ). They are restricted to a subset of endospore-forming species, and probably participate in the program of endospore formation. We propose the designation LonC..
Probab=99.77  E-value=9.9e-19  Score=158.30  Aligned_cols=182  Identities=26%  Similarity=0.403  Sum_probs=132.9

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHH---HHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCC
Q ss_conf             928489999999999828767062010787988889999999---99614687778866587899977999977987782
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIA---RSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDV   77 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A---~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~   77 (369)
T Consensus       157 iVGQerAI~aLlaK~aSPfPQH-iiLYGPPGVGKTTaARl~LEe~K~~~~tPF~~DA---------------------~F  214 (616)
T TIGR02903       157 IVGQERAIKALLAKLASPFPQH-IILYGPPGVGKTTAARLALEEAKKLKNTPFAEDA---------------------PF  214 (616)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCC-EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCC---------------------CE
T ss_conf             3334689999997631888660-7855733884789999987621368744761137---------------------85


Q ss_pred             CCCCCCC---------C---CCHHH------HHHHHHHH--------HHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHH
Q ss_conf             2245332---------2---33455------56655544--------565420465237751156648001678999997
Q 537021.9.peg.4   78 VELDAAS---------H---TSIDD------VREIIDQI--------YYKPISARFRVYIMDEVQMLSTAAFNGLLKTLE  131 (369)
Q Consensus        78 ~e~~~~s---------~---~~id~------ir~l~~~~--------~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lE  131 (369)
T Consensus       215 vEVDGtTLRWDPREvTNPLLGSVHDPIYQGa~RDLAE~GvPEPk~GLVT~AHGG---vLFIDEIGELD~lLQnKLLKVLE  291 (616)
T TIGR02903       215 VEVDGTTLRWDPREVTNPLLGSVHDPIYQGARRDLAETGVPEPKLGLVTDAHGG---VLFIDEIGELDPLLQNKLLKVLE  291 (616)
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCC---EEEEECHHHHHHHHHHHHHHHHC
T ss_conf             751576266774101477677625765567640110478798989871004775---67650211222787632444322


Q ss_pred             HCCCC--------------------------CCEEE---EECCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             21221--------------------------11466---50675433035675433321024540013567876431013
Q 537021.9.peg.4  132 EPPPH--------------------------VKFIF---ATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES  182 (369)
Q Consensus       132 EPp~~--------------------------~~fil---~t~~~~~ll~TI~SRcq~~~f~~l~~~~i~~~L~~i~~~E~  182 (369)
T Consensus       292 DKrV~F~SsYYDpdD~NvPkYIK~lFe~GAPADFvLIGATTr~P~eINpALRSRCaEvfFePL~p~dI~~Iv~~AA~kln  371 (616)
T TIGR02903       292 DKRVEFSSSYYDPDDENVPKYIKKLFEEGAPADFVLIGATTRDPEEINPALRSRCAEVFFEPLTPEDIKEIVLNAAEKLN  371 (616)
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCHHHCCHHHHCCCCEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             64366532124875378655888852268882568726615882440512330143132179887899999999888617


Q ss_pred             CCCCHHHHHHHHHCC-CCCCCHHHHCCC
Q ss_conf             456256644565316-764200110001
Q 537021.9.peg.4  183 IEFDPEAVAMIARAS-DGSARDGLSLLD  209 (369)
Q Consensus       183 i~~d~~~l~~ia~~s-~GslR~Al~lLe  209 (369)
T Consensus       372 v~L~~gV~e~Ia~YTieG--RkAvnILA  397 (616)
T TIGR02903       372 VKLAEGVEELIARYTIEG--RKAVNILA  397 (616)
T ss_pred             CCCCCCHHHHHHHCCCCC--HHHHHHHH
T ss_conf             700036487872147131--12223465