HHsearch alignment for GI: peg_472 and conserved domain: pfam02572

>pfam02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP. This family consists of the BtuR, CobO, CobP proteins all of which are Cob(I)alamin adenosyltransferase, EC:2.5.1.17, involved in cobalamin (vitamin B12) biosynthesis. These enzymes catalyse the adenosylation reaction: ATP + cob(I)alamin + H2O <= phosphate + diphosphate + adenosylcobalamin.
Probab=94.30  E-value=0.41  Score=28.35  Aligned_cols=118  Identities=18%  Similarity=0.191  Sum_probs=64.0

Q ss_pred             EEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCC-CCCC---CCCCCHHHHHHHCCCCCCCCCCC-C-----CCCC---CHH
Q ss_conf             62010787988889999999996146877788-6658---78999779999779877822245-3-----3223---345
Q 537021.9.peg.4   23 SYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVE---FEGFGEHCQAIIRGNHVDVVELD-A-----ASHT---SID   89 (369)
Q Consensus        23 a~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~-~~~~---~c~~c~~c~~i~~~~~~d~~e~~-~-----~s~~---~id   89 (369)
T Consensus         6 i~iytG~-GKGKTTAAlGlalRA~G~G~rV~ivQFlKg~~~~GE~~~l~~-----l~~v~~~~~g~gf~~~~~~~~~d~~   79 (172)
T pfam02572         6 LIVYTGN-GKGKSTAAFGMALRALGHGMRVGVVQFIKGKWETGEEAALEA-----LPEVEWHVMGEGFTWETQDRERDIA   79 (172)
T ss_pred             EEEEECC-CCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHH-----CCCCEEEECCCCCCCCCCCCHHHHH
T ss_conf             9999579-997188999999998259988999999538877638999987-----8996899788998587888788999


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEEECHH-HCC--CCHHHHHHHHHHHCCCCCCEEEEECCC
Q ss_conf             556655544565420465237751156-648--001678999997212211146650675
Q 537021.9.peg.4   90 DVREIIDQIYYKPISARFRVYIMDEVQ-MLS--TAAFNGLLKTLEEPPPHVKFIFATTEI  146 (369)
Q Consensus        90 ~ir~l~~~~~~~p~~~~~kv~iid~a~-~m~--~~a~NaLLK~lEEPp~~~~fil~t~~~  146 (369)
T Consensus        80 ~a~~~~~~a~~~l~~~~~dlvVLDEi~~ai~~gli~~~~v~~~l~~rp~~~evVlTGr~~  139 (172)
T pfam02572        80 AAREAWEKAKEALASGSYDLVVLDELNYALKYGYLDLEEVLELLRNRPEGQHVVLTGRGA  139 (172)
T ss_pred             HHHHHHHHHHHHHHCCCCCEEEEHHHHHHHHCCCCCHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             999999999999758898999735579997559968999999998289987799989999