HHsearch alignment for GI: peg_472 and conserved domain: pfam00448

>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=97.62  E-value=0.00028  Score=51.70  Aligned_cols=137  Identities=15%  Similarity=0.100  Sum_probs=65.6

Q ss_pred             CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCC-CCCCCCCCCCCCCCCHHHHHHHHH-HH
Q ss_conf             7062010787988889999999996146877788665878999779999779-877822245332233455566555-44
Q 537021.9.peg.4   21 AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRG-NHVDVVELDAASHTSIDDVREIID-QI   98 (369)
Q Consensus        21 ~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~-~~~d~~e~~~~s~~~id~ir~l~~-~~   98 (369)
T Consensus         1 P~vi~lvGptGvGKTTTiaKLAa~~~~~~~---~V~lit~Dt~R~-gA~eQL~~ya~~l~v~~~~~~~~~d~~~~~~~~l   76 (196)
T pfam00448         1 PNVILLVGLQGSGKTTTIAKLAAYLKKQGK---KVLLVAADTFRA-AAIEQLKQLAERLGVPVFGSGTGSDPAAVAFDAV   76 (196)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCC---EEEEEECCCCCH-HHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHH
T ss_conf             969999899999889999999999997799---289997587768-8999999999863981781487778789999999


Q ss_pred             HHHHHCCCCCEEEEECHHHCCCCHH--HHHHHHHHH-CCCCCCEEEEECCCCCCCHHHHHHHHHHHC
Q ss_conf             5654204652377511566480016--789999972-122111466506754330356754333210
Q 537021.9.peg.4   99 YYKPISARFRVYIMDEVQMLSTAAF--NGLLKTLEE-PPPHVKFIFATTEIRKIPITVLSRCQRFDL  162 (369)
Q Consensus        99 ~~~p~~~~~kv~iid~a~~m~~~a~--NaLLK~lEE-Pp~~~~fil~t~~~~~ll~TI~SRcq~~~f  162 (369)
T Consensus        77 ~~~-~~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~~~~~~LVl~a~~~~~~~~~~~~f~~~~~~  142 (196)
T pfam00448        77 EKA-KAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIAPDEVLLVLDATTGQNALNQAKAFNEAVGI  142 (196)
T ss_pred             HHH-HHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             998-846899999989998747677899999998522873028998567782137899987600477