HHsearch alignment for GI: peg_472 and conserved domain: pfam07724

>pfam07724 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model.
Probab=98.87  E-value=1.2e-09  Score=91.36  Aligned_cols=95  Identities=20%  Similarity=0.288  Sum_probs=61.7

Q ss_pred             EEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHH--HCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             62010787988889999999996146877788665878999779999--7798778222453322334555665554456
Q 537021.9.peg.4   23 SYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAI--IRGNHVDVVELDAASHTSIDDVREIIDQIYY  100 (369)
Q Consensus        23 a~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i--~~~~~~d~~e~~~~s~~~id~ir~l~~~~~~  100 (369)
T Consensus         5 ~~l~~GPsGvGKT~lAk~la~~l~~~~~~~i---~~dm~e~~~~~~v~~l~g~~~--------gyvg~~~~G~l~~~v~~   73 (168)
T pfam07724         5 SFLFLGPTGVGKTELAKALAELLFGDERALI---RIDMSEYMEEHSVSRLIGAPP--------GYVGYEEGGQLTEAVRR   73 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCCCCCEE---EECCCCCCCHHHHHHHCCCCC--------CCCCCCCCCCHHHHHHH
T ss_conf             9998898998999999999999679853448---855756542569998705899--------87262426507899983


Q ss_pred             HHHCCCCCEEEEECHHHCCCCHHHHHHHHHHH
Q ss_conf             54204652377511566480016789999972
Q 537021.9.peg.4  101 KPISARFRVYIMDEVQMLSTAAFNGLLKTLEE  132 (369)
Q Consensus       101 ~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEE  132 (369)
T Consensus        74 ~p----~~VillDEIeKa~~~V~~~LL~ild~  101 (168)
T pfam07724        74 KP----YSIVLIDEIEKAHPGVQNDLLQILEG  101 (168)
T ss_pred             CC----CCEEEEHHHHHHCHHHHHHHHHHCCC
T ss_conf             89----84898657766589999999987058