BLAST/PSIBLAST alignment of GI: peg_472 and GI: 15963983 at iteration 1
>gi|15963983|ref|NP_384336.1| DNA polymerase III subunits gamma and tau [Sinorhizobium meliloti 1021] Length = 626
>gi|15073159|emb|CAC41667.1| Putative DNA polymerase III subunit TAU protein [Sinorhizobium meliloti 1021] Length = 626
 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 297/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 36  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 96  VPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 156 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILGK 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FDPEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 216 EGVPFDPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEIETVRSMLGLADRARIVDLF 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF++QY++G NP+V+L DLA+FTHLVTR+KY+P+  +    SE E  
Sbjct: 276 EHVIKGDVAGALDEFAAQYEAGANPTVVLTDLADFTHLVTRLKYVPDAVNDQSLSEIERT 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 336 RGAEFAGSVAVTTLSRVWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 395

Query: 361 IVE 363
           +++
Sbjct: 396 LLD 398