HHsearch alignment for GI: peg_472 and conserved domain: TIGR03522

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=93.92  E-value=0.23  Score=30.17  Aligned_cols=46  Identities=15%  Similarity=0.206  Sum_probs=29.3

Q ss_pred             HCCCCCEEEEECH-HHCCCCHHHHHHHHHHHCCCCCCEEEEECCCCC
Q ss_conf             2046523775115-664800167899999721221114665067543
Q 537021.9.peg.4  103 ISARFRVYIMDEV-QMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRK  148 (369)
Q Consensus       103 ~~~~~kv~iid~a-~~m~~~a~NaLLK~lEEPp~~~~fil~t~~~~~  148 (369)
T Consensus       148 L~~~P~lliLDEPt~GLDp~~~~~~~~~l~~l~~~~TillssH~l~e  194 (301)
T TIGR03522       148 LIHDPKVLILDEPTTGLDPNQLVEIRNVIKNIGKDKTIILSTHIMQE  194 (301)
T ss_pred             HCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHH
T ss_conf             70799899994886678989999999999987599999998785899