HHsearch alignment for GI: peg_472 and conserved domain: pfam03308

>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=95.49  E-value=0.068  Score=34.09  Aligned_cols=42  Identities=19%  Similarity=0.200  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHC
Q ss_conf             899999999998287670620107879888899999999961
Q 537021.9.peg.4    5 KPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN   46 (369)
Q Consensus         5 ~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~   46 (369)
T Consensus        13 ~~~~~ll~~~~~~~g~a~~iGiTG~PGaGKStli~~l~~~~~   54 (267)
T pfam03308        13 PEARELLRRLMPLTGRAHRVGITGVPGAGKSTLIEALGMELR   54 (267)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             779999999874359955998768998879999999999999