HHsearch alignment for GI: peg_472 and conserved domain: pfam04851

>pfam04851 ResIII Type III restriction enzyme, res subunit.
Probab=96.55  E-value=0.0097  Score=40.32  Aligned_cols=93  Identities=26%  Similarity=0.254  Sum_probs=50.0

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCC
Q ss_conf             48999999999982876706201078798888999999999614687778866587899977999977987782224533
Q 537021.9.peg.4    4 QKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAA   83 (369)
Q Consensus         4 q~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~   83 (369)
T Consensus         8 Q~~a~~~~---~~~~~----~~i~~pTGsGKT~~~~~~i~~~~~-~~~------------------------~~lvlvp-   54 (103)
T pfam04851         8 QIEAIRNL---LEKKR----GLIVMATGSGKTLTAAKLIARLLK-GKK------------------------KVLFLVP-   54 (103)
T ss_pred             HHHHHHHH---HHCCC----EEEEECCCCCHHHHHHHHHHHHHH-CCC------------------------CEEEEEC-
T ss_conf             99999999---96398----699958999879999999999984-699------------------------2999908-


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             2233455566555445654204652377511566480016789999972122111466506
Q 537021.9.peg.4   84 SHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATT  144 (369)
Q Consensus        84 s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~  144 (369)
T Consensus        55 ~~~L~~Q~~~---~~----------lii~DE~H~~~a~~--~~~~l~~~~~~~~~lGlTAT  100 (103)
T pfam04851        55 RKDLLEQALE---EF----------VIIIDEAHHSSAKT--KYRKILEYFKPAFLLGLTAT  100 (103)
T ss_pred             CHHHHHHHHH---HH----------HHHHHHHHHCCCHH--HHHHHHHHCCCCEEEEEEEC
T ss_conf             2999999999---65----------64601635235378--99999995772608998008