BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.472_1
         (369 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|315121980|ref|YP_004062469.1| DNA polymerase III subunits gamma and tau [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495382|gb|ADR51981.1| DNA polymerase III subunits gamma and tau [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 363

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/362 (87%), Positives = 344/362 (95%)

Query: 7   MIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHC 66
           M+KTL NAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTA +D+PTVEFEGFGEHC
Sbjct: 1   MVKTLANAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTADVDIPTVEFEGFGEHC 60

Query: 67  QAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGL 126
           Q+II+GNHVDVVELDAASHTSIDDVREII+Q+YYKPISARF+VYIMDEVQMLSTAAFNGL
Sbjct: 61  QSIIQGNHVDVVELDAASHTSIDDVREIIEQMYYKPISARFKVYIMDEVQMLSTAAFNGL 120

Query: 127 LKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFD 186
           LKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDLHRISIG+LI LFTKIL++ESIE D
Sbjct: 121 LKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLHRISIGNLIGLFTKILRQESIESD 180

Query: 187 PEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKG 246
           PE++AMIARASDGS RDGLSLLDQAIARC DKI  S+VRLMLALADRNRIMDLFGYLIKG
Sbjct: 181 PESIAMIARASDGSVRDGLSLLDQAIARCGDKIEASTVRLMLALADRNRIMDLFGYLIKG 240

Query: 247 DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYS 306
           DI+  LQEFS QYDSG NPSV+L+ LA+FTHLVTRIKY+PEMADTLLYSEAEN RA  Y+
Sbjct: 241 DIVKALQEFSLQYDSGANPSVVLYGLADFTHLVTRIKYVPEMADTLLYSEAENLRASGYA 300

Query: 307 KEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEEKK 366
           KEVS+T LSRFWQMILKG+SEIEGFSRPMEAVEM+LIRLAH+VQLPSPEEIA YIVEEK+
Sbjct: 301 KEVSVTVLSRFWQMILKGLSEIEGFSRPMEAVEMILIRLAHSVQLPSPEEIAHYIVEEKQ 360

Query: 367 KK 368
           KK
Sbjct: 361 KK 362


>gi|222147106|ref|YP_002548063.1| DNA polymerase III subunits gamma and tau [Agrobacterium vitis S4]
 gi|221734096|gb|ACM35059.1| DNA polymerase III subunits gamma and tau [Agrobacterium vitis S4]
          Length = 631

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 239/363 (65%), Positives = 300/363 (82%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT  ID PT++ +
Sbjct: 37  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTTEIDRPTIDLK 96

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 97  IPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 156

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS GDL+ LF+ IL +
Sbjct: 157 AAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISAGDLVGLFSTILSK 216

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+IE + EA+AMIARA++GSARDGLSLLDQAIA    ++   +VR ML LADR R++DLF
Sbjct: 217 ENIEAEDEALAMIARAAEGSARDGLSLLDQAIAHGAGRVEADAVRSMLGLADRARVVDLF 276

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G+++ GD+   L EF+SQY++G +PSV+L DLA+FTHLVTR+KY+P  A+    SE E  
Sbjct: 277 GHIVLGDVAAALSEFNSQYEAGASPSVVLTDLADFTHLVTRLKYVPNGANDPSLSEVERV 336

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R   Y++ V++T LSR WQM+LKGI E+E  SR   A EMVLIRLAHA  LPSPEE AR 
Sbjct: 337 RGADYAESVAVTTLSRIWQMLLKGIPEVENASRQAGAAEMVLIRLAHAAHLPSPEEAARR 396

Query: 361 IVE 363
           +++
Sbjct: 397 LLD 399


>gi|15963983|ref|NP_384336.1| DNA polymerase III subunits gamma and tau [Sinorhizobium meliloti
           1021]
 gi|15073159|emb|CAC41667.1| Putative DNA polymerase III subunit TAU protein [Sinorhizobium
           meliloti 1021]
          Length = 626

 Score =  518 bits (1333), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 297/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 36  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 96  VPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 156 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILGK 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FDPEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 216 EGVPFDPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEIETVRSMLGLADRARIVDLF 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF++QY++G NP+V+L DLA+FTHLVTR+KY+P+  +    SE E  
Sbjct: 276 EHVIKGDVAGALDEFAAQYEAGANPTVVLTDLADFTHLVTRLKYVPDAVNDQSLSEIERT 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 336 RGAEFAGSVAVTTLSRVWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 395

Query: 361 IVE 363
           +++
Sbjct: 396 LLD 398


>gi|307306395|ref|ZP_07586139.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti
           BL225C]
 gi|306902237|gb|EFN32834.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti
           BL225C]
          Length = 626

 Score =  517 bits (1332), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 297/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 36  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 96  VPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 156 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILGK 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FDPEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 216 EGVPFDPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEIETVRSMLGLADRARIVDLF 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF++QY++G NP+V+L DLA+FTHLVTR+KY+P+  +    SE E  
Sbjct: 276 EHVIKGDVAGALDEFAAQYEAGANPTVVLTDLADFTHLVTRLKYVPDAVNDQSLSEIERT 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 336 RGAEFAGSVAVTTLSRVWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 395

Query: 361 IVE 363
           +++
Sbjct: 396 LLD 398


>gi|307319282|ref|ZP_07598711.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti
           AK83]
 gi|306895118|gb|EFN25875.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium meliloti
           AK83]
          Length = 626

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 297/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 36  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 96  VPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 156 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILGK 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FDPEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 216 EGVPFDPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEIETVRSMLGLADRARIVDLF 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF++QY++G NP+V+L DLA+FTHLVTR+KY+P+  +    SE E  
Sbjct: 276 EHVIKGDVAGALDEFAAQYEAGANPTVVLTDLADFTHLVTRLKYVPDAINDQSLSEIERT 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 336 RGAEFAGSVAVTTLSRVWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 395

Query: 361 IVE 363
           +++
Sbjct: 396 LLD 398


>gi|86355786|ref|YP_467678.1| DNA polymerase III subunits gamma and tau [Rhizobium etli CFN 42]
 gi|86279888|gb|ABC88951.1| DNA polymerase III, tau subunit protein [Rhizobium etli CFN 42]
          Length = 624

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 239/363 (65%), Positives = 296/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDDVREII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDVREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +P+A+AMIARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEPDALAMIARAAEGSARDGLSLLDQAIAHGAGAVQAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF SQY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHIVKGDVAGALGEFQSQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEIERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A +++K +++T LSR WQM+LKGI E EG SR   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAEFAKSIAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LAE 396


>gi|222084336|ref|YP_002542865.1| DNA polymerase III [Agrobacterium radiobacter K84]
 gi|221721784|gb|ACM24940.1| DNA polymerase III [Agrobacterium radiobacter K84]
          Length = 625

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/363 (65%), Positives = 298/363 (82%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNY+T  ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYRTPEIDRPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  EPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 AAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAGK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +PEA+AMIARA++GSARDGLSLLDQAIA  +  +V  +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEPEALAMIARAAEGSARDGLSLLDQAIAHGSGVVVADAVRSMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF+SQY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 HHIIKGDVAAALAEFNSQYEAGANPVVVLADLADFTHLVTRLKYVPDAANDPSLSEVERN 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A ++++ V++T LSR WQM+LKGI E E  +R   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAEFAQGVAVTTLSRIWQMLLKGIPETESAARTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LAE 396


>gi|116249901|ref|YP_765739.1| DNA polymerase III subunits gamma and tau [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115254549|emb|CAK05623.1| putative DNA polymerase III [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 625

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 296/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT+ ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTSEIDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  APGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +P+A+AMIARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEPDALAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF +QY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHIVKGDVAAALGEFQNQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEVERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A +++K V++T LSR WQM+LKGI E EG SR   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAEFAKCVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LAE 396


>gi|209551648|ref|YP_002283565.1| DNA polymerase III subunits gamma and tau [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209537404|gb|ACI57339.1| DNA polymerase III, subunits gamma and tau [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 626

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 236/363 (65%), Positives = 296/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT+ +D PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTSDVDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +P+A+AMIARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEPDALAMIARAAEGSARDGLSLLDQAIAHGAGAVQAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF SQY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHVVKGDVAAALGEFQSQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEVERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A +++K V++T LSR WQM+LKGI E EG SR   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAEFAKGVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LGE 396


>gi|227824061|ref|YP_002828034.1| DNA polymerase III subunits gamma and tau [Sinorhizobium fredii
           NGR234]
 gi|227343063|gb|ACP27281.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium fredii
           NGR234]
          Length = 645

 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/363 (65%), Positives = 299/363 (82%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA ID PT++  
Sbjct: 56  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTAEIDKPTIDLR 115

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 116 IPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 175

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 176 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILNK 235

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+PEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 236 EAVRFEPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEMETVRSMLGLADRARIVDLF 295

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD    L EF++QY++G NP+V+L DLA+FTHLVTR+KY+PE A+   +SE E  
Sbjct: 296 EHIVKGDAAAALGEFAAQYEAGANPTVVLTDLADFTHLVTRMKYVPEAANDQSFSEIERR 355

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 356 RGAEFAGSVAVTTLSRIWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 415

Query: 361 IVE 363
           ++E
Sbjct: 416 LLE 418


>gi|150398618|ref|YP_001329085.1| DNA polymerase III subunits gamma and tau [Sinorhizobium medicae
           WSM419]
 gi|150030133|gb|ABR62250.1| DNA polymerase III, subunits gamma and tau [Sinorhizobium medicae
           WSM419]
          Length = 625

 Score =  511 bits (1316), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 235/363 (64%), Positives = 295/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT  ID PT++  
Sbjct: 36  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTTGIDKPTIDLR 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 96  LPGEHCQAIMDGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LF+ IL +
Sbjct: 156 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFSTILGK 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FDPEA+AM+ARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 216 EGVPFDPEALAMVARAAEGSARDGLSLLDQAIAHGGGSVEVETVRSMLGLADRARIVDLF 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF++QY++G NP+V+L DLA+FTHLVTR+KY+P+  +    SE E  
Sbjct: 276 EHIIKGDVAAALHEFAAQYEAGANPTVVLTDLADFTHLVTRLKYVPDAINDQSLSEIERR 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
              +++  V++T LSR WQM+LKGI E E  +RP  A EMVLIRLAHA  LPSPEE AR 
Sbjct: 336 HGAEFAGSVAVTTLSRIWQMLLKGIPEAESSARPAGAAEMVLIRLAHAAHLPSPEEAARR 395

Query: 361 IVE 363
           +++
Sbjct: 396 LLD 398


>gi|190889795|ref|YP_001976337.1| DNA polymerase III, tau subunit protein (DNA-directed DNA
           polymerase) [Rhizobium etli CIAT 652]
 gi|190695074|gb|ACE89159.1| DNA polymerase III, tau subunit protein (DNA-directed DNA
           polymerase) [Rhizobium etli CIAT 652]
          Length = 623

 Score =  511 bits (1315), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 294/363 (80%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA +D PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTADVDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  APGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE + +A+AMIARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEADALAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF SQY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHIVKGDVAGALAEFQSQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEIERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A + +K V++T LSR WQM+LKGI E EG SR   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAELAKGVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LAE 396


>gi|241207078|ref|YP_002978174.1| DNA polymerase III subunits gamma/tau [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860968|gb|ACS58635.1| DNA polymerase III, subunits gamma and tau [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 625

 Score =  510 bits (1313), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 236/363 (65%), Positives = 295/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT+ ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTSEIDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE + +A+AMIARA++GSARDGLSLLDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGIEAEADALAMIARAAEGSARDGLSLLDQAIAHGAGVVQAEAVRSMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF +QY++G NP V+L DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHIVKGDVAAALGEFQNQYEAGANPVVVLTDLADFTHLVTRLKYVPDAANDPSLSEVERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +A +++K V++T LSR WQM+LKGI E EG SR   A EMVLIRLAHA  LP+PE+ AR 
Sbjct: 334 KAAEFAKGVAVTTLSRIWQMLLKGIPETEGSSRTAGAAEMVLIRLAHAAHLPAPEDAARR 393

Query: 361 IVE 363
           + E
Sbjct: 394 LAE 396


>gi|325291540|ref|YP_004277404.1| DNA polymerase III subunits gamma and tau [Agrobacterium sp. H13-3]
 gi|325059393|gb|ADY63084.1| DNA polymerase III subunits gamma and tau [Agrobacterium sp. H13-3]
          Length = 625

 Score =  508 bits (1309), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 233/363 (64%), Positives = 296/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT  ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTDTIDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  IPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISAADLVGLFTAIAGK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E  E +P+A++MIARA++GSARDGLSLLDQAIA    ++   +VR ML LADR RI+DLF
Sbjct: 214 EGFEAEPQALSMIARAAEGSARDGLSLLDQAIAHGGGRVEAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            ++IKGD+   L EF+ QY++G NP V+L+DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHIIKGDVAAALSEFNGQYEAGANPVVVLNDLADFTHLVTRMKYVPDAAEDPSLSEIERV 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  ++++ +++T LSR WQM+LKGI E E  SRP  A EMVLIRL+HA  LP+PE+ AR 
Sbjct: 334 RGAEFAETIAVTALSRIWQMLLKGIPETENASRPAGAAEMVLIRLSHAANLPAPEDAARR 393

Query: 361 IVE 363
           ++E
Sbjct: 394 LLE 396


>gi|15887450|ref|NP_353131.1| DNA polymerase III subunits gamma and tau [Agrobacterium
           tumefaciens str. C58]
 gi|15154965|gb|AAK85916.1| DNA polymerase III, tau subunit [Agrobacterium tumefaciens str.
           C58]
          Length = 624

 Score =  508 bits (1307), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/363 (63%), Positives = 296/363 (81%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKT  ID PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTDTIDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  IPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISAADLVGLFTAIAGK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E  E +P+A++MIARA++GSARDGLSLLDQAIA    ++   +VR ML LADR RI+DLF
Sbjct: 214 EGFEAEPQALSMIARAAEGSARDGLSLLDQAIAHGGGRVEAEAVRGMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF+ QY++G NP V+L+DLA+FTHLVTR+KY+P+ A+    SE E  
Sbjct: 274 QHVVKGDVAAALSEFNGQYEAGANPVVVLNDLADFTHLVTRMKYVPDAAEDPSLSEIERT 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  ++++ +++T LSR WQM+LKGI E E  SRP  A EMVLIRL+HA  LP+PE+ AR 
Sbjct: 334 RGAEFAETIAVTALSRIWQMLLKGIPETENASRPAGAAEMVLIRLSHAANLPAPEDAARR 393

Query: 361 IVE 363
           ++E
Sbjct: 394 LLE 396


>gi|163757647|ref|ZP_02164736.1| DNA polymerase III subunits gamma and tau [Hoeflea phototrophica
           DFL-43]
 gi|162285149|gb|EDQ35431.1| DNA polymerase III subunits gamma and tau [Hoeflea phototrophica
           DFL-43]
          Length = 639

 Score =  494 bits (1273), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 227/356 (63%), Positives = 280/356 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TLTNAF +GRIAQ++ML+G RG+GKTTTARI+AR+LNYKTA ID P+++  
Sbjct: 57  LIGQEPMVRTLTNAFSTGRIAQAWMLTGVRGVGKTTTARILARALNYKTAEIDQPSIDLT 116

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC AI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 117 TPGEHCPAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 176

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RI  G L   F+ +  +
Sbjct: 177 QAFNGLLKTLEEPPAHVKFIFATTEIRKVPITVLSRCQRFDLRRIETGALASHFSSVAAQ 236

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D E+++MIARA++GS RDGLSLLDQAIA    ++   +VR ML LADR+R+++LF
Sbjct: 237 EGIGIDDESLSMIARAAEGSVRDGLSLLDQAIAHGGGQVDAQAVRAMLGLADRSRVVELF 296

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G L+ GD+   L  F  QYDSG  PSVIL DLA+FTHLVTR+K++PE AD    +E E  
Sbjct: 297 GNLMAGDVAAALTGFRDQYDSGAGPSVILTDLADFTHLVTRLKFVPEAADDPSLTETERE 356

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           R   Y+ ++S   LSR WQM+LKGISE EG SRP  A EM LIR+AHA  LPSPEE
Sbjct: 357 RGADYAGKLSTAILSRVWQMLLKGISETEGSSRPAAAAEMALIRIAHAASLPSPEE 412


>gi|23500949|ref|NP_697076.1| DNA polymerase III subunits gamma and tau [Brucella suis 1330]
 gi|23346805|gb|AAN28991.1| DNA polymerase III, gamma and tau subunits [Brucella suis 1330]
          Length = 602

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/359 (61%), Positives = 286/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDLHRI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLHRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|148559186|ref|YP_001258081.1| DNA polymerase III subunits gamma and tau [Brucella ovis ATCC
           25840]
 gi|148370443|gb|ABQ60422.1| replication factor C conserved domain:ATP/GTP-binding site motif A
           [Brucella ovis ATCC 25840]
          Length = 602

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF+ GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFERGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA   D +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGADSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|260462019|ref|ZP_05810264.1| DNA polymerase III, subunits gamma and tau [Mesorhizobium
           opportunistum WSM2075]
 gi|259032266|gb|EEW33532.1| DNA polymerase III, subunits gamma and tau [Mesorhizobium
           opportunistum WSM2075]
          Length = 597

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/361 (60%), Positives = 283/361 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+PM++TLTNAF +GRIAQ++ML+G RG+GKTTTARI+AR+LNYKTA +D P+V+  
Sbjct: 27  LVGQEPMVRTLTNAFATGRIAQAWMLTGVRGVGKTTTARILARALNYKTATVDQPSVDLA 86

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+R+II+++ Y P+SAR++VYI+DEV MLST
Sbjct: 87  VLGEHCQAIMEGRHVDVIEMDAASHTGIDDIRDIIERVRYAPVSARYKVYIIDEVHMLST 146

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L+   + I  +
Sbjct: 147 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIDAGALVAHLSSIAGK 206

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+AMIARA++GSARD LS+LDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 207 EGISVDDDALAMIARAAEGSARDSLSILDQAIAHGAGSVSAEAVRAMLGLADRARIVDLF 266

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+  VL EF +QYD+G +P+ +L DLAEF HLVTR++++P   D    S+ E  
Sbjct: 267 EHVMKGDVAAVLAEFRAQYDTGADPAAVLTDLAEFNHLVTRLRFVPTAMDDASLSQDERQ 326

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R   +++ +S+  LSR WQM+LKGI E++  +RP+ A EMVLIRLAHA  LP+ +E  R 
Sbjct: 327 RGADFARALSVRVLSRTWQMLLKGIPEVQSSNRPVSAAEMVLIRLAHAADLPTLDEALRS 386

Query: 361 I 361
           +
Sbjct: 387 L 387


>gi|256112542|ref|ZP_05453463.1| DNA polymerase III subunits gamma and tau [Brucella melitensis bv.
           3 str. Ether]
 gi|265993981|ref|ZP_06106538.1| DNA polymerase III gamma and tau [Brucella melitensis bv. 3 str.
           Ether]
 gi|262764962|gb|EEZ10883.1| DNA polymerase III gamma and tau [Brucella melitensis bv. 3 str.
           Ether]
          Length = 602

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 286/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     ++  +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVIAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|306843634|ref|ZP_07476235.1| DNA polymerase III, subunits gamma and tau [Brucella sp. BO1]
 gi|306276325|gb|EFM58025.1| DNA polymerase III, subunits gamma and tau [Brucella sp. BO1]
          Length = 602

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTADAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|254694837|ref|ZP_05156665.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 3
           str. Tulya]
 gi|261215165|ref|ZP_05929446.1| DNA polymerase III gamma and tau [Brucella abortus bv. 3 str.
           Tulya]
 gi|260916772|gb|EEX83633.1| DNA polymerase III gamma and tau [Brucella abortus bv. 3 str.
           Tulya]
          Length = 602

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTNTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|62289022|ref|YP_220815.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 1
           str. 9-941]
 gi|82698960|ref|YP_413534.1| DNA polymerase III subunits gamma and tau [Brucella melitensis
           biovar Abortus 2308]
 gi|161618024|ref|YP_001591911.1| DNA polymerase III subunits gamma and tau [Brucella canis ATCC
           23365]
 gi|189023298|ref|YP_001934066.1| DNA polymerase III subunits gamma and tau [Brucella abortus S19]
 gi|237814509|ref|ZP_04593507.1| DNA polymerase III, subunits gamma and tau [Brucella abortus str.
           2308 A]
 gi|254690348|ref|ZP_05153602.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 6
           str. 870]
 gi|254696466|ref|ZP_05158294.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254700849|ref|ZP_05162677.1| DNA polymerase III subunits gamma and tau [Brucella suis bv. 5 str.
           513]
 gi|254705216|ref|ZP_05167044.1| DNA polymerase III subunits gamma and tau [Brucella suis bv. 3 str.
           686]
 gi|254709194|ref|ZP_05171005.1| DNA polymerase III subunits gamma and tau [Brucella pinnipedialis
           B2/94]
 gi|254731378|ref|ZP_05189956.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 4
           str. 292]
 gi|256030718|ref|ZP_05444332.1| DNA polymerase III subunits gamma and tau [Brucella pinnipedialis
           M292/94/1]
 gi|256060177|ref|ZP_05450357.1| DNA polymerase III subunits gamma and tau [Brucella neotomae 5K33]
 gi|256158724|ref|ZP_05456599.1| DNA polymerase III subunits gamma and tau [Brucella ceti M490/95/1]
 gi|256254122|ref|ZP_05459658.1| DNA polymerase III subunits gamma and tau [Brucella ceti B1/94]
 gi|256258602|ref|ZP_05464138.1| DNA polymerase III subunits gamma and tau [Brucella abortus bv. 9
           str. C68]
 gi|256368500|ref|YP_003106006.1| DNA polymerase III subunits gamma and tau [Brucella microti CCM
           4915]
 gi|260546316|ref|ZP_05822056.1| DNA polymerase III gamma and tau subunit [Brucella abortus NCTC
           8038]
 gi|260567317|ref|ZP_05837787.1| DNA polymerase III gamma and tau [Brucella suis bv. 4 str. 40]
 gi|260755890|ref|ZP_05868238.1| DNA polymerase III gamma and tau [Brucella abortus bv. 6 str. 870]
 gi|260759114|ref|ZP_05871462.1| DNA polymerase III gamma and tau [Brucella abortus bv. 4 str. 292]
 gi|260760839|ref|ZP_05873182.1| DNA polymerase III gamma and tau [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884914|ref|ZP_05896528.1| DNA polymerase III gamma and tau [Brucella abortus bv. 9 str. C68]
 gi|261221264|ref|ZP_05935545.1| DNA polymerase III gamma and tau [Brucella ceti B1/94]
 gi|261316694|ref|ZP_05955891.1| DNA polymerase III gamma and tau [Brucella pinnipedialis B2/94]
 gi|261324154|ref|ZP_05963351.1| DNA polymerase III gamma and tau [Brucella neotomae 5K33]
 gi|261751359|ref|ZP_05995068.1| DNA polymerase III gamma and tau [Brucella suis bv. 5 str. 513]
 gi|261755924|ref|ZP_05999633.1| DNA polymerase III gamma and tau [Brucella suis bv. 3 str. 686]
 gi|265987764|ref|ZP_06100321.1| DNA polymerase III gamma and tau [Brucella pinnipedialis M292/94/1]
 gi|265997225|ref|ZP_06109782.1| DNA polymerase III gamma and tau [Brucella ceti M490/95/1]
 gi|297247441|ref|ZP_06931159.1| DNA polymerase III subunit gamma/tau [Brucella abortus bv. 5 str.
           B3196]
 gi|62195154|gb|AAX73454.1| DnaX, DNA polymerase III, gamma and tau subunits [Brucella abortus
           bv. 1 str. 9-941]
 gi|82615061|emb|CAJ09987.1| Replication factor C conserved domain:ATP/GTP-binding site motif A
           (P-loop):AAA ATPase:AAA ATPase, central region [Brucella
           melitensis biovar Abortus 2308]
 gi|161334835|gb|ABX61140.1| DNA polymerase III, subunits gamma and tau [Brucella canis ATCC
           23365]
 gi|189018870|gb|ACD71592.1| DNA polymerase III subunits gamma and tau [Brucella abortus S19]
 gi|237789346|gb|EEP63556.1| DNA polymerase III, subunits gamma and tau [Brucella abortus str.
           2308 A]
 gi|255998658|gb|ACU47057.1| DNA polymerase III subunits gamma and tau [Brucella microti CCM
           4915]
 gi|260096423|gb|EEW80299.1| DNA polymerase III gamma and tau subunit [Brucella abortus NCTC
           8038]
 gi|260156835|gb|EEW91915.1| DNA polymerase III gamma and tau [Brucella suis bv. 4 str. 40]
 gi|260669432|gb|EEX56372.1| DNA polymerase III gamma and tau [Brucella abortus bv. 4 str. 292]
 gi|260671271|gb|EEX58092.1| DNA polymerase III gamma and tau [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675998|gb|EEX62819.1| DNA polymerase III gamma and tau [Brucella abortus bv. 6 str. 870]
 gi|260874442|gb|EEX81511.1| DNA polymerase III gamma and tau [Brucella abortus bv. 9 str. C68]
 gi|260919848|gb|EEX86501.1| DNA polymerase III gamma and tau [Brucella ceti B1/94]
 gi|261295917|gb|EEX99413.1| DNA polymerase III gamma and tau [Brucella pinnipedialis B2/94]
 gi|261300134|gb|EEY03631.1| DNA polymerase III gamma and tau [Brucella neotomae 5K33]
 gi|261741112|gb|EEY29038.1| DNA polymerase III gamma and tau [Brucella suis bv. 5 str. 513]
 gi|261745677|gb|EEY33603.1| DNA polymerase III gamma and tau [Brucella suis bv. 3 str. 686]
 gi|262551693|gb|EEZ07683.1| DNA polymerase III gamma and tau [Brucella ceti M490/95/1]
 gi|264659961|gb|EEZ30222.1| DNA polymerase III gamma and tau [Brucella pinnipedialis M292/94/1]
 gi|297174610|gb|EFH33957.1| DNA polymerase III subunit gamma/tau [Brucella abortus bv. 5 str.
           B3196]
          Length = 602

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|225626583|ref|ZP_03784622.1| DNA polymerase III, subunits gamma and tau [Brucella ceti str.
           Cudo]
 gi|260169621|ref|ZP_05756432.1| DNA polymerase III subunits gamma and tau [Brucella sp. F5/99]
 gi|261759150|ref|ZP_06002859.1| DNA polymerase III gamma and tau [Brucella sp. F5/99]
 gi|225618240|gb|EEH15283.1| DNA polymerase III, subunits gamma and tau [Brucella ceti str.
           Cudo]
 gi|261739134|gb|EEY27130.1| DNA polymerase III gamma and tau [Brucella sp. F5/99]
          Length = 602

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGASSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|17988191|ref|NP_540825.1| DNA polymerase III subunits gamma and tau [Brucella melitensis bv.
           1 str. 16M]
 gi|225851577|ref|YP_002731810.1| DNA polymerase III subunits gamma and tau [Brucella melitensis ATCC
           23457]
 gi|256045825|ref|ZP_05448701.1| DNA polymerase III subunits gamma and tau [Brucella melitensis bv.
           1 str. Rev.1]
 gi|256264911|ref|ZP_05467443.1| DNA polymerase III subunit gamma and tau [Brucella melitensis bv. 2
           str. 63/9]
 gi|260563116|ref|ZP_05833602.1| DNA polymerase III gamma and tau subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|265992238|ref|ZP_06104795.1| DNA polymerase III gamma and tau [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17983953|gb|AAL53089.1| DNA polymerase iii subunits gamma and tau [Brucella melitensis bv.
           1 str. 16M]
 gi|225639942|gb|ACN99855.1| DNA polymerase III, subunits gamma and tau [Brucella melitensis
           ATCC 23457]
 gi|260153132|gb|EEW88224.1| DNA polymerase III gamma and tau subunit [Brucella melitensis bv. 1
           str. 16M]
 gi|263003304|gb|EEZ15597.1| DNA polymerase III gamma and tau [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095396|gb|EEZ18997.1| DNA polymerase III subunit gamma and tau [Brucella melitensis bv. 2
           str. 63/9]
 gi|326408046|gb|ADZ65111.1| DNA polymerase III subunits gamma and tau [Brucella melitensis M28]
 gi|326537763|gb|ADZ85978.1| DNA polymerase III, subunits gamma and tau [Brucella melitensis
           M5-90]
          Length = 602

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|306842673|ref|ZP_07475317.1| DNA polymerase III, subunits gamma and tau [Brucella sp. BO2]
 gi|306287182|gb|EFM58681.1| DNA polymerase III, subunits gamma and tau [Brucella sp. BO2]
          Length = 602

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQALSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|294851443|ref|ZP_06792116.1| DNA polymerase III subunit gamma/tau [Brucella sp. NVSL 07-0026]
 gi|294820032|gb|EFG37031.1| DNA polymerase III subunit gamma/tau [Brucella sp. NVSL 07-0026]
          Length = 602

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|13474589|ref|NP_106158.1| DNA polymerase III subunits gamma and tau [Mesorhizobium loti
           MAFF303099]
 gi|14025343|dbj|BAB51944.1| DNA polymerase III tau [Mesorhizobium loti MAFF303099]
          Length = 604

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 216/361 (59%), Positives = 282/361 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+PM++TLTNAF +GRIAQ++ML+G RG+GKTTTARI+AR+LNYKTA +D P+V+  
Sbjct: 34  LVGQEPMVRTLTNAFATGRIAQAWMLTGVRGVGKTTTARILARALNYKTATVDQPSVDLA 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+R+II+++ Y P+SAR++VYI+DEV MLST
Sbjct: 94  VLGEHCQAIMEGRHVDVIEMDAASHTGIDDIRDIIERVRYAPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L+   + I  +
Sbjct: 154 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIDAGALVAHLSSIAAK 213

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+AMIARA++GSARD LS+LDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 214 EGISVDDDALAMIARAAEGSARDSLSILDQAIAHGAGAVSAEAVRAMLGLADRARIVDLF 273

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF +QYD+G +P+ +L DLAEF HLVTR++++P   D    S+ E  
Sbjct: 274 EHVMKGDVAAALAEFRTQYDTGADPAAVLTDLAEFNHLVTRLRFVPTAMDDASLSQDERQ 333

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R   +++ +S+  LSR WQM+LKGI E++  +RP+ A EMVLIRLAHA  LP+ +E  R 
Sbjct: 334 RGADFARALSVRVLSRTWQMLLKGIPEVQSSNRPVSAAEMVLIRLAHAADLPTLDEALRS 393

Query: 361 I 361
           +
Sbjct: 394 L 394


>gi|254713381|ref|ZP_05175192.1| DNA polymerase III subunits gamma and tau [Brucella ceti M644/93/1]
 gi|254716261|ref|ZP_05178072.1| DNA polymerase III subunits gamma and tau [Brucella ceti M13/05/1]
 gi|261218037|ref|ZP_05932318.1| DNA polymerase III gamma and tau [Brucella ceti M13/05/1]
 gi|261321113|ref|ZP_05960310.1| DNA polymerase III gamma and tau [Brucella ceti M644/93/1]
 gi|260923126|gb|EEX89694.1| DNA polymerase III gamma and tau [Brucella ceti M13/05/1]
 gi|261293803|gb|EEX97299.1| DNA polymerase III gamma and tau [Brucella ceti M644/93/1]
          Length = 602

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/356 (61%), Positives = 284/356 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDE 380


>gi|163842310|ref|YP_001626714.1| DNA polymerase III subunits gamma and tau [Brucella suis ATCC
           23445]
 gi|163673033|gb|ABY37144.1| DNA polymerase III, subunits gamma and tau [Brucella suis ATCC
           23445]
          Length = 602

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGCHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|254718255|ref|ZP_05180066.1| DNA polymerase III subunits gamma and tau [Brucella sp. 83/13]
 gi|265983215|ref|ZP_06095950.1| DNA polymerase III gamma and tau [Brucella sp. 83/13]
 gi|306839997|ref|ZP_07472791.1| DNA polymerase III, subunits gamma and tau [Brucella sp. NF 2653]
 gi|264661807|gb|EEZ32068.1| DNA polymerase III gamma and tau [Brucella sp. 83/13]
 gi|306404961|gb|EFM61246.1| DNA polymerase III, subunits gamma and tau [Brucella sp. NF 2653]
          Length = 602

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/359 (60%), Positives = 285/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIKVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|254707264|ref|ZP_05169092.1| DNA polymerase III subunits gamma and tau [Brucella pinnipedialis
           M163/99/10]
 gi|261314747|ref|ZP_05953944.1| DNA polymerase III gamma and tau [Brucella pinnipedialis
           M163/99/10]
 gi|261303773|gb|EEY07270.1| DNA polymerase III gamma and tau [Brucella pinnipedialis
           M163/99/10]
          Length = 602

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/359 (60%), Positives = 284/359 (79%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTT RI+AR+LNYKT  +D PT++  
Sbjct: 25  LIGQEPMVRTLRNAFETGRIAQAWMLTGVRGVGKTTTVRILARALNYKTDTVDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TPGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EKIEVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGSVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           R  ++++ +SI  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R
Sbjct: 325 RGREFAQTLSIRALSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIR 383


>gi|49475044|ref|YP_033085.1| DNA polymerase III subunits gamma and tau [Bartonella henselae str.
           Houston-1]
 gi|49237849|emb|CAF27044.1| DNA polymerase III subunit tau [Bartonella henselae str. Houston-1]
          Length = 646

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 216/364 (59%), Positives = 286/364 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT    
Sbjct: 25  LIGQEAMVRTLTNAFETGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTVLN 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRFDL RI    L     +I Q 
Sbjct: 145 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFDLRRIESAVLSAHLRQIAQH 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++E + +A++MIARA++GSARD LS+ DQAIA  N KI   +VR ML LAD+ RI+DLF
Sbjct: 205 ENVEVEDQALSMIARAAEGSARDALSIFDQAIAHSNGKISAVTVRAMLGLADQARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +L+KG+++N L E  SQYD+G +P  IL +LA+F HLVTR+++ PE+ + L  +E E  
Sbjct: 265 EFLMKGNVVNALHELRSQYDAGADPLTILTELADFNHLVTRLRFTPEILEDLSLTEDERL 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +SK++S+  LSR WQM+LKG+ E+   +RP++A EM+LIRLAH   LP+ +E  + 
Sbjct: 325 RSLDFSKKLSVPVLSRNWQMLLKGLQEVNQTARPLQAAEMLLIRLAHVTDLPTLDEALKK 384

Query: 361 IVEE 364
           +++E
Sbjct: 385 LMQE 388


>gi|239830865|ref|ZP_04679194.1| DNA polymerase III, subunits gamma and tau [Ochrobactrum
           intermedium LMG 3301]
 gi|239823132|gb|EEQ94700.1| DNA polymerase III, subunits gamma and tau [Ochrobactrum
           intermedium LMG 3301]
          Length = 635

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 216/361 (59%), Positives = 285/361 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  +D PT++  
Sbjct: 54  LIGQEPMVRTLKNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTVDQPTIDLS 113

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GE+CQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 114 VPGENCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 173

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L     +I + 
Sbjct: 174 AAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAAHLRRIAEA 233

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 234 EEIAVDDASLAMIARAGEGSARDSLSIFDQAIAHGAGAVTAEAVRSMLGLADRARIIDLF 293

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 294 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 353

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  ++++++S+  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R 
Sbjct: 354 RGREFAQKLSVRVLSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIRG 413

Query: 361 I 361
           +
Sbjct: 414 L 414


>gi|319779807|ref|YP_004139283.1| DNA polymerase III, subunits gamma and tau [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317165695|gb|ADV09233.1| DNA polymerase III, subunits gamma and tau [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 605

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 216/361 (59%), Positives = 280/361 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+PM++TLTNAF +GRIAQ++ML+G RG+GKTTTARI+AR+LNYKTA ID P+V+  
Sbjct: 35  LVGQEPMVRTLTNAFATGRIAQAWMLTGVRGVGKTTTARILARALNYKTADIDQPSVDLA 94

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC AI+ G HVDV+E+DAASHT IDD+R+II+++ Y P+SAR++VYI+DEV MLST
Sbjct: 95  VLGEHCLAIMEGRHVDVIEMDAASHTGIDDIRDIIERVRYAPVSARYKVYIIDEVHMLST 154

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L+     I  +
Sbjct: 155 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIDAGALVGHLASISAK 214

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+AMIARA++GSARD LS+LDQAIA     +   +VR ML LADR RI+DLF
Sbjct: 215 EGISVDDDALAMIARAAEGSARDSLSILDQAIAHGAGSVGADAVRAMLGLADRARIVDLF 274

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+   L EF +QYD+G +P+ +L DLAEF HLVTR++++P   +    SE E  
Sbjct: 275 EHVMKGDVAAALGEFRAQYDTGADPAAVLTDLAEFNHLVTRLRFVPTAIEDASLSEDERQ 334

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R   +++ +S+  LSR WQM+LKGI E++  +RP+ A EMVLIRLAHA  LP+ +E  R 
Sbjct: 335 RGADFARTLSVRVLSRTWQMLLKGIPEVQSSNRPVSAAEMVLIRLAHAADLPTLDEALRS 394

Query: 361 I 361
           +
Sbjct: 395 L 395


>gi|153007366|ref|YP_001368581.1| DNA polymerase III subunits gamma and tau [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559254|gb|ABS12752.1| DNA polymerase III, subunits gamma and tau [Ochrobactrum anthropi
           ATCC 49188]
          Length = 605

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 215/361 (59%), Positives = 284/361 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT++  
Sbjct: 25  LIGQEPMVRTLNNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYKTDTIDQPTIDLS 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GE+CQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLS 
Sbjct: 85  VQGENCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLSN 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PITVLSRCQRFDL RI  G L +   +I + 
Sbjct: 145 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITVLSRCQRFDLRRIESGTLAQHLRRIAEA 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  ++AMIARA +GSARD LS+ DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 205 EQIAVDDTSLAMIARAGEGSARDSLSIFDQAIAHGAGTVTAEAVRSMLGLADRARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD+   L EF +QYD G +PSV+L DLA+F HLVTR+++ P++A+ +  SE E  
Sbjct: 265 EMLMRGDVAGALTEFRAQYDVGADPSVVLTDLADFNHLVTRLRFTPDVAEDVSLSEDERV 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R  ++++++S+  LSR WQM+LKGI+E++  +RP++A EM+LIRLAHA  LP+ +E  R 
Sbjct: 325 RGREFAQKLSVRVLSRTWQMLLKGIAEVDTATRPVQAAEMLLIRLAHAADLPTLDEAIRS 384

Query: 361 I 361
           +
Sbjct: 385 L 385


>gi|49473886|ref|YP_031928.1| DNA polymerase III subunits gamma and tau [Bartonella quintana str.
           Toulouse]
 gi|49239389|emb|CAF25723.1| DNA polymerase III subunit tau [Bartonella quintana str. Toulouse]
          Length = 640

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/369 (57%), Positives = 288/369 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT    
Sbjct: 25  LIGQETMVRTLTNAFETGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTVLN 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRFDL RI    L     +I + 
Sbjct: 145 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFDLRRIETAVLSAHLCQIAKH 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+++ + +A++MIARA++GSARD LS+ DQAIA  N  I   +VR +L L D+ RI+DLF
Sbjct: 205 ENVKVEDQALSMIARAAEGSARDALSIFDQAIAYSNGNISAVAVRALLGLVDQARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGDI+N L E  SQYD+G +P  IL +LA+F HLVTR+++ PE+A+ L  +E E++
Sbjct: 265 EFIMKGDIVNALHELRSQYDAGADPLTILTELADFNHLVTRLRFTPEIAEDLSLTEVEHS 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +SK++S+  LSR WQM+LKG+ E+   +RP++A EM+LIRLA+   LP+ +E  + 
Sbjct: 325 RSLDFSKKLSVPVLSRNWQMLLKGLQEVSETTRPLQAAEMLLIRLAYTADLPTLDEALKK 384

Query: 361 IVEEKKKKT 369
           + +EK   T
Sbjct: 385 LTQEKTSLT 393


>gi|319408027|emb|CBI81681.1| DNA polymerase III gamma and tau subunit [Bartonella
           schoenbuchensis R1]
          Length = 642

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/369 (57%), Positives = 287/369 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT+   
Sbjct: 25  LIGQEAMVRTLTNAFETGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTIALN 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR+++YI+DE+ MLST
Sbjct: 85  TLGEHCAQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKIYIIDEIHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPH+KFIFATTEIRK+PIT+LSRCQRFDL RI    L+E   KI + 
Sbjct: 145 QAFNGLLKTLEEPPPHIKFIFATTEIRKVPITILSRCQRFDLRRIESAVLVEYLRKIAKH 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ + +A+++I RA++GSARD LS+ DQAIA  N K+ T SVR ML LAD+ RI+DLF
Sbjct: 205 EKIKVEDQALSLIVRAAEGSARDALSIFDQAIAYSNGKVSTVSVRTMLGLADQARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KG+I++ L E  SQYD+G +P +IL +L++F HLVTR++  PE+A  L  +E E  
Sbjct: 265 EFVMKGNIVSALSELRSQYDAGADPFMILTELSDFNHLVTRLRLTPEIAGDLFLTEEERL 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R L +S+++SI  LSR WQ++LKG+ E+   +RP++A EM+LIRL H   LP+ +E  + 
Sbjct: 325 RGLDFSQKLSIPVLSRNWQILLKGLQEVNKAARPIQAAEMILIRLTHTADLPTLDEALKK 384

Query: 361 IVEEKKKKT 369
           + +EK   T
Sbjct: 385 LTQEKTSLT 393


>gi|110636381|ref|YP_676589.1| DNA polymerase III subunits gamma and tau [Mesorhizobium sp. BNC1]
 gi|110287365|gb|ABG65424.1| DNA polymerase III, tau subunit [Chelativorans sp. BNC1]
          Length = 600

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 210/356 (58%), Positives = 280/356 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TLTNAF +GRIAQ++ML+G RG+GKTTTARI+AR+LNY+T  +D P+V+  
Sbjct: 29  LIGQEPMVRTLTNAFAAGRIAQAWMLTGVRGVGKTTTARILARALNYRTEAVDRPSVDLS 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC+AI+ G HVDV+E+DAASHT IDD+R+II+Q+ Y P+SAR++VYI+DEV MLS 
Sbjct: 89  VPGEHCEAILEGRHVDVIEMDAASHTGIDDIRDIIEQVRYAPVSARYKVYIIDEVHMLSN 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRFDL RI  G + +    I   
Sbjct: 149 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFDLRRIDSGLIKQHLAHIGDL 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++ D +A+AMIARA++GS RD  S+ DQAIA  + K+   +VR ML LADR R++DLF
Sbjct: 209 EGVDADSDALAMIARAAEGSMRDAQSIFDQAIAHSSGKVTAETVRDMLGLADRARVIDLF 268

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +L+KGD+   L E+ +QYD+G +P+ +L DLAEF HLVTR++++P+ A+     + E  
Sbjct: 269 EHLMKGDVAAALAEYRAQYDAGADPAAVLTDLAEFNHLVTRMRFVPDAANDGSLPQEERT 328

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           R L++SK +S+  LSR WQM+LKGI E++G SRP+ A EMVLIR+AHA  LP+ +E
Sbjct: 329 RGLEFSKNLSVRVLSRTWQMLLKGIQEVQGSSRPISAGEMVLIRIAHAANLPTLDE 384


>gi|240849897|ref|YP_002971286.1| DNA polymerase III subunits gamma and tau [Bartonella grahamii
           as4aup]
 gi|240267020|gb|ACS50608.1| DNA polymerase III subunits gamma and tau [Bartonella grahamii
           as4aup]
          Length = 646

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 210/365 (57%), Positives = 282/365 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF+ GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT   +
Sbjct: 25  LIGQEAMVRTLTNAFEKGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTVLD 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR++VYI+DEV MLST
Sbjct: 85  SLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PIT+LSRCQRFDL RI    L     +I + 
Sbjct: 145 QAFNGLLKTLEEPPSHVKFIFATTEIRKVPITILSRCQRFDLRRIESKALSAHLRQIAKY 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E + +A++MIARA++GSARD LS+ DQAIA  N  +   +VR ML LAD+ RI+DLF
Sbjct: 205 EKVEVEDQALSMIARAAEGSARDALSIFDQAIAHSNGNVNAIAVRTMLGLADQARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD++N L E  SQY++G +P  IL +LA+F HLVTR+++ PE+ +    +E +  
Sbjct: 265 EFIMKGDVVNALHELRSQYEAGADPLTILTELADFNHLVTRLRFTPEIVEDFSLTEEQRL 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +SK++S+  LSR WQM+LKG+ E+   +RP++A EM+LIRLAH   LP+ +E  + 
Sbjct: 325 RSLDFSKKLSVPILSRNWQMLLKGLQEVNQTARPLQAAEMLLIRLAHTADLPTLDEALKK 384

Query: 361 IVEEK 365
           + +EK
Sbjct: 385 LTQEK 389


>gi|121602189|ref|YP_989487.1| DNA polymerase III subunits gamma and tau [Bartonella bacilliformis
           KC583]
 gi|120614366|gb|ABM44967.1| DNA polymerase III, subunits gamma and tau [Bartonella
           bacilliformis KC583]
          Length = 634

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 213/356 (59%), Positives = 278/356 (78%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF++GRIAQ+++L+G RG+GKTTTARI+AR+LNY+T  I+ PT  F 
Sbjct: 22  LIGQETMVRTLTNAFEAGRIAQAWILTGIRGVGKTTTARILARALNYETKDINKPTTVFN 81

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y P+SAR++VYI+DEV MLST
Sbjct: 82  TLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYCPVSARYKVYIIDEVHMLST 141

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRFDL R+    L+    KI Q 
Sbjct: 142 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFDLRRVESSALVAHLHKIAQH 201

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E   +A+++IARA++GS RD LS+ DQAIA  N KI  ++VR ML LAD+ RI+DLF
Sbjct: 202 EKVEVQEQALSIIARAAEGSVRDALSIFDQAIAHSNGKINATAVRTMLGLADQARIIDLF 261

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            Y++KGDI++ L E  SQYD+G +P  +L +LA F HLVTR++ IPE  + L  +E E  
Sbjct: 262 DYVMKGDIVSALHELRSQYDAGADPFSVLAELANFNHLVTRLRLIPETTEDLSLTEDERL 321

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           R+L +S+++SI  LSR WQM+LKG+ EI   +RP++A EM+LIRL HA  LP+ +E
Sbjct: 322 RSLDFSQKLSIRVLSRTWQMLLKGLQEINQAARPLQAAEMLLIRLTHATDLPTLDE 377


>gi|163867528|ref|YP_001608727.1| DNA polymerase III subunits gamma and tau [Bartonella tribocorum
           CIP 105476]
 gi|161017174|emb|CAK00732.1| DNA polymerase III gamma and tau subunit [Bartonella tribocorum CIP
           105476]
          Length = 646

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 211/365 (57%), Positives = 282/365 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF+ GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT   +
Sbjct: 25  LIGQEAMVRTLTNAFEKGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTVLD 84

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR++VYI+DEV MLST
Sbjct: 85  TLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLST 144

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PIT+LSRCQRFDL RI    L     +I + 
Sbjct: 145 QAFNGLLKTLEEPPSHVKFIFATTEIRKVPITILSRCQRFDLRRIEAKALSAHLHQIAKY 204

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E + +A++MIARA++GSARD LS+ DQAIA  N  +  + VR ML LAD+ RI+DLF
Sbjct: 205 EKVEVEDQALSMIARAAEGSARDALSIFDQAIAHSNGNVSAAEVRTMLGLADQARIIDLF 264

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +++KGD+I+ L E  SQYD+G +P  IL +LA+F HLVTR+++ PE+ +    +E +  
Sbjct: 265 EFVMKGDVIHALHELRSQYDAGADPLTILTELADFNHLVTRLRFTPEIVEDFSLTEEQRL 324

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +SK++S+  LSR WQM+LKG+ E+   +RP++A EM+LIRLAH   LP+ +E  + 
Sbjct: 325 RSLDFSKKLSVPVLSRNWQMLLKGLQEVNQTARPLQATEMLLIRLAHTADLPTLDEALKK 384

Query: 361 IVEEK 365
           + +EK
Sbjct: 385 LTQEK 389


>gi|319898354|ref|YP_004158447.1| DNA polymerase III gamma and tau subunit [Bartonella clarridgeiae
           73]
 gi|319402318|emb|CBI75857.1| DNA polymerase III gamma and tau subunit [Bartonella clarridgeiae
           73]
          Length = 634

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/365 (57%), Positives = 283/365 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M+ TL NAFK+GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT  F+
Sbjct: 29  LIGQEAMVCTLNNAFKTGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTLFD 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+PISAR++VYI+DEV MLST
Sbjct: 89  KLGEHCTQIIEGRHMDVIEMDAASHTGIDDIREIIEQIRYRPISARYKVYIIDEVHMLST 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRF+L RI    L+    +I Q 
Sbjct: 149 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFNLQRIETAVLVNHLRQIAQL 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE   +A+ +IARA++GS RD LS+ DQAIA  N K+   +VR+ML L D++RI+DLF
Sbjct: 209 EEIEVQDQALFVIARAAEGSVRDALSIFDQAIAHGNGKVDAIAVRIMLGLTDQSRIIDLF 268

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++KG+I++ L E  +QY++G +P VIL +LA+F HL+TR++  PE+ + L ++E E +
Sbjct: 269 ESIMKGNIVHALHELRNQYNAGADPFVILTELADFIHLITRLRLTPEIIENLSFTEEERS 328

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +SK++SI  LSR WQM+LKG+ E+   + P++A EM+LIRL H   LP+ +E    
Sbjct: 329 RSLDFSKKLSIPILSRSWQMLLKGLQEVNQAAHPIQAAEMLLIRLTHVADLPTLDEALTK 388

Query: 361 IVEEK 365
           +++EK
Sbjct: 389 LIQEK 393


>gi|319403646|emb|CBI77231.1| DNA polymerase III subunit tau [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 630

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 211/366 (57%), Positives = 281/366 (76%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ ++ TL NAFK+GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT  F+
Sbjct: 29  LIGQEAIVCTLNNAFKTGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTLFD 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P+SAR+++YI+DEV MLST
Sbjct: 89  TLGEHCAQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVSARYKIYIIDEVHMLST 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRF+L RI    L+    K+ Q 
Sbjct: 149 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFNLQRIETTVLVTHLRKVAQL 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E   +A+ MIARA++GS RD LS+ DQAIA  N K+  ++V LML L D++RI+DLF
Sbjct: 209 EKVEAQDQALFMIARAAEGSVRDALSIFDQAIAYGNGKVDATAVSLMLGLTDQSRIIDLF 268

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+KG+I+N L E  +QY+ G +P VIL +LA+F HL+TR++  PE+ + L  +E E +
Sbjct: 269 ESLMKGNIVNALHELRNQYNRGADPFVILTELADFNHLITRLRLTPEIIENLSLTEEERS 328

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +S+++SI  LSR WQM+LKG+ E+     P++A EM+LIRLAH   LP+ +E    
Sbjct: 329 RSLNFSQKLSIRVLSRSWQMLLKGLQEVNQAPHPIQAAEMLLIRLAHIADLPTLDEALTK 388

Query: 361 IVEEKK 366
           + +EKK
Sbjct: 389 LTQEKK 394


>gi|90419786|ref|ZP_01227695.1| DNA polymerase III, subunits gamma/tau [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335827|gb|EAS49575.1| DNA polymerase III, subunits gamma/tau [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 639

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/361 (58%), Positives = 272/361 (75%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TLTNAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNY+T  ID PT+   
Sbjct: 35  LIGQEPMVRTLTNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYQTDEIDQPTIHMG 94

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HCQAI+ G HVDVVE+DAASHT IDDVREII Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 95  EPGIHCQAIMEGRHVDVVEMDAASHTGIDDVREIIAQVRYRPVSARYKVYIIDEVHMLST 154

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKF+FATTEIRK+P+TVLSRCQRFDL R+    L+   TKI   
Sbjct: 155 QAFNGLLKTLEEPPEHVKFVFATTEIRKVPVTVLSRCQRFDLRRVESATLMAHLTKIATA 214

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E D +A+ +IARA++GS RD LSL DQAIA     +   +VR ML LADR RI+DLF
Sbjct: 215 EHVEVDEDALRLIARAAEGSVRDALSLTDQAIAHGAGAVTAQAVRDMLGLADRVRIIDLF 274

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            YL+KGD    L+E   QY  G +P+V+L DLA+FTHLVT ++++P+ A+    S  E  
Sbjct: 275 EYLMKGDAAAALKELRDQYVVGADPAVVLADLADFTHLVTTLRFVPDAAEDAALSPMEAE 334

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R L++SK +SI  L + WQM+LK + E    + P +A EM LIR+AHA  LPSP+++ R 
Sbjct: 335 RGLEFSKSLSIRTLGQVWQMLLKALEETRNANAPRQAAEMALIRIAHAADLPSPDDLVRL 394

Query: 361 I 361
           I
Sbjct: 395 I 395


>gi|319405116|emb|CBI78722.1| DNA polymerase III subunit tau [Bartonella sp. AR 15-3]
          Length = 633

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/366 (57%), Positives = 282/366 (77%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M+ TL NAFK+GRIAQ++ML+G RG+GKTTTARI+AR+LNYKT  ID PT  F+
Sbjct: 29  LIGQEAMVCTLNNAFKTGRIAQAWMLTGIRGVGKTTTARILARALNYKTKDIDQPTTLFD 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DV+E+DAASHT IDD+REII+QI Y+P++AR++VYI+DEV MLST
Sbjct: 89  TLGEHCTQIIEGRHIDVIEMDAASHTGIDDIREIIEQIRYRPVAARYKVYIIDEVHMLST 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRF+L RI    L+    +I Q 
Sbjct: 149 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFNLRRIEATVLLTHLRQIAQL 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E   +A+ MIA A++GS RD LS+LDQAIA  N K+   +VR+ML L D++RI+DLF
Sbjct: 209 EKVEAQDQALFMIAHAAEGSVRDALSILDQAIAYGNGKVDAIAVRVMLGLTDQSRIIDLF 268

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++KG+I+N L E  +QY++G +P  IL +LA+F HL+TR++  PE+ ++L  +E E +
Sbjct: 269 ESIMKGNIVNALYELRNQYNAGADPFAILTELADFNHLITRLRLTPEIIESLSLTEEERS 328

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +S+++SI  LSR WQM+LKG+ E+   S P++A EM+LIRLAH   LP+ +E    
Sbjct: 329 RSLNFSQKLSIRVLSRSWQMLLKGLQEVSQASHPIQAAEMLLIRLAHVADLPTLDEALTK 388

Query: 361 IVEEKK 366
           + + KK
Sbjct: 389 LTQNKK 394


>gi|319406562|emb|CBI80204.1| DNA polymerase III, subunits gamma and tau [Bartonella sp. 1-1C]
          Length = 604

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/366 (57%), Positives = 278/366 (75%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF +GRIAQ++ML+G RG+GKTTTARI++R+LNYKT  ID PT  F+
Sbjct: 22  LIGQEAMVRTLNNAFTTGRIAQAWMLTGIRGVGKTTTARILSRALNYKTKDIDQPTTLFD 81

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHC  II G H+DVVE+DAASHT IDD+REII+QI Y+P+SAR++VYI+DEV MLST
Sbjct: 82  TLGEHCAQIIEGRHIDVVEMDAASHTGIDDIREIIEQIRYRPVSARYKVYIIDEVHMLST 141

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPPPHVKFIFATTEIRK+PIT+LSRCQRF+L R+    L+    KI Q 
Sbjct: 142 QAFNGLLKTLEEPPPHVKFIFATTEIRKVPITILSRCQRFNLQRVETTALVAHLRKISQL 201

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E   +A+ MIARA++GS RD LS+ DQAIA  N K+ T++V LML L D++ I+DLF
Sbjct: 202 EKVEAQDQALFMIARAAEGSVRDALSIFDQAIAYSNGKVDTTAVSLMLGLTDQSHIIDLF 261

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+KG+II+ L E  +QY+ G +P VIL +LA F HL+TR++  PE+ +    +E E +
Sbjct: 262 ESLMKGNIIHALHELRNQYNRGADPFVILTELANFNHLITRLRLTPEIIENSSLTEEERS 321

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R+L +S+++SI  LSR WQM+LKG+ E+     P++A EM+LIRLAH   LP+ +E    
Sbjct: 322 RSLNFSQKLSIRILSRSWQMLLKGLQEVNQAPHPIQAAEMLLIRLAHVADLPTLDEALTK 381

Query: 361 IVEEKK 366
           + +EK 
Sbjct: 382 LTQEKN 387


>gi|114704405|ref|ZP_01437313.1| DNA polymerase III subunits gamma and tau [Fulvimarina pelagi
           HTCC2506]
 gi|114539190|gb|EAU42310.1| DNA polymerase III subunits gamma and tau [Fulvimarina pelagi
           HTCC2506]
          Length = 668

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/361 (57%), Positives = 271/361 (75%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TLTNAF++GRIAQ++ML+G RG+GKTTTARI+AR+LNY+T  ID PT+   
Sbjct: 31  LIGQEPMVRTLTNAFETGRIAQAWMLTGVRGVGKTTTARILARALNYETGEIDQPTIHMA 90

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HCQAI+ G HVDVVE+DAASHT IDD+REII Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 91  EPGIHCQAIMEGRHVDVVEMDAASHTGIDDIREIIAQVRYRPVSARYKVYIIDEVHMLST 150

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKF+FATTEIRK+PITVLSRCQRFDL R+    LI    +I ++
Sbjct: 151 QAFNGLLKTLEEPPEHVKFVFATTEIRKVPITVLSRCQRFDLRRVESATLIGHLKQIAEK 210

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E + +A+ +IARA++GS RD LSL DQAIA     +   +VR ML LADR R++DLF
Sbjct: 211 EKVEIEDDALRLIARAAEGSVRDSLSLTDQAIAHGAGAVTAGAVRDMLGLADRVRVIDLF 270

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            Y++KGD  + L E   QY  G +P+++L DLA+FTHLVT ++Y PE A+  + S  E  
Sbjct: 271 EYIMKGDAASALVELRDQYTVGADPAIVLGDLADFTHLVTTLRYAPEAAEDAVLSPDEAE 330

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           R L YSK +SI  L + WQM+LK + E      P +A EM LIR+AHA  LPSP+++ + 
Sbjct: 331 RGLAYSKTLSIRTLGQVWQMLLKALEETRNADSPRQAAEMALIRIAHAADLPSPDDLLKL 390

Query: 361 I 361
           +
Sbjct: 391 L 391


>gi|254500517|ref|ZP_05112668.1| DNA polymerase III, subunits gamma and tau, putative [Labrenzia
           alexandrii DFL-11]
 gi|222436588|gb|EEE43267.1| DNA polymerase III, subunits gamma and tau, putative [Labrenzia
           alexandrii DFL-11]
          Length = 654

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/358 (57%), Positives = 271/358 (75%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKT-AHIDVPTVEF 59
           ++GQ+PM++TL NAF +GRIAQ++ML+G RG+GKTTTARI+AR LNY+     D PTV+ 
Sbjct: 57  LVGQEPMVQTLENAFDTGRIAQAWMLTGVRGVGKTTTARILARGLNYEVPGEADKPTVKL 116

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
              G HC+AI+ G HVDV+E+DAASHT I D+REIID   Y+P +AR++VYI+DEV MLS
Sbjct: 117 TQEGTHCKAIMEGRHVDVIEMDAASHTGISDIREIIDAARYRPATARYKVYIIDEVHMLS 176

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RI    LI L  +I  
Sbjct: 177 NAAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRIDQSKLIGLLRRISD 236

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E I+   EA+ +IARA +GSARD LSLLDQA+A  +  I    +R ML LADR R++DL
Sbjct: 237 AEGIQISDEALMLIARAGEGSARDSLSLLDQAMAHGSGAIEADDLRQMLGLADRARVIDL 296

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           FG+L+ G I + L E  +QY+ G +P++IL DLA+FTHLVTR+K  P+ AD    +EAE 
Sbjct: 297 FGHLMAGRIEDALAELQAQYEIGADPAIILTDLADFTHLVTRMKVAPKSADEASVTEAER 356

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           AR  ++++++S+  LSR WQ++LKG+ E++  S+P+ A +MVL+RLA+A  LP P E+
Sbjct: 357 ARGQEFAEKISVRLLSRVWQILLKGVQEVQAASKPLAAADMVLVRLAYAADLPDPGEL 414


>gi|115526801|ref|YP_783712.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris BisA53]
 gi|115520748|gb|ABJ08732.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris BisA53]
          Length = 629

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 202/363 (55%), Positives = 270/363 (74%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTA--HIDVPTVE 58
           +IGQ  M++TL+NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+TA   +  PT+ 
Sbjct: 54  LIGQDAMVRTLSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYETADGSVKAPTIH 113

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             G G HCQAI+ G H+DV+E+DAASHT +DDVR+I D + Y P  AR++VYI+DEV ML
Sbjct: 114 MPGPGVHCQAIMEGRHMDVLEMDAASHTGVDDVRQINDSVRYAPAGARYKVYIIDEVHML 173

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I 
Sbjct: 174 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMSHLGSIA 233

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++E +PEA+ +IARA++GS RD LSLLDQAIA     +    VR ML LADR R++D
Sbjct: 234 AKENVEIEPEALGIIARAAEGSVRDSLSLLDQAIAHAAGIVRADQVRQMLGLADRTRVID 293

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LFG+L  GDI     EF  QYD+G +P V+L DLAEF + VTR+K +P +AD + + E E
Sbjct: 294 LFGHLASGDIAAAFAEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPSIADNVAFGETE 353

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  Y+ ++S+  LSR WQM+LKGI+E++G +R + A EMVL+R+A+A  LP+P+E  
Sbjct: 354 RLRARDYATKLSMRVLSRMWQMLLKGITEVQGATRQVAAAEMVLVRIAYAADLPTPDEAV 413

Query: 359 RYI 361
           R +
Sbjct: 414 RML 416


>gi|118590526|ref|ZP_01547928.1| DNA polymerase III subunits gamma and tau [Stappia aggregata IAM
           12614]
 gi|118436989|gb|EAV43628.1| DNA polymerase III subunits gamma and tau [Stappia aggregata IAM
           12614]
          Length = 640

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/358 (56%), Positives = 273/358 (76%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHI-DVPTVEF 59
           ++GQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR LNY+   + D PTV+ 
Sbjct: 52  LVGQEPMVQTLENAFETGRIAQAWMLTGVRGVGKTTTARILARGLNYEVPGVADRPTVKL 111

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
              G HC+AI+ G HVDV+E+DAASHT I+D+REIID   Y+P +AR++VYI+DEV MLS
Sbjct: 112 TQEGTHCKAIMEGRHVDVIEMDAASHTGINDIREIIDAARYRPATARYKVYIIDEVHMLS 171

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RI    LI L  +I  
Sbjct: 172 NAAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRIDQSKLIGLLRRISD 231

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E I+   EA+ +IARA +GSARD LSLLDQA+A     I    +R ML LADR R++DL
Sbjct: 232 AEGIQISDEALMLIARAGEGSARDSLSLLDQAMAHGAGAIEAEDLRQMLGLADRARVIDL 291

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           FG+++ G I + L E  +QY+ G +P+++L DLA+FTHLVTR+K  P+ AD    +EAE 
Sbjct: 292 FGHIMAGRIEDALGELQAQYEVGADPAIVLTDLADFTHLVTRMKVAPKSADEASVTEAER 351

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           AR  ++++++S+  LSR WQ++LKG+ E++  S+P+ A +MVL+RLA+A  LP P ++
Sbjct: 352 ARGREFAEQISVRLLSRAWQILLKGVQEVQAASKPLAAADMVLVRLAYAADLPDPGDL 409


>gi|328541815|ref|YP_004301924.1| DNA polymerase III subunits gamma and tau [Polymorphum gilvum
           SL003B-26A1]
 gi|326411567|gb|ADZ68630.1| DNA polymerase III subunits gamma and tau [Polymorphum gilvum
           SL003B-26A1]
          Length = 673

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 205/362 (56%), Positives = 271/362 (74%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK-TAHIDVPTVEF 59
           ++GQ+PM++TL NAF +GRIAQ++ML+G RG+GKTTTARI+AR LNY+     D PTV  
Sbjct: 53  LVGQEPMVQTLENAFATGRIAQAWMLTGVRGVGKTTTARILARGLNYEIPGEADRPTVRL 112

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
              G HC+AI+ G HVDV+E+DAASHT I+D+REI D   Y+P +AR++VYI+DEV MLS
Sbjct: 113 SREGTHCRAIMEGRHVDVIEMDAASHTGINDIREITDAARYRPATARYKVYIIDEVHMLS 172

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    L+ L  +I  
Sbjct: 173 NAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEQPKLVGLLRRISD 232

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E I+   EA+++IARA +GSARD LSLLDQAIA     I    VR ML LADR R++DL
Sbjct: 233 AEGIDISDEALSLIARAGEGSARDSLSLLDQAIAHGAGHIDAVQVREMLGLADRARVIDL 292

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           FG+++ G +   L+E + QY SG +P+V+L DLA+FTHLVTR+K +P+  + +  +E E 
Sbjct: 293 FGHVMAGRVAEALEELAGQYASGADPAVVLTDLADFTHLVTRLKIVPKAGEEVSVTETER 352

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R  ++++ +S+  LSR WQ++LKGISE++G  +P+ A +MVL+RLA+A  LP PEE  R
Sbjct: 353 LRGREFAESLSMRSLSRAWQILLKGISEVQGAPKPLAAADMVLVRLAYAADLPDPEEALR 412

Query: 360 YI 361
            +
Sbjct: 413 LL 414


>gi|254470770|ref|ZP_05084173.1| DNA polymerase III, tau subunit protein [Pseudovibrio sp. JE062]
 gi|211959912|gb|EEA95109.1| DNA polymerase III, tau subunit protein [Pseudovibrio sp. JE062]
          Length = 640

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/357 (56%), Positives = 272/357 (76%), Gaps = 1/357 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK-TAHIDVPTVEF 59
           + GQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR LNY+    ID PT+  
Sbjct: 60  LYGQEPMVQTLQNAFETGRIAQAWMLTGVRGVGKTTTARILARGLNYEIPGEIDKPTIHL 119

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
           +  G HCQAI+ G HVDV+E+DAASHT I D+REI +   Y+P +AR++VYI+DEV MLS
Sbjct: 120 DKPGVHCQAIMEGRHVDVIEMDAASHTGIGDIREITEAARYRPANARYKVYIIDEVHMLS 179

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    L+ L  +I  
Sbjct: 180 NAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIESSTLVSLLREISG 239

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E IE   EA+ +IARA +GSARD LSLLDQAIA    +I    VR ML LADR+R++DL
Sbjct: 240 KEGIEISDEALTLIARAGEGSARDSLSLLDQAIAHGAGRIEADEVRQMLGLADRSRVIDL 299

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F ++++GDI + L E  +QYD G +P+V+L DLA+FTHLVTR+K +P+  +    +E+E 
Sbjct: 300 FEHVMRGDIASALDELKAQYDVGADPAVVLSDLADFTHLVTRLKAVPKAGEENSVTESER 359

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            R  ++++++S+  LSR WQ++LKGI+E++   +P+ A +MVL+RL +A  LP PEE
Sbjct: 360 QRGREFAEKLSMRVLSRTWQILLKGINEVQNAPKPLAAADMVLVRLCYASDLPDPEE 416


>gi|304392342|ref|ZP_07374283.1| DNA polymerase III subunit tau [Ahrensia sp. R2A130]
 gi|303295446|gb|EFL89805.1| DNA polymerase III subunit tau [Ahrensia sp. R2A130]
          Length = 672

 Score =  434 bits (1116), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 271/367 (73%), Gaps = 4/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TL NAF +GRIAQ+YML+G RG+GKTTTARI+AR+LNY++     PT++  
Sbjct: 43  LIGQEPMVRTLRNAFSTGRIAQAYMLTGVRGVGKTTTARILARALNYESDTQKQPTLDLS 102

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC  I+ GNHVDV+E+DAASHT I D+REII  + YKP+SAR++VYI+DEV MLST
Sbjct: 103 TPGIHCADIMEGNHVDVIEMDAASHTGIGDIREIIAAVRYKPVSARYKVYIIDEVHMLST 162

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFNGLLKTLEEPP HVKFIFATTEIRK+PIT+LSRCQRFDL RI  G++++   KI + 
Sbjct: 163 AAFNGLLKTLEEPPEHVKFIFATTEIRKVPITILSRCQRFDLRRIEAGEMVDHLGKIAKL 222

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDK----IVTSSVRLMLALADRNRI 236
           ESI  + EA+AMIARAS+GS RD LS+LDQAIA  + +    +    VR ML LADR R+
Sbjct: 223 ESIAVEDEALAMIARASEGSVRDALSVLDQAIAHASAESDATVRAEGVRDMLGLADRARV 282

Query: 237 MDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
           +DLF + +KGDI   L E  +Q+D G +P+ +L DLA+F H VTR++Y+    D    S+
Sbjct: 283 IDLFEFCMKGDIAAALAEMKAQHDVGADPATVLTDLADFVHFVTRVRYVDTALDDPSLSQ 342

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            +  R   +++ ++   L R WQM+LKGI+E++   RP+ A +MVL+RL HA  LP+P+E
Sbjct: 343 QQKTRGKDFAERLTPRILGRAWQMLLKGIAEVQSAPRPLAAADMVLVRLTHAADLPTPDE 402

Query: 357 IARYIVE 363
             R + +
Sbjct: 403 ALRQLAD 409


>gi|307942775|ref|ZP_07658120.1| DNA polymerase III subunit tau [Roseibium sp. TrichSKD4]
 gi|307773571|gb|EFO32787.1| DNA polymerase III subunit tau [Roseibium sp. TrichSKD4]
          Length = 610

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/355 (55%), Positives = 267/355 (75%), Gaps = 1/355 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKT-AHIDVPTVEF 59
           ++GQ+PM++TL NAF++GRIAQ++ML+G RG+GKTTTARI+AR LNY+    +D PTV+ 
Sbjct: 36  LVGQEPMVQTLENAFETGRIAQAWMLTGVRGVGKTTTARILARGLNYEVPGEVDRPTVQL 95

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
              G HC+AI+ G HVDV+E+DAASHT I D+REIID   Y+P +AR++VYI+DEV MLS
Sbjct: 96  TQEGTHCRAIMGGRHVDVIEMDAASHTGIGDIREIIDASRYRPATARYKVYIIDEVHMLS 155

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RI    L+ L  +I  
Sbjct: 156 NAAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRIDQAKLVGLLRRISD 215

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E I+   EA+ +IARA +GSARD LSLLDQA+AR +  +    +R ML LADR R++DL
Sbjct: 216 AEEIQISDEALLLIARAGEGSARDSLSLLDQAMARASGPMEADDLRQMLGLADRARVIDL 275

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F +++ G +   + E  +QY+ G +P+++L DLA+FTHLVTR+K  P+ AD    +E E 
Sbjct: 276 FEHVMAGRVAEAMDELQAQYEVGADPAIVLTDLADFTHLVTRVKVAPKAADEASVTEVER 335

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
            R  ++++++SI  LSR WQ++LKG+ E++   +P+ A +MVL+RLA+A  LP P
Sbjct: 336 TRGREFAEKLSIRILSRAWQILLKGVQEVQAAPKPLAAADMVLVRLAYAADLPDP 390


>gi|146337878|ref|YP_001202926.1| DNA polymerase III subunits gamma and tau [Bradyrhizobium sp.
           ORS278]
 gi|146190684|emb|CAL74688.1| Putative DNA polymerase III (gamma and tau subunits)
           [Bradyrhizobium sp. ORS278]
          Length = 615

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 197/363 (54%), Positives = 266/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 36  LIGQEAVVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 95

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+D++E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 96  MPVLGTHCQAIMESRHMDILEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 155

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L++    I 
Sbjct: 156 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLAGIA 215

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E +  +PEA+ +IARA++GS RD LSLLDQAIA    ++    VR ML LADR R++D
Sbjct: 216 TKEGVTIEPEALGIIARAAEGSVRDSLSLLDQAIAHSAGEVRADDVRQMLGLADRTRVID 275

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF YL  GDI    +EF  QYD G +P V+L DLAEF + VTR+K +P  AD + +SE E
Sbjct: 276 LFHYLASGDIAAAFKEFREQYDVGADPVVVLSDLAEFVNFVTRVKVVPATADNVAFSETE 335

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++S+  LSR WQM+LKGI+E +G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 336 RLRARDFATKLSMRVLSRMWQMLLKGIAETQGATRPAAAAEMVLVRIAYAADLPTPDEAI 395

Query: 359 RYI 361
           R I
Sbjct: 396 RMI 398


>gi|75674567|ref|YP_316988.1| DNA polymerase III subunits gamma and tau [Nitrobacter winogradskyi
           Nb-255]
 gi|74419437|gb|ABA03636.1| DNA polymerase III gamma/tau subunits [Nitrobacter winogradskyi
           Nb-255]
          Length = 611

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/363 (54%), Positives = 271/363 (74%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV--PTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+ A   V  PT+ 
Sbjct: 48  LIGQEALVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYQLADGSVQGPTIR 107

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 108 MPQLGVHCRAIMESRHIDVLEMDAASHTGVDDVRQINDSVRYAPSSARYKVYIIDEVHML 167

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I 
Sbjct: 168 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEAEVLMAHLAAIA 227

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++E +PEA+ ++ARA++GS RD LSLLDQAIA     +   +VR ML LADR R++D
Sbjct: 228 AKENVEAEPEALGILARAAEGSVRDSLSLLDQAIAHAAGVVRADAVRRMLGLADRTRVID 287

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI +   EF SQY++G +P V+L DLAEF + VTRIK +P +AD + + EAE
Sbjct: 288 LFEALARGDIASAFGEFRSQYETGADPVVVLSDLAEFVNFVTRIKIVPAIADNVAFGEAE 347

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++SI  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 348 RLRASDFAVKLSIRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYVADLPTPDEAI 407

Query: 359 RYI 361
           R +
Sbjct: 408 RLL 410


>gi|92116083|ref|YP_575812.1| DNA polymerase III subunits gamma and tau [Nitrobacter hamburgensis
           X14]
 gi|91798977|gb|ABE61352.1| DNA polymerase III, subunits gamma and tau [Nitrobacter
           hamburgensis X14]
          Length = 615

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 268/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 48  LIGQEALVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIR 107

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 108 MPKLGVHCQAIMESRHIDVLEMDAASHTGVDDVRQINDSVRYAPSSARYKVYIIDEVHML 167

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I 
Sbjct: 168 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLKRVDADVLVTHLGNIA 227

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++E +PEA+ ++ARA++GS RD LSL DQAIA     +   +VR ML LADR R++D
Sbjct: 228 AKENVEVEPEALGIVARAAEGSVRDSLSLFDQAIAHAAGVVRADAVRQMLGLADRTRVID 287

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI +  +EF  QYD+G +P V+L DLAEF + VTRIK +P +AD + + E E
Sbjct: 288 LFYSLARGDIASAFREFRDQYDTGADPVVVLSDLAEFVNFVTRIKIVPALADNIAFGETE 347

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 348 RLRARDFAAKLSMRVLSRMWQMLLKGITEVQGATRPAAAAEMVLVRIAYVADLPTPDEAI 407

Query: 359 RYI 361
           R +
Sbjct: 408 RML 410


>gi|299132608|ref|ZP_07025803.1| DNA polymerase III, subunits gamma and tau [Afipia sp. 1NLS2]
 gi|298592745|gb|EFI52945.1| DNA polymerase III, subunits gamma and tau [Afipia sp. 1NLS2]
          Length = 616

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 196/365 (53%), Positives = 265/365 (72%), Gaps = 2/365 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ M++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 48  LIGQEAMVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKAPTIT 107

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+DV+E+DAASHT IDDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 108 MPTPGVHCQAIMESRHIDVLEMDAASHTGIDDVRQITDGVRYAPSSARYKVYIIDEVHML 167

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I+
Sbjct: 168 SEKAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVDADVLMSHLANIV 227

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E +PEA+ +IARA++GS RD LSLLDQAIA     +    VR ML LADR+R++D
Sbjct: 228 TREGVEAEPEALGLIARAAEGSVRDSLSLLDQAIAHAAGLVRAEDVRQMLGLADRSRVID 287

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF +L KGDI +   EF  QYD+G +P V+L DLAEF + VTR+K +P  AD +   EAE
Sbjct: 288 LFEHLAKGDIASAFAEFREQYDTGADPVVVLSDLAEFVNFVTRVKVVPATADNVALGEAE 347

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++ ++S+  LSR WQM+LKGI+E++  +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 348 RTRGREFATKLSMRVLSRMWQMLLKGIAEVQNATRPQAAAEMVLVRIAYVADLPTPDEAI 407

Query: 359 RYIVE 363
           + I E
Sbjct: 408 KMIGE 412


>gi|148258531|ref|YP_001243116.1| DNA polymerase III subunits gamma and tau [Bradyrhizobium sp.
           BTAi1]
 gi|146410704|gb|ABQ39210.1| Putative DNA polymerase III (gamma and tau subunits)
           [Bradyrhizobium sp. BTAi1]
          Length = 613

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 266/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 36  LIGQEAVVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 95

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+D++E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 96  MPVLGTHCQAIMESRHMDILEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 155

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L++    I 
Sbjct: 156 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLAGIA 215

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E +  +PEA+ +IARA++GS RD LSLLDQAIA    ++    VR ML LADR R++D
Sbjct: 216 TKEGVTIEPEALGIIARAAEGSVRDSLSLLDQAIAHSAGEVRADDVRQMLGLADRTRVID 275

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF +L  GDI    +EF  QYD G +P V+L DLAEF + VTR+K +P  AD + +SE E
Sbjct: 276 LFHHLASGDIAAAFKEFREQYDVGADPVVVLSDLAEFVNFVTRVKVVPATADNVAFSETE 335

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++S+  LSR WQM+LKGI+E +G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 336 RLRARDFATKLSMRVLSRMWQMLLKGIAETQGATRPAAAAEMVLVRIAYAADLPTPDEAI 395

Query: 359 RYI 361
           R I
Sbjct: 396 RMI 398


>gi|154246111|ref|YP_001417069.1| DNA polymerase III, subunits gamma and tau [Xanthobacter
           autotrophicus Py2]
 gi|154160196|gb|ABS67412.1| DNA polymerase III, subunits gamma and tau [Xanthobacter
           autotrophicus Py2]
          Length = 622

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/363 (54%), Positives = 268/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKT--AHIDVPTVE 58
           +IGQ+ M++TL NAF SGRIAQ+Y+L+G RG+GKTTTARI+AR+LNY+        P+++
Sbjct: 56  LIGQEAMVRTLRNAFSSGRIAQAYILTGVRGVGKTTTARILARALNYEPMDGSAGGPSLD 115

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+ C+ II   HVDV+E+DAAS+TSI+D+REII+   Y+P+ AR++VYI+DEV ML
Sbjct: 116 LSVMGKQCRDIIESRHVDVMEMDAASNTSINDIREIIESARYRPVMARYKVYIIDEVHML 175

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R+  G+L      I 
Sbjct: 176 STAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRVEAGELAAHLAGIC 235

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E +  +PEA+A++ARA++GS RD LSLLDQAIA     +    VR +L LAD+ R++D
Sbjct: 236 AKEGVTIEPEALAIVARAAEGSVRDSLSLLDQAIAHGGGAVGAEEVRRLLGLADKGRVID 295

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L+KG++   L EF  QYD+G +P+VIL DLAEFTHLVTR+K +P+ A      EAE
Sbjct: 296 LFEALMKGEMARALAEFRDQYDAGADPAVILTDLAEFTHLVTRLKIMPDAAQDAALVEAE 355

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R L+ ++ +S+  L+R WQM+ KGI E++   +P +A EM L+RL +A  LP+P+E  
Sbjct: 356 RVRGLEMAQGLSMRVLARAWQMLTKGIGEVQQAPKPAQAAEMALVRLGYATDLPTPDEAL 415

Query: 359 RYI 361
           R +
Sbjct: 416 RRL 418


>gi|91974569|ref|YP_567228.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris BisB5]
 gi|91681025|gb|ABE37327.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris BisB5]
          Length = 624

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/371 (52%), Positives = 268/371 (72%), Gaps = 2/371 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF +GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 44  LIGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYEMPDGSVKGPTIH 103

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 104 MPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 163

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L++    I 
Sbjct: 164 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLAGIA 223

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E +E +PEA+ +IARA++GS RD LSL DQAIA     +    VR ML LADR R+++
Sbjct: 224 AKEGVEVEPEALGIIARAAEGSVRDSLSLFDQAIAHAAGLVRADQVRQMLGLADRTRVIE 283

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI +  QEF  QYD+G +P V+L DLAEF + VTR+K +P  AD + + E E
Sbjct: 284 LFDALARGDIASAFQEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPATADNVAFGETE 343

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R   ++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 344 RLRGRDFAAKLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYAADLPTPDEAL 403

Query: 359 RYIVEEKKKKT 369
           R + ++    T
Sbjct: 404 RMLAQDGGSAT 414


>gi|85717152|ref|ZP_01048111.1| DNA polymerase III subunits gamma and tau [Nitrobacter sp. Nb-311A]
 gi|85696043|gb|EAQ33942.1| DNA polymerase III subunits gamma and tau [Nitrobacter sp. Nb-311A]
          Length = 827

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 269/363 (74%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV--PTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+ A   V  PT+ 
Sbjct: 261 LIGQEALVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELADGSVQGPTIR 320

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 321 MPQLGVHCRAIMESRHIDVLEMDAASHTGVDDVRQINDGVRYAPSSARYKVYIIDEVHML 380

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           ST AFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I 
Sbjct: 381 STPAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEAEVLMAHLASIA 440

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++E +PEA+ ++ARA++GS RD LSLLDQAIA     +   +VR ML LADR RI+D
Sbjct: 441 AKENVEVEPEALGIVARAAEGSVRDSLSLLDQAIAHAAGVVRADAVRQMLGLADRTRIID 500

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI +   EF SQY++G +P V+L DLAEF + VTRIK +P +AD + + E E
Sbjct: 501 LFEALARGDIASAFGEFRSQYETGADPVVVLSDLAEFVNFVTRIKIVPAIADNVAFGETE 560

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 561 RLRARDFAVKLSMRVLSRMWQMLLKGITEVQGATRPAAAAEMVLVRIAYVADLPTPDEAI 620

Query: 359 RYI 361
           R +
Sbjct: 621 RLL 623


>gi|39933692|ref|NP_945968.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris CGA009]
 gi|39647538|emb|CAE26059.1| possible DNA polymerase III tau subunit [Rhodopseudomonas palustris
           CGA009]
          Length = 623

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 267/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF +GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 42  LIGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 101

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 102 MPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 161

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+   + I 
Sbjct: 162 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMNHLSNIA 221

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q+E +E +PEA+ ++ARA++GS RD LSL DQAIA     +   +VR ML LADR R+++
Sbjct: 222 QKEGVEVEPEALGIVARAAEGSVRDSLSLFDQAIAHAAGVVRADAVRQMLGLADRTRVIE 281

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI     EF  QYD+G +P V+L DLAEF + VTR+K +P +AD + + E E
Sbjct: 282 LFDALARGDIAAAFAEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPAIADNVAFGETE 341

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 342 RVRGREFAAKLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYAADLPTPDEAL 401

Query: 359 RYI 361
           R +
Sbjct: 402 RML 404


>gi|298294413|ref|YP_003696352.1| DNA polymerase III subunits gamma and tau [Starkeya novella DSM
           506]
 gi|296930924|gb|ADH91733.1| DNA polymerase III, subunits gamma and tau [Starkeya novella DSM
           506]
          Length = 658

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/376 (54%), Positives = 269/376 (71%), Gaps = 13/376 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAH--------I 52
           +IGQ+ M++TL+NAF SGRIAQ+Y+L+G RG+GKTTTARI+AR+LNY+ A          
Sbjct: 55  LIGQEAMVRTLSNAFTSGRIAQAYILTGVRGVGKTTTARILARALNYEPADGPAGANTVP 114

Query: 53  DVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIM 112
             PT++    G HC+ II   HVDV E+DAAS+T I D+REII+   YKP+ AR++V+I+
Sbjct: 115 SAPTLDMPALGRHCRDIIESRHVDVQEMDAASNTGIGDIREIIEAARYKPVLARYKVFII 174

Query: 113 DEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIE 172
           DEV MLSTAAFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSR QRFDL R+  G L  
Sbjct: 175 DEVHMLSTAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRTQRFDLRRVEAGTLAR 234

Query: 173 LFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC-----NDKIVTSSVRLM 227
               I   E +  D EA++++ARA++GS RD LSLLDQAIA        + +    VR +
Sbjct: 235 HLRAICDAEGVGIDTEALSLVARAAEGSVRDALSLLDQAIAHAGGQSSGNTVHGEQVRAL 294

Query: 228 LALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE 287
           L LADR R++DLF  L+KGD+   L E   QYDSG +P+V++ DLAEFTHLVT++K IPE
Sbjct: 295 LGLADRGRVIDLFEALMKGDVAQALTELREQYDSGADPAVVIADLAEFTHLVTKLKIIPE 354

Query: 288 MADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
            AD     EAE  R   ++K +S+  L+R WQM+ KG+SE++  ++PM+A EMVL+RLA+
Sbjct: 355 TADDPALVEAERVRGRDFAKALSMRVLARAWQMLTKGLSEVQQAAKPMQAAEMVLVRLAY 414

Query: 348 AVQLPSPEEIARYIVE 363
           A  LP+P+E  R + E
Sbjct: 415 ASDLPTPDEALRRLRE 430


>gi|192289049|ref|YP_001989654.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris TIE-1]
 gi|192282798|gb|ACE99178.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris TIE-1]
          Length = 623

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 267/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF +GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 42  LIGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 101

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 102 MPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 161

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+   + I 
Sbjct: 162 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMNHLSNIA 221

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q+E +E +PEA+ ++ARA++GS RD LSL DQAIA     +   +VR ML LADR R+++
Sbjct: 222 QKEGVEVEPEALGIVARAAEGSVRDSLSLFDQAIAHAAGVVRADAVRQMLGLADRTRVIE 281

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI     EF  QYD+G +P V+L DLAEF + VTR+K +P +AD + + E E
Sbjct: 282 LFDALARGDIAAAFAEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPAIADNVAFGETE 341

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 342 RVRGREFATKLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYAADLPTPDEAL 401

Query: 359 RYI 361
           R +
Sbjct: 402 RML 404


>gi|316932084|ref|YP_004107066.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris DX-1]
 gi|315599798|gb|ADU42333.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris DX-1]
          Length = 624

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 267/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF +GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 42  LIGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 101

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 102 MPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 161

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+   + I 
Sbjct: 162 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMNHLSNIA 221

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q+E +E +PEA+ +IARA++GS RD LSL DQAIA     +   +VR ML LADR R+++
Sbjct: 222 QKEGVEVEPEALGIIARAAEGSVRDSLSLFDQAIAHAAGLVRADAVRQMLGLADRTRVIE 281

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI     EF  QYD+G +P V+L DLAEF + VTR+K +P +AD + + E E
Sbjct: 282 LFDALARGDIAAAFAEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPAIADNVAFGETE 341

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++ ++S+  LSR WQM+LKG++E++G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 342 RLRGREFAAKLSMRVLSRMWQMLLKGVAEVQGATRPAAAAEMVLVRIAYAADLPTPDEAL 401

Query: 359 RYI 361
           R +
Sbjct: 402 RML 404


>gi|158421766|ref|YP_001523058.1| ATPase [Azorhizobium caulinodans ORS 571]
 gi|158328655|dbj|BAF86140.1| ATPase [Azorhizobium caulinodans ORS 571]
          Length = 613

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 276/363 (76%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKT--AHIDVPTVE 58
           +IGQ+ M++TL+NAF SGRIAQ+Y+L+G RG+GKTTTARI+AR+LNY+        P+++
Sbjct: 43  LIGQEAMVRTLSNAFASGRIAQAYILTGVRGVGKTTTARILARALNYEPMDGSPGGPSLD 102

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
              FG+HC+ II   HVDV+E+DAAS+TSI+D+REII+   Y+P+ AR++VYI+DEV ML
Sbjct: 103 LSVFGKHCKDIIESRHVDVMEMDAASNTSINDIREIIEGSRYRPVMARYKVYIIDEVHML 162

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R+  G L    ++I 
Sbjct: 163 STAAFNGLLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRVEAGVLAAHLSRIC 222

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++  D EA++++ARA++GS RD LSLLDQAIA     +    VR +L LAD+ R++D
Sbjct: 223 AKENVSVDAEALSIVARAAEGSVRDSLSLLDQAIAHGGGAVTGEEVRRLLGLADKARVID 282

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L+KGD+   L EF  QYDSG +P+VIL DLAEFTHLVTR+K +P+ A      EAE
Sbjct: 283 LFDALMKGDMPRALAEFRDQYDSGADPAVILTDLAEFTHLVTRLKIVPDSASDASLVEAE 342

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R ++ ++ +S+  LSR WQM+ KGI+E++  ++P +A EMVL+RLA+A  LP+P+E  
Sbjct: 343 RIRGVEMAEALSMRVLSRTWQMLTKGIAEVQQAAKPAQAAEMVLVRLAYAADLPTPDEAL 402

Query: 359 RYI 361
           R +
Sbjct: 403 RKL 405


>gi|220924618|ref|YP_002499920.1| DNA polymerase III subunits gamma and tau [Methylobacterium
           nodulans ORS 2060]
 gi|219949225|gb|ACL59617.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           nodulans ORS 2060]
          Length = 605

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 263/367 (71%), Gaps = 5/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV--PTVE 58
           +IGQ  M++TL NAF++GRI Q++ML+G RG+GKTTTARI+AR LNY         PT+ 
Sbjct: 46  LIGQGAMVRTLANAFEAGRIPQAWMLTGVRGVGKTTTARILARGLNYALPDDPQAGPTIR 105

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC AI+   H+DV+E+DAASHT IDDVR+IID I Y P+SAR++VYI+DEV ML
Sbjct: 106 MPALGLHCAAIMESRHIDVLEMDAASHTGIDDVRQIIDGIRYAPVSARYKVYIVDEVHML 165

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+  G LI    KI 
Sbjct: 166 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEAGTLIAHLQKIC 225

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           + E +  +PEA+A IARA++GS RD LSLLDQAIA    ++   +VR ML LADR RI+D
Sbjct: 226 EAEGVAAEPEALAGIARAAEGSVRDSLSLLDQAIAHGAGRVTAETVRDMLGLADRARIID 285

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMA--DTLLYSE 296
           LF   ++GD  +   E  +Q+++G +PSV+L DLAEFTHLVTR+K  PE A  D+ L SE
Sbjct: 286 LFEAAMRGDAPSAFAELRAQHEAGADPSVVLQDLAEFTHLVTRLKVAPETARSDSAL-SE 344

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           AE AR   ++  +S+  LSR WQ++LK I E++   RP+ A EM L+RL +A  LP+P+E
Sbjct: 345 AERARGSDFADRLSVRALSRAWQILLKAIPEVQAAPRPLAAAEMALVRLIYAADLPTPDE 404

Query: 357 IARYIVE 363
             R + E
Sbjct: 405 ALRQVKE 411


>gi|209886655|ref|YP_002290512.1| DNA polymerase III, subunits gamma and tau [Oligotropha
           carboxidovorans OM5]
 gi|209874851|gb|ACI94647.1| DNA polymerase III, subunits gamma and tau [Oligotropha
           carboxidovorans OM5]
          Length = 632

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 263/365 (72%), Gaps = 2/365 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ M++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+        P++ 
Sbjct: 57  LIGQEAMVRTISNAFETGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSAKGPSIA 116

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+DV+E+DAASHT IDDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 117 MPVPGVHCQAIMESRHIDVLEMDAASHTGIDDVRQITDGVRYAPSSARYKVYIIDEVHML 176

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I+
Sbjct: 177 SEKAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVDAEVLMTHLANIV 236

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E +PEA+ +IARA++GS RD LSLLDQAIA     +    VR ML LADR R++D
Sbjct: 237 TREGVEAEPEALGLIARAAEGSVRDSLSLLDQAIAHAAGLVRAEDVRQMLGLADRTRVID 296

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF +L KGDI +   EF  QYD+G +P V+L DLAEF + VTR+K +P  AD +   EAE
Sbjct: 297 LFEHLAKGDIASAFAEFREQYDTGADPVVVLSDLAEFVNFVTRVKVVPATADNVALGEAE 356

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++ ++S+  LSR WQM+LKGI+E++  +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 357 RTRGREFATKLSMRVLSRMWQMLLKGIAEVQNATRPQAAAEMVLVRVAYVADLPTPDEAI 416

Query: 359 RYIVE 363
           + I E
Sbjct: 417 KMIGE 421


>gi|90426319|ref|YP_534689.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris BisB18]
 gi|90108333|gb|ABD90370.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris BisB18]
          Length = 618

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/358 (53%), Positives = 261/358 (72%), Gaps = 2/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ  M++TL+NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 40  LIGQDAMVRTLSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYEMPDGSVTAPTIH 99

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+DV+E+DAASHT I+DVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 100 MPVPGVHCQAIMESRHIDVLEMDAASHTGIEDVRQITDGVRYSPTSARYKVYIIDEVHML 159

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L+     I 
Sbjct: 160 SDKAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMAHLANIA 219

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +E++E +PEA+ +IARA++GS RD LSL DQAIA     +   +VR ML LADR R++D
Sbjct: 220 GKENVEVEPEALGIIARAAEGSVRDSLSLFDQAIAHAAGTVRADAVRQMLGLADRTRVID 279

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF +L  GDI +   EF  QYD G +P V+L DLAEF + VTR+K +P  A+ + + E E
Sbjct: 280 LFAHLAGGDIASAFGEFREQYDVGADPVVVLSDLAEFVNFVTRVKIVPATAENVAFGETE 339

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
             RA +++ ++S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+   LP+P+E
Sbjct: 340 RLRAREFAAKLSMRVLSRMWQMLLKGITEVQGATRPAAAAEMVLVRIAYVADLPTPDE 397


>gi|27383227|ref|NP_774756.1| DNA polymerase III subunits gamma and tau [Bradyrhizobium japonicum
           USDA 110]
 gi|27356401|dbj|BAC53381.1| DNA polymerase III tau subunit [Bradyrhizobium japonicum USDA 110]
          Length = 613

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 266/363 (73%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF++GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 36  LIGQEAVVRTVSNAFETGRIPQAWILTGVRGVGKTTTARILARALNYEMPDGSVKGPTIH 95

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HCQAI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 96  MPNLGVHCQAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 155

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L++    I 
Sbjct: 156 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLASIA 215

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            +ES+E +PEA+ +IARA++GS RD LSLLDQAIA     +   +VR ML LADR R++D
Sbjct: 216 AKESVEIEPEALGIIARAAEGSVRDSLSLLDQAIAHAAGTVKADAVRQMLGLADRTRVID 275

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI    +EF  QYD G +P V+L DLAEF + VTR+K +P  AD + Y E E
Sbjct: 276 LFDSLARGDIAAAFKEFRDQYDVGADPIVVLSDLAEFVNFVTRVKIVPATADNVAYGETE 335

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             RA  ++ ++S+  LSR WQM+LKGI+E++  +RP  A EMVL+R+A+   LP+P+E  
Sbjct: 336 RVRARDFASKISMRVLSRMWQMLLKGITEVQAATRPAAAAEMVLVRIAYVADLPTPDEAI 395

Query: 359 RYI 361
           R +
Sbjct: 396 RML 398


>gi|86747794|ref|YP_484290.1| DNA polymerase III subunits gamma and tau [Rhodopseudomonas
           palustris HaA2]
 gi|86570822|gb|ABD05379.1| DNA polymerase III, subunits gamma and tau [Rhodopseudomonas
           palustris HaA2]
          Length = 627

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/363 (52%), Positives = 263/363 (72%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK--TAHIDVPTVE 58
           +IGQ+ +++T++NAF +GRI Q+++L+G RG+GKTTTARI+AR+LNY+     +  PT+ 
Sbjct: 49  LIGQEAVVRTVSNAFDTGRIPQAWILTGVRGVGKTTTARILARALNYELPDGSVKGPTIH 108

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC+AI+   H+DV+E+DAASHT +DDVR+I D + Y P SAR++VYI+DEV ML
Sbjct: 109 MPVHGVHCKAIMESRHMDVLEMDAASHTGVDDVRQINDSVRYAPASARYKVYIIDEVHML 168

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           STAAFN  LKTLEEPP H KF+FATTEIRK+P+TVLSRCQRFDL R+    L++    I 
Sbjct: 169 STAAFNAFLKTLEEPPEHAKFVFATTEIRKVPVTVLSRCQRFDLRRVEADVLMKHLGGIA 228

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           ++E +E + EA+ +IARA++GS RD LSL DQAIA     +    VR ML LADR R+++
Sbjct: 229 EKEGVEVEAEALGIIARAAEGSVRDSLSLFDQAIAHAAGLVRADQVRQMLGLADRTRVIE 288

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L +GDI     EF  QYD+G +P V+L DLAEF + VTR+K +P  AD + + E E
Sbjct: 289 LFDALARGDIAAAFAEFRDQYDTGADPVVVLSDLAEFVNFVTRVKIVPATADNVAFGETE 348

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  +++  +S+  LSR WQM+LKGI+E++G +RP  A EMVL+R+A+A  LP+P+E  
Sbjct: 349 RLRGREFATRLSMRVLSRMWQMLLKGIAEVQGATRPAAAAEMVLVRIAYAADLPTPDEAI 408

Query: 359 RYI 361
           R I
Sbjct: 409 RMI 411


>gi|188581065|ref|YP_001924510.1| DNA polymerase III, subunits gamma and tau [Methylobacterium populi
           BJ001]
 gi|179344563|gb|ACB79975.1| DNA polymerase III, subunits gamma and tau [Methylobacterium populi
           BJ001]
          Length = 623

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 255/363 (70%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL NAF + RI Q++ML+G RG+GKTTTARI+AR LNY +T   D  PTV 
Sbjct: 45  LIGQGAMVRTLANAFSANRIPQAWMLTGVRGVGKTTTARILARGLNYVRTGQPDTGPTVS 104

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+HCQAI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 105 MPELGQHCQAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYAPVSARYKVYIVDEVHML 164

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     KI 
Sbjct: 165 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLSAHLKKIC 224

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E + EA+A + RA++GS RD LSLLDQAIA     +  + VR ML LADR+RI+D
Sbjct: 225 AAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVTAAGVRDMLGLADRSRIVD 284

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF   ++GDI     E  +QYD+G +P+V+L DLA FTHLVTR+K +P        SEAE
Sbjct: 285 LFEAAMRGDIPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAE 344

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  Q++  + +  LSR WQ++LK + E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 345 RVRGAQFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 404

Query: 359 RYI 361
           R +
Sbjct: 405 RQL 407


>gi|240138441|ref|YP_002962913.1| DNA polymerase III, tau and gamma subunits [Methylobacterium
           extorquens AM1]
 gi|240008410|gb|ACS39636.1| DNA polymerase III, tau and gamma subunits [Methylobacterium
           extorquens AM1]
          Length = 626

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 256/363 (70%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL NAF + RI Q++ML+G RG+GKTTTARI+AR LNY +T   D  PTV 
Sbjct: 44  LIGQGAMVRTLGNAFAANRIPQAWMLTGVRGVGKTTTARILARGLNYLRTGQPDTGPTVS 103

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+HCQAI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 104 MPELGQHCQAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYSPVSARYKVYIVDEVHML 163

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     KI 
Sbjct: 164 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLAAHLKKIC 223

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E + EA+A + RA++GS RD LSLLDQAIA     +  + VR ML LADR+RI+D
Sbjct: 224 AAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVSAAGVRDMLGLADRSRIVD 283

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++GD+     E  +QYD+G +P+V+L DLA FTHLVTR+K +P        SEAE
Sbjct: 284 LFEAVMRGDVPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAE 343

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R + ++  + +  LSR WQ++LK + E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 344 RVRGVAFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 403

Query: 359 RYI 361
           R +
Sbjct: 404 RQL 406


>gi|163851288|ref|YP_001639331.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           extorquens PA1]
 gi|163662893|gb|ABY30260.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           extorquens PA1]
          Length = 628

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 256/363 (70%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL NAF + RI Q++ML+G RG+GKTTTARI+AR LNY +T   D  PTV 
Sbjct: 46  LIGQGAMVRTLGNAFAANRIPQAWMLTGVRGVGKTTTARILARGLNYLRTGQPDTGPTVS 105

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+HCQAI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 106 MPELGQHCQAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYSPVSARYKVYIVDEVHML 165

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     KI 
Sbjct: 166 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLAAHLKKIC 225

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E + EA+A + RA++GS RD LSLLDQAIA     +  + VR ML LADR+RI+D
Sbjct: 226 AAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVSAAGVRDMLGLADRSRIVD 285

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++GD+     E  +QYD+G +P+V+L DLA FTHLVTR+K +P        SEAE
Sbjct: 286 LFEAVMRGDVPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAE 345

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R + ++  + +  LSR WQ++LK + E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 346 RVRGVAFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 405

Query: 359 RYI 361
           R +
Sbjct: 406 RQL 408


>gi|218530155|ref|YP_002420971.1| DNA polymerase III subunits gamma and tau [Methylobacterium
           chloromethanicum CM4]
 gi|218522458|gb|ACK83043.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           chloromethanicum CM4]
          Length = 626

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 256/363 (70%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL NAF + RI Q++ML+G RG+GKTTTARI+AR LNY +T   D  PTV 
Sbjct: 44  LIGQGAMVRTLGNAFAANRIPQAWMLTGVRGVGKTTTARILARGLNYLRTGQPDTGPTVS 103

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+HCQAI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 104 MPELGQHCQAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYSPVSARYKVYIVDEVHML 163

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     KI 
Sbjct: 164 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLAAHLKKIC 223

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E + EA+A + RA++GS RD LSLLDQAIA     +  + VR ML LADR+RI+D
Sbjct: 224 AAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVSAAGVRDMLGLADRSRIVD 283

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++GD+     E  +QYD+G +P+V+L DLA FTHLVTR+K +P        SEAE
Sbjct: 284 LFEAVMRGDVPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAE 343

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R + ++  + +  LSR WQ++LK + E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 344 RVRGVAFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 403

Query: 359 RYI 361
           R +
Sbjct: 404 RQL 406


>gi|254560987|ref|YP_003068082.1| DNA polymerase III, tau and subunit gammas [Methylobacterium
           extorquens DM4]
 gi|254268265|emb|CAX24200.1| DNA polymerase III, tau and gamma subunits [Methylobacterium
           extorquens DM4]
          Length = 626

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 255/363 (70%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL NAF + RI Q++ML+G RG+GKTTTARI+AR LNY +T   D  PTV 
Sbjct: 44  LIGQGAMVRTLGNAFAANRIPQAWMLTGVRGVGKTTTARILARGLNYLRTGQPDTGPTVS 103

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G+HC AI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 104 MPELGQHCHAIMESRHMDVLEMDAASHTGIDDVRGIIDGIRYSPVSARYKVYIVDEVHML 163

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     KI 
Sbjct: 164 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEADVLAAHLKKIC 223

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +E + EA+A + RA++GS RD LSLLDQAIA     +  + VR ML LADR+RI+D
Sbjct: 224 AAEGVEAEDEALAAVTRAAEGSVRDALSLLDQAIAHGAGAVSAAGVRDMLGLADRSRIVD 283

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++GD+     E  +QYD+G +P+V+L DLA FTHLVTR+K +P        SEAE
Sbjct: 284 LFEAVMRGDVPAAFAEIRAQYDAGADPAVVLSDLAGFTHLVTRLKLVPGAEADPTLSEAE 343

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R + ++  + +  LSR WQ++LK + E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 344 RVRGVAFAGRLPVRALSRAWQILLKALPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 403

Query: 359 RYI 361
           R +
Sbjct: 404 RQL 406


>gi|154250711|ref|YP_001411535.1| DNA polymerase III subunits gamma and tau [Parvibaculum
           lavamentivorans DS-1]
 gi|154154661|gb|ABS61878.1| DNA polymerase III, subunits gamma and tau [Parvibaculum
           lavamentivorans DS-1]
          Length = 623

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/362 (54%), Positives = 265/362 (73%), Gaps = 5/362 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHI-----DVP 55
           ++GQ+ M++TL+NAF++ R+A ++ML+G RG+GKTTTARI+AR+LNY+           P
Sbjct: 58  LVGQEAMVRTLSNAFETDRVAHAFMLTGVRGVGKTTTARILARALNYEKPGATKGDGSGP 117

Query: 56  TVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEV 115
           T+  +G G HC+AI+   HVDV+E+DAAS T IDD+REIID + Y P+SAR++VYI+DEV
Sbjct: 118 TIHMDGLGVHCEAIMESRHVDVMEMDAASRTGIDDIREIIDSVRYLPVSARYKVYIIDEV 177

Query: 116 QMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFT 175
            MLS  AFNGLLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R+S+ +L  L  
Sbjct: 178 HMLSKQAFNGLLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRLSVEELTGLLG 237

Query: 176 KILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNR 235
            +  +E +E +  A+ ++ARA+DGSARD LSLLD+AI+   + ++ S VR ML LADR R
Sbjct: 238 SVATKEHVEAEDAALRLVARAADGSARDALSLLDRAISHGENGVLESDVRDMLGLADRAR 297

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           + DLF  L+KGDI   L E  +QYD G +P V+L DLAE TH +TR+K +   +D +  S
Sbjct: 298 VFDLFDLLMKGDIGGALTELRAQYDVGADPVVVLSDLAELTHWLTRLKLVEGASDDVAMS 357

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E E  R    ++ + I  LSR WQM+LKG++E++G +RP+ A EMVL+RLA+    P PE
Sbjct: 358 ETERTRGRDMAERLPIRVLSRVWQMLLKGLTEVQGAARPIAAAEMVLVRLAYVADGPGPE 417

Query: 356 EI 357
           E+
Sbjct: 418 EL 419


>gi|170749547|ref|YP_001755807.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656069|gb|ACB25124.1| DNA polymerase III, subunits gamma and tau [Methylobacterium
           radiotolerans JCM 2831]
          Length = 637

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/363 (53%), Positives = 250/363 (68%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDV-PTVE 58
           +IGQ  M++TL N F + RI Q++ML+G RG+GKTTTARI+AR LNY +    D  PTV 
Sbjct: 42  LIGQDAMVRTLANGFAANRIPQAWMLTGVRGVGKTTTARILARGLNYARAGQPDTGPTVS 101

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
               G HC AI+   H+DV+E+DAASHT IDDVR IID I Y P+SAR++VYI+DEV ML
Sbjct: 102 MPELGLHCAAIMESRHMDVLEMDAASHTGIDDVRAIIDGIRYGPVSARYKVYIVDEVHML 161

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+    L     K+ 
Sbjct: 162 SEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEAPTLHAHLAKVC 221

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E +  + EA+  I RA++GS RD LSLLDQAIA     I   SVR ML LADR RI+D
Sbjct: 222 AAEEVTVEDEALGAIVRAAEGSVRDALSLLDQAIAHGAGTITAQSVRDMLGLADRARILD 281

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++G +     E  +QYDSG +PSV+L DLA FTHLVTR+K +PE A     SE E
Sbjct: 282 LFEAVMRGSVPAAFAELRAQYDSGADPSVVLSDLAAFTHLVTRLKVVPEAAADPTLSETE 341

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R   ++ ++SI  LSR WQ++LK I E++   RP+ A EM ++RLA+A  LP+P+E  
Sbjct: 342 RVRGAAFADKLSIRALSRAWQILLKAIPEVQAAPRPLAAAEMAIVRLAYAADLPTPDEAL 401

Query: 359 RYI 361
           R +
Sbjct: 402 RQL 404


>gi|170742371|ref|YP_001771026.1| DNA polymerase III subunits gamma and tau [Methylobacterium sp.
           4-46]
 gi|168196645|gb|ACA18592.1| DNA polymerase III, subunits gamma and tau [Methylobacterium sp.
           4-46]
          Length = 605

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/368 (54%), Positives = 260/368 (70%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV---PTV 57
           +IGQ  M++TL NAF++GRI Q++ML+G RG+GKTTTARI+AR LNY  A  D    PT+
Sbjct: 44  LIGQGAMVRTLANAFEAGRIPQAWMLTGVRGVGKTTTARILARGLNYALAG-DAKAGPTI 102

Query: 58  EFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQM 117
                G HC AI+   H+DV+E+DAASHT IDDVR+IID I Y P+SAR++VYI+DEV M
Sbjct: 103 RMPTLGLHCAAIMESRHIDVLEMDAASHTGIDDVRQIIDGIRYAPVSARYKVYIVDEVHM 162

Query: 118 LSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKI 177
           LS  AFN  LKTLEEPPPH KF+FATTEIRK+P+T+LSRCQRFDL R+  G L+    +I
Sbjct: 163 LSEKAFNAFLKTLEEPPPHAKFVFATTEIRKVPVTILSRCQRFDLRRVEAGTLVAHLHRI 222

Query: 178 LQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIM 237
              E +  +PEA+A IARA++GS RD LSLLDQAIA    ++   +VR ML LADR RI+
Sbjct: 223 CDAEGVAVEPEALAAIARAAEGSVRDSLSLLDQAIAHGAGRVTAETVRDMLGLADRARII 282

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEM--ADTLLYS 295
           DLF   ++GD      E   QY++G +P+V+L DLA FTHLVTR+K  PE   ADT L S
Sbjct: 283 DLFEAAMRGDAPAAFAELHGQYEAGADPAVVLQDLAGFTHLVTRLKVAPETARADTAL-S 341

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           EAE  R   ++  +S+  LSR WQ++L+ I E++   RP+ A EM L+RL +A  LP+P+
Sbjct: 342 EAERGRGSDFADRLSVRALSRAWQILLRAIPEVQAAPRPLAAAEMALVRLIYAADLPTPD 401

Query: 356 EIARYIVE 363
           E  R + E
Sbjct: 402 EALRQVRE 409


>gi|23016072|ref|ZP_00055832.1| COG2812: DNA polymerase III, gamma/tau subunits [Magnetospirillum
           magnetotacticum MS-1]
          Length = 597

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/358 (52%), Positives = 258/358 (72%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ+ M++TL+NA K+GR+A +++L+G RG+GKTTTARIIAR+LN   T     PT++ 
Sbjct: 25  LIGQEAMVRTLSNAIKTGRLAHAFVLTGVRGVGKTTTARIIARALNCVGTDGKGGPTIDP 84

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI    HVD++E+DAAS T ++D+REII+ + Y+P SARF+VYI+DEV MLS
Sbjct: 85  CGVCEHCRAIAEDRHVDILEMDAASRTGVNDIREIIEGVRYRPTSARFKVYIIDEVHMLS 144

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           TAAFN LLKTLEEPP HVKFIFATTEIRKIP+TVLSRCQRFDL R+ +  L   F  I  
Sbjct: 145 TAAFNALLKTLEEPPEHVKFIFATTEIRKIPVTVLSRCQRFDLRRVEMEVLSRHFEAIAA 204

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E  E +P A+ +IARA+DGS RDGLSLLDQAI+     +  + VR ML LADR R+ DL
Sbjct: 205 KEGAEIEPAALKLIARAADGSVRDGLSLLDQAISHGAGAVTETQVRDMLGLADRARVFDL 264

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              ++KGD+   L + + QY +G +P+V+L D+ E  H +TR+K  P+ AD L   E E 
Sbjct: 265 LDAVMKGDVPTALDQITDQYAAGADPAVVLQDMLELVHWLTRLKVTPDAADQLGAPETER 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            +  + +K +S+  L+R WQM+LKG++E      P++A EM ++RLA+A +LP+P E+
Sbjct: 325 VKGAEMAKTLSLAALTRAWQMLLKGLTETRNAPNPLQAAEMAVVRLAYAAELPTPAEL 382


>gi|217976468|ref|YP_002360615.1| DNA polymerase III, subunits gamma and tau [Methylocella silvestris
           BL2]
 gi|217501844|gb|ACK49253.1| DNA polymerase III, subunits gamma and tau [Methylocella silvestris
           BL2]
          Length = 628

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 258/375 (68%), Gaps = 13/375 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK------TAHIDV 54
           +IGQ+ M++TL+NAF  GRI Q+Y+L+G RG+GKTTTARI+AR+ NY+         +D 
Sbjct: 50  LIGQEAMVRTLSNAFDLGRIHQAYILTGVRGVGKTTTARILARAFNYELPTGDGRPAVDG 109

Query: 55  PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDE 114
           PT+   GFG HCQAI+   HVDV+E+DAASHT IDDVREII+   YKP+ ARF+VYI+DE
Sbjct: 110 PTIHMAGFGAHCQAIMESRHVDVIEMDAASHTGIDDVREIIEGARYKPVMARFKVYIIDE 169

Query: 115 VQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELF 174
           V MLS  AFNGLLKTLEEPP HVKF+FATTEI K+P+TV SRCQRFDL RI  G+L    
Sbjct: 170 VHMLSRQAFNGLLKTLEEPPDHVKFLFATTEIEKVPVTVRSRCQRFDLRRIDAGELSTFL 229

Query: 175 TKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDK-------IVTSSVRLM 227
             I   E +  + EA+A+IARA++GS RD LSLLDQAIA            I   ++R M
Sbjct: 230 ATICAREKVAIEDEALALIARAAEGSVRDALSLLDQAIAHGPSADQIGAKGISAEALRAM 289

Query: 228 LALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE 287
           L LADR RI+DLF  L++G I   L      YD G +P+ I+ +LAEFTHLVTR+K  PE
Sbjct: 290 LGLADRGRIIDLFDALMRGRIAEALTGLKDLYDGGADPTAIMVELAEFTHLVTRLKLAPE 349

Query: 288 MADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
            ++    +  E  R  +++  +S+  L+R WQ++ KG+ EI+   RP+ A +MVL+RLA+
Sbjct: 350 SSEDSSITPEERKRGAEFAASLSMAVLTRTWQLLSKGLQEIKDSPRPLAAADMVLVRLAY 409

Query: 348 AVQLPSPEEIARYIV 362
           A  LP+P++  R + 
Sbjct: 410 AADLPTPDKALRKLA 424


>gi|323136736|ref|ZP_08071817.1| DNA polymerase III, subunits gamma and tau [Methylocystis sp. ATCC
           49242]
 gi|322398053|gb|EFY00574.1| DNA polymerase III, subunits gamma and tau [Methylocystis sp. ATCC
           49242]
          Length = 610

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 261/372 (70%), Gaps = 11/372 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK------TAHIDV 54
           +IGQ+PM++TL NAF  GRI Q+Y+L+G RG+GKTTTARI+AR+ NY+         ID 
Sbjct: 44  LIGQEPMVRTLENAFDLGRIHQAYLLTGVRGVGKTTTARILARAFNYELPAKDGRPAIDK 103

Query: 55  PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDE 114
           PT+  +  G HCQAII   HVDV+E+DAASHT IDDVREIID   Y+P+ AR +VYI+DE
Sbjct: 104 PTIHMDELGVHCQAIIDSRHVDVLEMDAASHTGIDDVREIIDNARYRPVMARTKVYIIDE 163

Query: 115 VQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELF 174
           V MLS AAFNGLLKTLEEPP HVKFIFATTEI K+P+TV SRCQRFDL RI  G L    
Sbjct: 164 VHMLSKAAFNGLLKTLEEPPEHVKFIFATTEIDKVPVTVRSRCQRFDLRRIDAGLLASHL 223

Query: 175 TKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAI-----ARCNDKIVTSSVRLMLA 229
             I ++E++  +P+A+AMIARA++GSARD LSLLDQAI           I    +RLML 
Sbjct: 224 RGICEKENVAIEPDALAMIARAAEGSARDALSLLDQAIAYGSAHAAGGAIAADDLRLMLG 283

Query: 230 LADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMA 289
           +AD+ R++DLF  ++ GD+   +     QY+ G +P+ +L +LAEFTHL TR+K  PE A
Sbjct: 284 VADKARVIDLFETVMAGDVGRAIALLEDQYNGGADPAQVLLELAEFTHLATRLKLAPETA 343

Query: 290 DTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAV 349
            +   +  E  R    ++ +S+  L+R WQ+++KG+ E+ G  RP++A +MVL+RLA+A 
Sbjct: 344 QSAALTPEEKRRGSDAAERLSVPALTRAWQILMKGVDELRGSQRPLQAADMVLVRLAYAA 403

Query: 350 QLPSPEEIARYI 361
            +P+P E+ + +
Sbjct: 404 DMPTPGELLKQL 415


>gi|83313202|ref|YP_423466.1| DNA polymerase III subunits gamma and tau [Magnetospirillum
           magneticum AMB-1]
 gi|82948043|dbj|BAE52907.1| DNA polymerase III, gamma/tau subunits [Magnetospirillum magneticum
           AMB-1]
          Length = 599

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/360 (52%), Positives = 258/360 (71%), Gaps = 5/360 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV---PTV 57
           +IGQ+ M++TL+NA K+GR+A +++L+G RG+GKTTTARIIAR+LN     +D    PT+
Sbjct: 28  LIGQEAMVRTLSNAIKTGRLAHAFVLTGVRGVGKTTTARIIARALN--CVGLDGKGGPTI 85

Query: 58  EFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQM 117
           +  G  EHC+AI    HVD++E+DAAS T ++D+REII+ + Y+P SARF++YI+DEV M
Sbjct: 86  DPCGQCEHCRAIAEDRHVDILEMDAASRTGVNDIREIIEGVRYRPTSARFKIYIIDEVHM 145

Query: 118 LSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKI 177
           LSTAAFN LLKTLEEPP HVKF+FATTEIRKIP+TVLSRCQRFDL R+ +  L + F  I
Sbjct: 146 LSTAAFNALLKTLEEPPEHVKFVFATTEIRKIPVTVLSRCQRFDLRRVEMEVLAKHFESI 205

Query: 178 LQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIM 237
             +E  E +P A+ +IARA+DGS RDGLSLLDQAI+     +  + VR ML LADR R+ 
Sbjct: 206 AAKEQAEIEPAALKLIARAADGSVRDGLSLLDQAISHGAGAVTEAQVRDMLGLADRARVF 265

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DL   ++KG +   L + + QY +G +P V+L D+ E  H +TR+K  P+ AD L  SE 
Sbjct: 266 DLLDAIMKGQVPAALDQITDQYAAGADPVVVLQDMLELVHWLTRLKVTPDAADQLGASET 325

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           E  +  + SK +S+  L+R WQM+LKG+ E      P++A EM ++RLA+A +LPSP E+
Sbjct: 326 ERVKGAEMSKTLSLAALTRAWQMLLKGLGETRNAPNPLQAAEMAVVRLAYAAELPSPAEL 385


>gi|260427427|ref|ZP_05781406.1| DNA polymerase III subunit tau [Citreicella sp. SE45]
 gi|260421919|gb|EEX15170.1| DNA polymerase III subunit tau [Citreicella sp. SE45]
          Length = 588

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 249/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAFK+GRIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 23  LVGQDAMVRTLKNAFKAGRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGEGGPTTEP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI+ G HVDV+E+DAAS+T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 83  CGVCEHCKAIMEGRHVDVMEMDAASNTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 143 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRKIAS 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            ES E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R+MDL
Sbjct: 203 SESAEITDDALALITRAAEGSARDATSLLDQAISHGAGETTAEQVRAMLGLADRGRVMDL 262

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S QY  G +P  +L DLAE TH V+ +K  PE A+    S  E 
Sbjct: 263 FEKIMRGDAPGALTELSEQYADGADPLAVLRDLAELTHWVSVVKITPEAAEDPTISPDER 322

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    S  + +  L+R WQM+LK + E+      M A EM +IRL H  +LPSPEE+ R
Sbjct: 323 ARGQALSANLGMRALTRMWQMLLKALDEVAQAPNAMMAAEMAVIRLTHVAELPSPEELIR 382

Query: 360 YI 361
            +
Sbjct: 383 RL 384


>gi|144898666|emb|CAM75530.1| DNA-directed DNA polymerase [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 586

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/358 (52%), Positives = 255/358 (71%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ  M++TLTNA  SGR+A +++L+G RG+GKTTTARIIAR+LN         PT++ 
Sbjct: 25  LIGQDAMVRTLTNAIASGRLAHAFVLTGVRGVGKTTTARIIARALNCIGPDGQGGPTIDP 84

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI    HVD++E+DAAS T ++D+REII+ + Y+P SARF+VYI+DEV MLS
Sbjct: 85  CGQCEHCRAIAEDRHVDILEMDAASRTGVNDIREIIESVRYRPTSARFKVYIIDEVHMLS 144

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           TAAFN LLKTLEEPP HVKFIFATTEIRKIP+TVLSRCQRFDL R+ +  L + F+ I  
Sbjct: 145 TAAFNALLKTLEEPPEHVKFIFATTEIRKIPVTVLSRCQRFDLRRVEMEVLAKHFSGIAD 204

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E  E +P A+ +IARA+DGS RDGLSLLDQAI+     +  + VR ML LADR R+ DL
Sbjct: 205 KEGAEIEPGALRLIARAADGSVRDGLSLLDQAISHGAGLVSEAQVRDMLGLADRARVFDL 264

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KG +   L   + QY  G +P+V++ D+ E  H +TR+K  P+ AD+   SE E 
Sbjct: 265 FELVMKGQMAPALDLLAEQYALGADPAVVVQDMLELAHWLTRLKITPDAADSSAASETEK 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            +  Q + ++S+  L+R WQM+LKG++E+     P++A EM L+RLA+   LPSP ++
Sbjct: 325 VKGTQMAGDLSMAQLTRTWQMLLKGLAEVRAAPNPLQAAEMSLVRLAYVADLPSPADL 382


>gi|163732699|ref|ZP_02140144.1| DNA polymerase III subunits gamma and tau [Roseobacter litoralis
           Och 149]
 gi|161394059|gb|EDQ18383.1| DNA polymerase III subunits gamma and tau [Roseobacter litoralis
           Och 149]
          Length = 584

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 249/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 24  LVGQDAMVQTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGTSGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 84  CGTCEHCTAIMEGRHVDVMEMDAASNTGVANIREIIDSVHYRAASARYKVYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  KI  
Sbjct: 144 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLMRKIAT 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+IARA++GSARD  SLLDQAI+    +   + VR ML LADR R++DL
Sbjct: 204 AEGAEIAQDAMALIARAAEGSARDATSLLDQAISHGAGETTAAQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  PE A+    S  E 
Sbjct: 264 FDMILRGDTAGALTELSAQYAEGADPMAVLRDLAEITHWVSVVKITPEAAEDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R L+ +  + +  L+R WQM+LK + E+      M A EM +IRL H   +P+PEE+ R
Sbjct: 324 SRGLEMAGTLPMRVLTRLWQMLLKALDEVASAPNAMMAAEMAIIRLTHVADMPTPEELVR 383

Query: 360 YI 361
            +
Sbjct: 384 KL 385


>gi|84685226|ref|ZP_01013125.1| DNA polymerase III subunits gamma and tau [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666958|gb|EAQ13429.1| DNA polymerase III subunits gamma and tau [Rhodobacterales
           bacterium HTCC2654]
          Length = 576

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/364 (53%), Positives = 249/364 (68%), Gaps = 1/364 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ+ M++TL NAF + RIAQ+++++G RGIGKTTTARIIA+ +N      +  PTVE 
Sbjct: 22  LIGQEAMVRTLRNAFAADRIAQAFVMTGIRGIGKTTTARIIAKGMNCIGPDGNGGPTVEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI  G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 82  CGECEHCVAIAEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI   D+I L  +I  
Sbjct: 142 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEDMIGLLRRIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           EE  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 202 EEKAEIADDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ IK  PE A+    S  E 
Sbjct: 262 IDMILRGDAAGALAELSAQYADGADPMAVLRDLAEVTHWVSVIKITPEAAEDPTVSPDER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    ++ +S   L+R WQM+LK I E+      M A EM +IRL H   LPSPEE+ +
Sbjct: 322 ARGQAMAEALSQRVLARMWQMLLKAIEEVGMAPNAMMAAEMAVIRLTHVSDLPSPEELVK 381

Query: 360 YIVE 363
            + E
Sbjct: 382 KLQE 385


>gi|83594802|ref|YP_428554.1| DNA polymerase III subunits gamma and tau [Rhodospirillum rubrum
           ATCC 11170]
 gi|83577716|gb|ABC24267.1| DNA-directed DNA polymerase [Rhodospirillum rubrum ATCC 11170]
          Length = 659

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/362 (53%), Positives = 248/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVP-TVEF 59
           +IGQ+ +++TLTNA  SGR+AQ++ML+G RG+GKTTTAR+IAR+LN   A      T+  
Sbjct: 53  LIGQEALVRTLTNAIDSGRLAQAWMLTGVRGVGKTTTARLIARALNCVGADGKGGVTITP 112

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI    HVDV+E+DAAS T + D+REI+D + Y+P  AR +VYI+DEV MLS
Sbjct: 113 CGVCEHCKAIAEDRHVDVLEMDAASRTGVGDIREILDGVRYRPAVARTKVYIIDEVHMLS 172

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           TAAFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R+S  +L   F +I  
Sbjct: 173 TAAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRVSAAELSGHFLRIAG 232

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E  P A+ +IARA+DGS RDGLSLLDQAIA     +  + V  ML LADR RI DL
Sbjct: 233 LEGAEIAPSALTLIARAADGSVRDGLSLLDQAIAHGGGTVSEAQVAEMLGLADRARIFDL 292

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              L+ G I   L     QY  G +P VI+ DL +  H +TR+K +P  A+     EAE 
Sbjct: 293 LDALLAGRIAESLDLLDRQYALGADPLVIVQDLLDLVHWMTRVKVVPVSAEDAAVPEAER 352

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    ++ +S+  L+R WQ++LKG+ E  G   P++AVEMVLIRLA+A  LP+PEE  +
Sbjct: 353 TRGRAMAERLSMAVLNRCWQILLKGLGEARGAPVPLQAVEMVLIRLAYASDLPTPEEALK 412

Query: 360 YI 361
            I
Sbjct: 413 MI 414


>gi|110678389|ref|YP_681396.1| DNA polymerase III subunits gamma and tau [Roseobacter
           denitrificans OCh 114]
 gi|109454505|gb|ABG30710.1| DNA polymerase III, tau subunit [Roseobacter denitrificans OCh 114]
          Length = 582

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 248/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT + 
Sbjct: 24  LVGQDAMVQTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGTGRPTTDP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 84  CGTCEHCTAIMEGRHVDVMEMDAASNTGVANIREIIDSVHYRAASARYKVYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  KI  
Sbjct: 144 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLMRKIAT 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+IARA++GSARD  SLLDQAI+    +   + VR ML LADR R++DL
Sbjct: 204 AEGAEIAQDAMALIARAAEGSARDATSLLDQAISHGAGETTAAQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  PE A+    S  E 
Sbjct: 264 FDMILRGDTAGALTELSAQYAEGADPMAVLRDLAEITHWVSVVKITPEAAEDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R L+ +  + +  L+R WQM+LK + E+      M A EM +IRL H   LP+P E+ R
Sbjct: 324 SRGLEMAGALPMRVLTRLWQMLLKALDEVASAPNAMMAAEMAIIRLTHVADLPTPGELVR 383

Query: 360 YI 361
            +
Sbjct: 384 QL 385


>gi|254487014|ref|ZP_05100219.1| DNA polymerase III, tau subunit [Roseobacter sp. GAI101]
 gi|214043883|gb|EEB84521.1| DNA polymerase III, tau subunit [Roseobacter sp. GAI101]
          Length = 578

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/362 (51%), Positives = 246/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 22  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 82  CGECEHCVAIMEGRHVDVMEMDAASNTGVGNIREIIDSVHYRAASARYKVYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMITLMRKIAS 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 202 AEGAEIADDALALITRAAEGSARDATSLLDQAISHGAGETTAVQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E SSQY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 262 FDMILRGDAAGALNELSSQYSDGADPMAVLRDLAEITHWVSVVKITPDAAEDPTVSPEER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R L  ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 322 SRGLTMAETLPMRVLTRLWQMLLKALDEVASAPNAMMAAEMAVIRLTHVADLPSPEELTR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|149916416|ref|ZP_01904935.1| DNA polymerase III subunits gamma and tau [Roseobacter sp. AzwK-3b]
 gi|149809686|gb|EDM69540.1| DNA polymerase III subunits gamma and tau [Roseobacter sp. AzwK-3b]
          Length = 596

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 244/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAFK+ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 24  LVGQDAMVRTLKNAFKADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGQGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + DVREIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEHCTAIMEGRHVDVLEMDAASRTGVGDVREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +   + VR ML LADR R++DL
Sbjct: 204 AEGAQITDDALALITRAAEGSARDATSLLDQAISHGAGETSAAEVRSMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E   QY  G +P  +L DLAE TH ++ +K  PE AD       E 
Sbjct: 264 FDLIMKGDAAGALTELGGQYAEGADPMAVLRDLAEITHWISVVKITPEAADDPTIGPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PEE+ R
Sbjct: 324 ARGQQMAEALPMRVLTRMWQMLLKALDEVAEAPNAMMAAEMAVIRLTHVADLPTPEELVR 383

Query: 360 YI 361
            +
Sbjct: 384 KL 385


>gi|83855097|ref|ZP_00948627.1| DNA polymerase III subunits gamma and tau [Sulfitobacter sp.
           NAS-14.1]
 gi|83842940|gb|EAP82107.1| DNA polymerase III subunits gamma and tau [Sulfitobacter sp.
           NAS-14.1]
          Length = 582

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 247/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 22  LVGQDAMVRTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 82  CGVCEHCVAIMEGRHVDVMEMDAASNTGVGNIREIIDSVHYRAASARYKVYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALMRKIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 202 AEGAEIADDALALITRAAEGSARDATSLLDQAISHGAGETTAVQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E  +QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 262 FDMILRGDAAGALDELGNQYSDGADPMAVLRDLAEITHWVSVVKITPDAAEDPTVSPEER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R +  ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+AR
Sbjct: 322 SRGVTMAETLPMRVLTRLWQMLLKALDEVASAPNAMMAAEMAVIRLTHVADLPSPEELAR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|83941620|ref|ZP_00954082.1| DNA polymerase III, gamma and tau subunits [Sulfitobacter sp.
           EE-36]
 gi|83847440|gb|EAP85315.1| DNA polymerase III, gamma and tau subunits [Sulfitobacter sp.
           EE-36]
          Length = 582

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 247/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 22  LVGQDAMVRTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 82  CGVCEHCVAIMEGRHVDVMEMDAASNTGVGNIREIIDSVHYRAASARYKVYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALMRKIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 202 AEGAEIAEDALALITRAAEGSARDATSLLDQAISHGAGETTAVQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E  +QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 262 FDMILRGDAAGALDELGNQYSDGADPMAVLRDLAEITHWVSVVKITPDAAEDPTVSPEER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R +  ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+AR
Sbjct: 322 SRGVTMAETLPMRVLTRLWQMLLKALDEVASAPNAMMAAEMAVIRLTHVADLPSPEELAR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|148552984|ref|YP_001260566.1| DNA polymerase III subunits gamma and tau [Sphingomonas wittichii
           RW1]
 gi|148498174|gb|ABQ66428.1| DNA polymerase III, subunits gamma and tau [Sphingomonas wittichii
           RW1]
          Length = 582

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/363 (51%), Positives = 250/363 (68%), Gaps = 3/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ  M+ TL NA + GR+A +++L+G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 23  LIGQDAMVTTLANAIRRGRLAHAFLLTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DVVE+DAASHTSIDDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 83  CGVCEPCVAIAEGRHIDVVEMDAASHTSIDDVREIIEAVRYASVSARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFNGLLKTLEEPP HVKF+FATTE+ K+PITVLSRCQRFDL RI+   L   FT ++ 
Sbjct: 143 KSAFNGLLKTLEEPPAHVKFLFATTEVNKVPITVLSRCQRFDLRRITADKLAAHFTNVVA 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E +E DPEA+A+IARA++GSARDGLS+LDQAIA  + ++    VR ML L+DR  +  L
Sbjct: 203 AEGVEADPEALALIARAAEGSARDGLSILDQAIAHGSGRVEAQQVRDMLGLSDRGAVRRL 262

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           FG ++KGD   VL     QYD GV P  +LH L E  H +TR K +    D  L +E   
Sbjct: 263 FGEMLKGDAAAVLASIRGQYDLGVEPVAMLHGLLETCHAITRAK-VAGTDDPALSAEERE 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           A    ++ ++    L R WQ++LKG  E++  + P+EA EM L+R+ HA QLP P E+AR
Sbjct: 322 AYG-DWAGKLGFATLHRLWQLLLKGHGEVQTAAMPIEAAEMALLRVVHASQLPDPGELAR 380

Query: 360 YIV 362
            + 
Sbjct: 381 RLA 383


>gi|254462224|ref|ZP_05075640.1| DNA polymerase III, gamma and tau subunit [Rhodobacterales
           bacterium HTCC2083]
 gi|206678813|gb|EDZ43300.1| DNA polymerase III, gamma and tau subunit [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 583

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 249/362 (68%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ+ M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 24  LVGQEAMVRTLKNAFEADRIAQAFVMTGIRGTGKTTTARIIAKGINCIGPDGTGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E+C AI+ G HVDV+E+DAAS T + D+REII+ ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGVCENCVAIMEGRHVDVMEMDAASRTGVGDIREIIESVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI   D+I +  +I  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEDMIGMLQRIAA 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 GEHAEIAEDALALITRAAEGSARDATSLLDQAISHGAGETTVEQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           +  +++GD    L E   QY +G +P  +L DLAE TH ++ +K  P+ AD    S  E 
Sbjct: 264 YQMIMRGDAAAALTELGEQYAAGADPMAVLRDLAEITHWISVVKITPDAADDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR LQ + ++ +  ++R WQM+LK + E+      M A EM +IRL H  +LPSPEE+ R
Sbjct: 324 ARGLQMANDLPMRAMTRMWQMLLKALDEVASAPNSMMAAEMAIIRLTHVAELPSPEELIR 383

Query: 360 YI 361
            +
Sbjct: 384 KL 385


>gi|114763364|ref|ZP_01442771.1| DNA polymerase III subunits gamma and tau [Pelagibaca bermudensis
           HTCC2601]
 gi|114543902|gb|EAU46913.1| DNA polymerase III subunits gamma and tau [Roseovarius sp.
           HTCC2601]
          Length = 588

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 245/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAFK+GRIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 23  LVGQDAMVRTLKNAFKAGRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGEGGPTTEP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI+ G HVDV+E+DAAS+T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 83  CGECEHCKAIMEGRHVDVIEMDAASNTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 143 NSAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMISLLRRIAT 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A++ RA++GSARD  SLLDQAI+    +     VR ML LADR R+MDL
Sbjct: 203 AEQAEITDDALALVTRAAEGSARDATSLLDQAISHGAGETTAEQVRAMLGLADRGRVMDL 262

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++ GD    L E S QY  G +P  +L DLAE TH  + +K  PE A+    S  E 
Sbjct: 263 FEKIMYGDAPGALTELSQQYADGADPLAVLRDLAEITHWTSVVKITPEAAEDPTISPDER 322

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    +  + +  L+R WQM+LK + E+      M A EM +IRL H  +LPSPEE+ R
Sbjct: 323 ARGETMAANLGMRALTRMWQMLLKALDEVAQAPNAMMAAEMAVIRLTHVAELPSPEELLR 382

Query: 360 YI 361
            +
Sbjct: 383 KL 384


>gi|114770074|ref|ZP_01447612.1| DNA polymerase III subunits gamma and tau [alpha proteobacterium
           HTCC2255]
 gi|114548911|gb|EAU51794.1| DNA polymerase III subunits gamma and tau [alpha proteobacterium
           HTCC2255]
          Length = 594

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/362 (51%), Positives = 244/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           M+GQ  M++TL NAF++ RIA +++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 27  MVGQDAMVRTLKNAFEADRIAHAFVMTGIRGTGKTTTARIIAKGMNCVGVDGTGGPTTEP 86

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC +II+G HVDV+E+DAAS T + D+REIID ++Y   SAR+++YI+DEV MLS
Sbjct: 87  CGQCEHCLSIIQGRHVDVMEMDAASRTGVGDIREIIDSVHYSAASARYKIYIIDEVHMLS 146

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRKIP+TVLSRCQRFDL RI   D++EL  KI +
Sbjct: 147 TSAFNALLKTLEEPPAHVKFIFATTEIRKIPVTVLSRCQRFDLRRIEPDDMMELLKKIAE 206

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I R S+GSARD +SLLDQAIA    +     VR ML LADR R++DL
Sbjct: 207 SEEAKISQDALALITRGSEGSARDAISLLDQAIAHGAGETNADQVRAMLGLADRGRVLDL 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++G     L+E S QY  G +P  IL DLAE TH ++ IK  P+  D    S  E 
Sbjct: 267 FDMIMRGQADKALEELSGQYADGADPLAILRDLAEITHWISVIKISPQTVDDPTVSPDER 326

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    + ++ +  ++R WQM+LK I E+      M A EM +IRL H   LPSPEE+ +
Sbjct: 327 ERGKAAASDLPMRAMTRMWQMLLKAIEEVSSAPNAMMAAEMAIIRLTHVADLPSPEELIK 386

Query: 360 YI 361
            I
Sbjct: 387 KI 388


>gi|83951302|ref|ZP_00960034.1| DNA polymerase III subunits gamma and tau [Roseovarius nubinhibens
           ISM]
 gi|83836308|gb|EAP75605.1| DNA polymerase III subunits gamma and tau [Roseovarius nubinhibens
           ISM]
          Length = 620

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 245/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 24  LVGQDAMVRTLKNAFQADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEHCTAIMEGRHVDVLEMDAASRTGVGDIREIIDSVAYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 144 TSAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 AEQAQISDDALALITRAAEGSARDATSLLDQAISHGAGETTAEQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E S+QY  G +P  +L DLAE TH V+ +K  PE A+       E 
Sbjct: 264 FDLILKGDAAGALTEISTQYADGADPLAVLRDLAEVTHWVSVVKITPEAAEDPTIGPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPE++ R
Sbjct: 324 ARGQQMAEALPMRVLTRMWQMLLKALEEVAAAPNTMMAAEMAVIRLTHVADLPSPEDLLR 383

Query: 360 YI 361
            +
Sbjct: 384 RL 385


>gi|85703838|ref|ZP_01034941.1| DNA polymerase III subunits gamma and tau [Roseovarius sp. 217]
 gi|85671158|gb|EAQ26016.1| DNA polymerase III subunits gamma and tau [Roseovarius sp. 217]
          Length = 587

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 246/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 24  LVGQDAMVRTLKNAFQADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGMGTPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI+ G HVDV+E+DAAS T + D+REII+ + Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGVCEHCRAIMEGRHVDVMEMDAASRTGVGDIREIIESVNYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 144 VNAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +ES +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 KESAQISDDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH ++ +K  P+ AD       E 
Sbjct: 264 FDMILRGDAAGALSELSAQYAEGADPLAVLRDLAEITHWISVVKITPDAADDPTIGPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR L+ +  + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PE++ R
Sbjct: 324 ARGLEMATALPMRVLTRMWQMLLKALDEVAQSPNAMMAAEMAVIRLTHVADLPTPEDLVR 383

Query: 360 YI 361
            +
Sbjct: 384 RL 385


>gi|182677255|ref|YP_001831401.1| DNA polymerase III, subunits gamma and tau [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182633138|gb|ACB93912.1| DNA polymerase III, subunits gamma and tau [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 651

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 257/378 (67%), Gaps = 16/378 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAH------IDV 54
           +IGQ+ M+KTL+NAF   RI Q+Y+L+G RG+GKTTTARI+AR+ NY+         I+ 
Sbjct: 44  LIGQEAMVKTLSNAFDLDRIHQAYLLTGVRGVGKTTTARILARAFNYEVPAENGQPAIEK 103

Query: 55  PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDE 114
           PTV  + FG HCQAII   HVD++E+DAASHT IDD+REII+   Y+P+SAR +VYI+DE
Sbjct: 104 PTVHMDRFGVHCQAIIESRHVDIIEMDAASHTGIDDIREIIESARYRPVSARVKVYIIDE 163

Query: 115 VQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELF 174
           V MLS  AFNGLLKTLEEPP HVKFIFATTEI K+PITV SRCQRFDL RI    LI+  
Sbjct: 164 VHMLSKQAFNGLLKTLEEPPEHVKFIFATTEIDKVPITVRSRCQRFDLRRIEPAVLIDYL 223

Query: 175 TKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDK---------IVTSSVR 225
             +  +E++  + EA+ +IARA++GS RD LSLLDQAIA    +         I  + ++
Sbjct: 224 ASVCAKENVLIEREALGLIARAAEGSVRDALSLLDQAIAHGTGQADPHSSAQPISATDLQ 283

Query: 226 LMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYI 285
            ML LADR RI+DLF  +++GD+   L +  + +D G +P+ +L +LAEF H VTR+K  
Sbjct: 284 AMLGLADRARIIDLFEAVMRGDMAKALADLKNLHDCGADPAQVLVELAEFVHFVTRLKLS 343

Query: 286 PEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           P   D     E E +R    +  +S+  L+R WQ++ KG+ E++   RP+   +MVL+RL
Sbjct: 344 PHTFDAAATPE-ELSRGGAMAGTLSVMVLTRAWQILTKGLQEVKDSPRPLACADMVLVRL 402

Query: 346 AHAVQLPSPEEIARYIVE 363
           A+A  LP+P+ + R + +
Sbjct: 403 AYAADLPTPDVVLRQLAK 420


>gi|126739558|ref|ZP_01755250.1| DNA polymerase III subunits gamma and tau [Roseobacter sp.
           SK209-2-6]
 gi|126719204|gb|EBA15914.1| DNA polymerase III subunits gamma and tau [Roseobacter sp.
           SK209-2-6]
          Length = 603

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 242/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 28  LVGQDAMVRTLKNAFETNRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGTGQPTTEP 87

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 88  CGTCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVQYRAASARYKIYIIDEVHMLS 147

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 148 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALMRKIAT 207

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 208 AEGAEIHEDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 267

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E  +QY  G +P  +L DLAE TH V+ +K  P+ A     S  E 
Sbjct: 268 IDMILRGDAAGALSELGAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAKDPTISPDER 327

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 328 SRGQQMAEALPMRVLTRMWQMLLKALEEVSAAPNAMMAAEMAVIRLTHVADLPSPEELIR 387

Query: 360 YI 361
            +
Sbjct: 388 KL 389


>gi|296447822|ref|ZP_06889735.1| DNA polymerase III, subunits gamma and tau [Methylosinus
           trichosporium OB3b]
 gi|296254681|gb|EFH01795.1| DNA polymerase III, subunits gamma and tau [Methylosinus
           trichosporium OB3b]
          Length = 601

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/371 (50%), Positives = 254/371 (68%), Gaps = 10/371 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK------TAHIDV 54
           +IGQ+PM++TL NAF+  RI Q+Y+L+G RG+GKTTTARI+AR+ NY+         +D 
Sbjct: 41  LIGQEPMVRTLENAFQLNRIHQAYLLTGVRGVGKTTTARILARAFNYELPAADGRPAVDR 100

Query: 55  PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDE 114
           PT+  +  G HCQAII   H DV+E+DAASHT IDD+REII+   Y+P+ AR +VYI+DE
Sbjct: 101 PTIHMDALGVHCQAIIDSRHPDVLEMDAASHTGIDDIREIIENARYRPVMARVKVYIVDE 160

Query: 115 VQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELF 174
           V MLS AAFNGLLKTLEEPP HVKFIFATTEI K+P+TV SRCQRFDL RI  G L    
Sbjct: 161 VHMLSKAAFNGLLKTLEEPPEHVKFIFATTEIDKVPVTVRSRCQRFDLRRIDAGLLAGHL 220

Query: 175 TKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQ----AIARCNDKIVTSSVRLMLAL 230
            KI   ES+  + EA+AM+ARA++GSARD LSLLDQ      A+    I    +R ML +
Sbjct: 221 RKICDLESVAIEDEALAMVARAAEGSARDALSLLDQAIAHGAAQGGGAIAAEDLRHMLGV 280

Query: 231 ADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMAD 290
           AD++R++DLF   +KGDI   L     Q+D G +P  +L +LAEFTHLVTR+K  P    
Sbjct: 281 ADKSRVIDLFEAAMKGDIATALALLQEQHDGGGDPGQVLLELAEFTHLVTRLKLAPGAER 340

Query: 291 TLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ 350
           +   +E E  R    ++ +S++ L+R +Q+++K + E+    RP+ + +M L+RL HA +
Sbjct: 341 SSALTEEERRRGGAAAQTLSVSALTRAFQILMKAVDELRFSPRPLASADMALVRLTHAAE 400

Query: 351 LPSPEEIARYI 361
           +PSPEE  R +
Sbjct: 401 MPSPEEALRKL 411


>gi|300024235|ref|YP_003756846.1| DNA polymerase III subunits gamma and tau [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299526056|gb|ADJ24525.1| DNA polymerase III, subunits gamma and tau [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 617

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/366 (51%), Positives = 246/366 (67%), Gaps = 5/366 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYK-----TAHIDVP 55
           +IGQ  M+ TL NAF SGRIAQ YML+G RG+GKTTTARI+AR+LNY+        ID P
Sbjct: 39  LIGQSAMVTTLRNAFASGRIAQGYMLTGVRGVGKTTTARILARALNYEAPDSGNGAIDKP 98

Query: 56  TVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEV 115
           T++  G G HC+ I+ G H DV+E+DAAS+T +D++REII+   Y P+ AR +V+I+DEV
Sbjct: 99  TIDMPGLGVHCKDIMEGRHPDVLEIDAASNTGVDNIREIIESAQYTPLVARTKVFIIDEV 158

Query: 116 QMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFT 175
            MLS  AFN LLKTLEEPP HV+FIFATTEIRK+P+TVLSRCQRFDL R+    L   F 
Sbjct: 159 HMLSKGAFNALLKTLEEPPAHVRFIFATTEIRKVPVTVLSRCQRFDLRRVEQPVLAAHFK 218

Query: 176 KILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNR 235
           KI + E  E D +A+ +IARA++GS RDGLS+LDQAIA     +  +SVR ML LADR R
Sbjct: 219 KISESEGAEADADALQLIARAAEGSVRDGLSILDQAIAMGEGHVTAASVRDMLGLADRGR 278

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           I DL   + +GD+   L  F+S +  G   S ++ DLAE  H + R+K + E       +
Sbjct: 279 IFDLAEAIFRGDLPAALNGFASLHRDGAEASEVIGDLAEAVHAIARVKAVGEEPAGESLT 338

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
             E  R    +  +S+ +LSR WQM++KG+ E+     P  A EMVLIRLA+   LP+P+
Sbjct: 339 AEEKKRLSDLASRLSMPYLSRAWQMLIKGLEEVGRTPNPDVAAEMVLIRLAYTADLPTPD 398

Query: 356 EIARYI 361
           E+ R +
Sbjct: 399 ELIRGL 404


>gi|260432378|ref|ZP_05786349.1| DNA polymerase III subunits gamma and tau [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416206|gb|EEX09465.1| DNA polymerase III subunits gamma and tau [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 584

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 241/358 (67%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 24  LVGQDAMVRTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEHCVAIMEGRHVDVLEMDAASRTGVGDIREIIDSVRYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 144 TSAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIGLLRKIAT 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 AEGAEISDDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E  +QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 264 MDMILRGDAAGALTELGAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            R  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+
Sbjct: 324 TRGQQMAEALPMRVLTRMWQMLLKALEEVSAAPNAMMAAEMAVIRLTHVADLPSPEEL 381


>gi|146276573|ref|YP_001166732.1| DNA polymerase III subunits gamma and tau [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145554814|gb|ABP69427.1| DNA polymerase III, subunits gamma and tau [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 582

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 242/367 (65%), Gaps = 1/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  M++TL NAF + RIA +++++G RG+GKTTTARIIA+ LN      D  PT E 
Sbjct: 24  LIGQDAMVRTLKNAFAADRIAHAFVMTGVRGVGKTTTARIIAKGLNCVGPDGDGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C++I  G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGACEACRSIAEGRHVDVLEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I    K+  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLKRIEPEVMIAHLAKVAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E      +A+A+I RA++GS RD +SL+DQAIA    +     VR ML LADR R++DL
Sbjct: 204 KEGARLTADALALITRAAEGSVRDAMSLMDQAIAHGAGETTADEVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E S QY  G +P  IL DLAE TH ++ IK  P+ AD       E 
Sbjct: 264 FDLVMKGDAAGALAELSGQYADGADPMAILRDLAEITHWISIIKISPDAADDPTTPPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R L+ ++ + +  L+R WQM+LK I E+      M A EM +IRL H   LP PE + R
Sbjct: 324 TRGLEMAERLPMRVLTRMWQMLLKAIEEVSLAPNAMMAAEMAVIRLTHVADLPDPEALIR 383

Query: 360 YIVEEKK 366
            +  E +
Sbjct: 384 RLQSEPR 390


>gi|126733475|ref|ZP_01749222.1| DNA polymerase III, subunits gamma and tau [Roseobacter sp. CCS2]
 gi|126716341|gb|EBA13205.1| DNA polymerase III, subunits gamma and tau [Roseobacter sp. CCS2]
          Length = 612

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 239/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           M+GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 53  MVGQDAMVRTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGTGGPTTEP 112

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID ++Y+  SARF++YI+DEV MLS
Sbjct: 113 CGQCEHCVAIMEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARFKIYIIDEVHMLS 172

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIR++P+TVLSRCQRFDL RI     I L  KI  
Sbjct: 173 KNAFNALLKTLEEPPEHVKFIFATTEIRQVPVTVLSRCQRFDLRRIEPETQIALLRKIAT 232

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   EA+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 233 AEGAEITDEALALITRAAEGSARDAQSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 292

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++G+    L E S QY  G +P  +L DLAE  H ++ IK  PE A+    S  E 
Sbjct: 293 FDMILRGEAAAALTELSGQYADGADPMAVLRDLAEVCHWISVIKITPEAAEDPTISPDER 352

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    + ++ +  +SR WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 353 TRGQAMATDLPMRVMSRMWQMLLKALEEVAQAPNAMMAAEMAVIRLTHVADLPSPEELVR 412

Query: 360 YI 361
            +
Sbjct: 413 KL 414


>gi|209965591|ref|YP_002298506.1| DNA polymerase III subunits gamma and tau [Rhodospirillum centenum
           SW]
 gi|209959057|gb|ACI99693.1| DNA polymerase III, subunits gamma and tau, putative
           [Rhodospirillum centenum SW]
          Length = 640

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/362 (50%), Positives = 253/362 (69%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           ++GQ  +++TL NA +SGRI Q+YML+G RG+GKTTTARIIAR+LN         PT+  
Sbjct: 38  LVGQDALVRTLRNAIQSGRIHQAYMLTGVRGVGKTTTARIIARALNCVGPDGKGGPTITP 97

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C++I    +VDV+E+DAAS+T +D++REIID + Y P +AR+++YI+DEV MLS
Sbjct: 98  CGVCEQCRSIAADRNVDVLEMDAASNTGVDNIREIIDGVRYAPAAARYKLYIIDEVHMLS 157

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPPHVKF+FATTEIRK+PITVLSRCQRFDL R+  G L+  FT+I  
Sbjct: 158 KGAFNALLKTLEEPPPHVKFVFATTEIRKVPITVLSRCQRFDLRRVDQGTLVGHFTRIAG 217

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E +E D EA+++IARA+DGS RDGLSLLDQAIA  + ++    VR ML LADR  I+DL
Sbjct: 218 KEGVEADAEAISLIARAADGSVRDGLSLLDQAIALGSGRVTAEQVRDMLGLADRGLIVDL 277

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F   +     + L      +  G +P VI+ DL +FTH +TR + +P  A+     E E 
Sbjct: 278 FEAAMAARPADALGVLDGLHRRGADPVVIVQDLLDFTHFLTRTRVVPGTAEDPAIPETER 337

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R +  +  + +  L+R WQ++LKG+ E++    PM+A+EMV+IRLA+A +LP+P ++ +
Sbjct: 338 TRGVALAGALGMPALTRAWQILLKGLGEVQQAPVPMQALEMVVIRLAYASELPTPGDLLK 397

Query: 360 YI 361
            I
Sbjct: 398 KI 399


>gi|294678278|ref|YP_003578893.1| DNA polymerase III subunit gamma/tau [Rhodobacter capsulatus SB
           1003]
 gi|294477098|gb|ADE86486.1| DNA polymerase III, gamma/tau subunit [Rhodobacter capsulatus SB
           1003]
          Length = 589

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 241/363 (66%), Gaps = 1/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+ M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ LN         PT E 
Sbjct: 29  LIGQEAMVRTLKNAFAASRIAQAFIMTGIRGTGKTTTARIIAKGLNCIGPDGTGQPTTEP 88

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
               EHC+AI  G HVDV+E+DAAS T + D+REII+ + Y+  SAR++VYI+DEV MLS
Sbjct: 89  CLVCEHCRAIAEGRHVDVLEMDAASRTGVGDIREIIESVNYRAASARYKVYIIDEVHMLS 148

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I   +K+  
Sbjct: 149 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMINHLSKVAT 208

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E+ +   +A+A+I RA++GS RD +SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 209 KENAQIAEDALALITRAAEGSVRDAMSLLDQAISHGAGETTADQVRAMLGLADRARVLDL 268

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E  +QY  G +P  +L DLAE TH V+ IK  PE A+       E 
Sbjct: 269 FDMILKGDAAAALTELGAQYSDGADPMAVLRDLAEITHWVSVIKITPEAAEDPTVPPEER 328

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    ++ + +  LSR WQM+LK I E+      M A EM LIRL H   LP PE + R
Sbjct: 329 TRGQAMAQAIPMRVLSRLWQMLLKAIEEVSSAPNAMMAAEMALIRLTHVADLPDPETLMR 388

Query: 360 YIV 362
            ++
Sbjct: 389 KVM 391


>gi|159043203|ref|YP_001531997.1| DNA polymerase III subunits gamma and tau [Dinoroseobacter shibae
           DFL 12]
 gi|157910963|gb|ABV92396.1| DNA polymerase III [Dinoroseobacter shibae DFL 12]
          Length = 587

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/363 (50%), Positives = 244/363 (67%), Gaps = 2/363 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAH-IDVPTVEF 59
           +IGQ  M++TL NAF++ RIAQ++M++G RG GKTTTARIIA+ +N   A     PT + 
Sbjct: 24  LIGQDAMVRTLRNAFQADRIAQAFMMTGIRGTGKTTTARIIAKGMNCTGADGAGGPTTDP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVR-EIIDQIYYKPISARFRVYIMDEVQML 118
            G  ++C+ I+ G HVDV+E+D AS T IDD+R  ++D +YY P SAR++++I+DEV ML
Sbjct: 84  CGQCDNCRGIMAGQHVDVIEMDGASQTKIDDIRANVLDSVYYAPASARYKIFIIDEVHML 143

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           ST+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I    +I 
Sbjct: 144 STSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIAHLRRIA 203

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             E  E   +A+A+I RA++GS RD +SLLDQAI+    +     VR ML LADR R+MD
Sbjct: 204 GLERAEITDDALALITRAAEGSVRDAMSLLDQAISHGAGETTAEQVRAMLGLADRGRVMD 263

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +++GD    L E S+QY  G +P  +L DLAE TH V+ IK  P+ A+    S  E
Sbjct: 264 LFDLVMRGDAAGALTELSAQYSDGADPMAVLRDLAEVTHWVSVIKITPDAAEDPTVSPDE 323

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
            AR    + E+ +  L+R WQM+LK + E+      M A EM +IRL H   LPSPE++ 
Sbjct: 324 RARGQAAAAELPMRALTRMWQMLLKALEEVAISPNAMMAAEMAIIRLTHVADLPSPEDLV 383

Query: 359 RYI 361
           R +
Sbjct: 384 RKL 386


>gi|83859372|ref|ZP_00952893.1| DNA polymerase III subunits gamma and tau [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852819|gb|EAP90672.1| DNA polymerase III subunits gamma and tau [Oceanicaulis alexandrii
           HTCC2633]
          Length = 586

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/364 (50%), Positives = 247/364 (67%), Gaps = 3/364 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+PM++TLTNAF SGRIA +YM++G RG+GKTTTAR+IAR+LNY+T  +  P++   
Sbjct: 50  LIGQEPMVRTLTNAFASGRIAHAYMMTGVRGVGKTTTARLIARALNYETDEVHQPSIRLT 109

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC AI R  HVDV+E+DAAS T I D+REI+D + Y P+SAR++VYI+DEV MLST
Sbjct: 110 PPGRHCDAIARSAHVDVMEMDAASRTGISDIREILDGVRYAPVSARYKVYIIDEVHMLST 169

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R+    L +   +I ++
Sbjct: 170 SAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLKRVDRDVLTDHLARICEK 229

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAI--ARCNDKIVTSSVRLMLALADRNRIMD 238
           E+   + + +A IARA++GS RD LSLLDQAI  A     +    +R ML LADR+R++D
Sbjct: 230 ENASVECDGLAAIARAAEGSVRDALSLLDQAIVQADAGQSVTADQIRDMLGLADRSRVLD 289

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L    ++    + L E   QYD+G +P V++ DL +  H V+RIK     AD L  ++  
Sbjct: 290 LLEAALENRAKDALDELRHQYDTGADPQVLMRDLLDHLHAVSRIKAAGPSAD-LGEAQET 348

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R  + ++  S+  L R W+  L G+ ++     P+ A EM +IRL  A  LPSPE+ A
Sbjct: 349 VERLAKLAEAHSLASLGRLWKTALTGLEDVRNAPDPVSAAEMAVIRLMAAASLPSPEDAA 408

Query: 359 RYIV 362
           R + 
Sbjct: 409 RLLA 412


>gi|149203327|ref|ZP_01880297.1| DNA polymerase III subunits gamma and tau [Roseovarius sp. TM1035]
 gi|149143160|gb|EDM31199.1| DNA polymerase III subunits gamma and tau [Roseovarius sp. TM1035]
          Length = 588

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 242/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 24  LVGQDAMVRTLKNAFQADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGQGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC+AI+ G HVDV+E+DAAS T + D+REII+ + Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEHCRAIMEGRHVDVMEMDAASRTGVGDIREIIESVNYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 144 VNAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 REGAQITDDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH ++ +K  P+ A+       E 
Sbjct: 264 FDMILRGDAAGALSELSAQYAEGADPLAVLRDLAEITHWISVVKITPDAANDPTIGPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR L  +  + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PE++ R
Sbjct: 324 ARGLDMATALPMRVLTRMWQMLLKALEEVAQSPNAMMAAEMAVIRLTHVADLPTPEDLVR 383

Query: 360 YI 361
            +
Sbjct: 384 RL 385


>gi|310815375|ref|YP_003963339.1| DNA polymerase III, subunits gamma and tau [Ketogulonicigenium
           vulgare Y25]
 gi|308754110|gb|ADO42039.1| DNA polymerase III, subunits gamma and tau [Ketogulonicigenium
           vulgare Y25]
          Length = 583

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/361 (50%), Positives = 241/361 (66%), Gaps = 4/361 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF +GRIAQ+++++G RG GKTTTARIIA+ LN         PT E 
Sbjct: 22  LVGQDAMVRTLKNAFAAGRIAQAFIMTGIRGTGKTTTARIIAKGLNCIGVDGTGGPTTEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI  G HVDV+E+DAAS T ++D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 82  CGKCEHCVAITEGRHVDVLEMDAASRTGVNDIREIIDSVHYRAASARYKIYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRKIAD 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSS---VRLMLALADRNRI 236
            E+     +A+A+I RA++GSARD  SLLDQAI+      V ++   VR ML LADR R+
Sbjct: 202 AETAAITDDALALITRAAEGSARDATSLLDQAISHGAGSDVGTTADQVRGMLGLADRGRV 261

Query: 237 MDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
           +DLF  +++GD    L E S+QY  G +P  +L DLAE  H ++ IK  P+ AD      
Sbjct: 262 LDLFDMVLRGDAAGALSELSAQYADGADPMAVLRDLAEIAHWLSVIKVTPDAADDPTIPP 321

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R  + +  + +  L+R WQM+LK + E+      M A EM +IRL H   LPSP E
Sbjct: 322 DERLRGTEMAGNLPMRVLTRMWQMLLKALEEVAIAPNSMMAAEMAIIRLTHVADLPSPAE 381

Query: 357 I 357
           +
Sbjct: 382 L 382


>gi|89069708|ref|ZP_01157044.1| DNA polymerase III subunits gamma and tau [Oceanicola granulosus
           HTCC2516]
 gi|89044654|gb|EAR50765.1| DNA polymerase III subunits gamma and tau [Oceanicola granulosus
           HTCC2516]
          Length = 583

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/365 (50%), Positives = 245/365 (67%), Gaps = 1/365 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N   A     PT E 
Sbjct: 22  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCVGADGQGGPTTEP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 82  CGRCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 142 TSAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAD 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E      +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR+R++DL
Sbjct: 202 AEGAAIADDALALITRAAEGSARDATSLLDQAISHGAGETTAEQVRAMLGLADRSRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E + QY  G +P  +L DLAE  H V+ IK  PE A+    S  E 
Sbjct: 262 FDLILKGDAAGALTELAGQYADGADPMAVLRDLAEICHWVSVIKITPEAAEDPTVSPEER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R  Q ++ + +  LSR WQM+LK + E+      M A EM +IRL H   LP+PEE+ R
Sbjct: 322 DRGRQMAEALPMRVLSRMWQMLLKTLEEVASAPNAMMAAEMAVIRLTHVADLPTPEELVR 381

Query: 360 YIVEE 364
            + ++
Sbjct: 382 RLGDQ 386


>gi|260574231|ref|ZP_05842236.1| DNA polymerase III, subunits gamma and tau [Rhodobacter sp. SW2]
 gi|259023697|gb|EEW26988.1| DNA polymerase III, subunits gamma and tau [Rhodobacter sp. SW2]
          Length = 577

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/362 (49%), Positives = 240/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+ M++TL NAF + RIA +++++G RG+GKTTTARIIA+ LN         PT E 
Sbjct: 24  LIGQEAMVRTLKNAFAADRIAHAFVMTGVRGVGKTTTARIIAKGLNCIGPDGKGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G HVDV+E+DAAS T + D+RE+ID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGVCEPCRAIAEGRHVDVMEMDAASRTGVGDIREVIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            AAFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    ++    +I  
Sbjct: 144 NAAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLKRIEPEVMLTHLARIAA 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E     P+A+A+I RA++GS RD +SL+DQAIA    +   + VR ML LADR R++DL
Sbjct: 204 LEGASLAPDALALITRAAEGSVRDAMSLMDQAIAHGAGETSAAQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KGD    L E S+QY  G +P  +L DLAE TH ++ IK  PE A+       E 
Sbjct: 264 FDLVMKGDAAGALSELSAQYADGADPMAVLRDLAEITHWISVIKITPEAAEDPTTPPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R L+ +  + +  L+R WQM+LK + E+      M A EM +IRL H   LP PE + R
Sbjct: 324 LRGLEMAVRLPMRALTRMWQMLLKSLEEVALAPNAMMAAEMAVIRLTHVADLPDPETLIR 383

Query: 360 YI 361
            +
Sbjct: 384 KL 385


>gi|126725863|ref|ZP_01741705.1| DNA polymerase III subunits gamma and tau [Rhodobacterales
           bacterium HTCC2150]
 gi|126705067|gb|EBA04158.1| DNA polymerase III subunits gamma and tau [Rhodobacterales
           bacterium HTCC2150]
          Length = 596

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 241/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++L+G RG GKT+TARIIA+ LN      +  PT E 
Sbjct: 24  LVGQDAMVRTLKNAFAADRIAQAFVLTGIRGTGKTSTARIIAKGLNCIGPDGNGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI  G HVD++E+DAAS T + D+REII+ ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEHCVAISEGRHVDIMEMDAASRTGVGDIREIIESVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFN LLKTLEEPP HVKF+FATTEIRK+P+TVLSRCQRFDL RI    +I++      
Sbjct: 144 NSAFNALLKTLEEPPEHVKFVFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIKMLQGNAA 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+     +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R+MD+
Sbjct: 204 SENANITDDALALITRAAEGSARDAQSLLDQAISHGAGETTADQVRAMLGLADRGRVMDM 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH V+ IK  P+ A+       E 
Sbjct: 264 FEMIMRGDAAGALAELSAQYSDGADPLAVLRDLAEITHWVSVIKITPDAAEDPTVGPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR   ++  + +  L+R WQM+L G+ E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 324 ARGQAFAAALPMRALTRMWQMLLAGLEEVSAAPNAMMASEMAVIRLTHVSTLPSPEELVR 383

Query: 360 YI 361
            +
Sbjct: 384 SL 385


>gi|84500405|ref|ZP_00998654.1| DNA polymerase III subunits gamma and tau [Oceanicola batsensis
           HTCC2597]
 gi|84391358|gb|EAQ03690.1| DNA polymerase III subunits gamma and tau [Oceanicola batsensis
           HTCC2597]
          Length = 581

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 249/365 (68%), Gaps = 1/365 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT + 
Sbjct: 23  LVGQDAMVRTLRNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGQGGPTTDP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+TS++D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 83  CGKCEHCVAIMEGRHVDVMEMDAASNTSVNDIREIIDSVHYRAASARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  +I  
Sbjct: 143 TSAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLLREIAD 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R+MDL
Sbjct: 203 REGAEIADDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVMDL 262

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S+QY  G +P  +L DLAE TH ++ +K  P+ A+       E 
Sbjct: 263 FEMVMRGDAAAALTELSAQYADGADPLAVLRDLAEITHWISVVKITPDAAEDPTIGPEER 322

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R    +  + +  ++R WQM+LK + EI      M A EM +IRL H  +LPSPEE+ R
Sbjct: 323 SRGADLAGRLPMRAMTRMWQMLLKALEEIAAAPNAMMAAEMAVIRLTHVAELPSPEELVR 382

Query: 360 YIVEE 364
            + ++
Sbjct: 383 KLRDQ 387


>gi|163744802|ref|ZP_02152162.1| DNA polymerase III subunits gamma and tau [Oceanibulbus indolifex
           HEL-45]
 gi|161381620|gb|EDQ06029.1| DNA polymerase III subunits gamma and tau [Oceanibulbus indolifex
           HEL-45]
          Length = 583

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 245/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N      +  PT + 
Sbjct: 22  LVGQDAMVRTLKNAFAADRIAQAFVMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTDP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS+T + ++REIID ++Y+  SAR++VYI+DEV MLS
Sbjct: 82  CGVCEHCTAIMEGRHVDVMEMDAASNTGVANIREIIDSVHYRAASARYKVYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 TGAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRKIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+ E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 202 AETAEITDDALALITRAAEGSARDATSLLDQAISHGAGETGAEQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L E S QY  G +P  +L DLAE TH V+ +K  P+ A+    +  E 
Sbjct: 262 FDMVLRGDAAAALTELSGQYADGADPMAVLRDLAEITHWVSVVKITPDAAEDPTIAPEER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 322 TRGQQMAETLPMRVLTRLWQMLLKALDEVAAAPNAMMAAEMAVIRLTHVADLPSPEELVR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|259415625|ref|ZP_05739546.1| DNA polymerase III subunits gamma and tau [Silicibacter sp.
           TrichCH4B]
 gi|259348855|gb|EEW60617.1| DNA polymerase III subunits gamma and tau [Silicibacter sp.
           TrichCH4B]
          Length = 625

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 242/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 49  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTEP 108

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 109 CGKCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVAYRAASARYKIYIIDEVHMLS 168

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  +I  
Sbjct: 169 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLLRRIAT 228

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+ E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 229 NETAEIAEDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 288

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 289 MDMILRGDAAAALTELSGQYAEGADPMAVLRDLAEITHWVSVVKITPDAAEDPTISPDER 348

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    +  + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 349 ARGQDMASRLPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPSPEELVR 408

Query: 360 YI 361
            +
Sbjct: 409 KL 410


>gi|86140173|ref|ZP_01058735.1| DNA polymerase III subunits gamma and tau [Roseobacter sp. MED193]
 gi|85823110|gb|EAQ43323.1| DNA polymerase III subunits gamma and tau [Roseobacter sp. MED193]
          Length = 608

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/362 (50%), Positives = 243/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 28  LVGQDAMVRTLKNAFETNRIAQAFVMTGIRGTGKTTTARIIAKGMNCIGPDGTGQPTTEP 87

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 88  CGVCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVQYRAASARYKIYIIDEVHMLS 147

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQR+DL RI    +I L  KI  
Sbjct: 148 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRYDLRRIEPEVMIALMRKIAT 207

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GS RD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 208 AEGAEITEDALALITRAAEGSVRDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 267

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 268 MDMVLRGDAAGALTELSAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 327

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    ++ +++  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 328 ARGQHMAETLAMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPSPEELIR 387

Query: 360 YI 361
            +
Sbjct: 388 KL 389


>gi|56698372|ref|YP_168745.1| DNA polymerase III subunits gamma and tau [Ruegeria pomeroyi DSS-3]
 gi|56680109|gb|AAV96775.1| DNA polymerase III, gamma and tau subunits [Ruegeria pomeroyi
           DSS-3]
          Length = 583

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 243/358 (67%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N      +  PT E 
Sbjct: 24  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T ++D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGKCEHCVAIMEGRHVDVMEMDAASRTGVNDIREIIDSVRYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI   D+I L  +I  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEDMIALMRRIAD 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 204 AEGAQIAEDALALIVRAAEGSARDATSLLDQAISHGAGETSAEQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E  +QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 264 MDMILRGDAGAALTELGAQYAEGADPMAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           AR  Q +  +++  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+
Sbjct: 324 ARGQQMADALAMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPSPEEL 381


>gi|163740347|ref|ZP_02147741.1| DNA polymerase III subunits gamma and tau [Phaeobacter
           gallaeciensis 2.10]
 gi|161386205|gb|EDQ10580.1| DNA polymerase III subunits gamma and tau [Phaeobacter
           gallaeciensis 2.10]
          Length = 611

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/362 (50%), Positives = 245/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 35  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTEP 94

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 95  CGKCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVQYRAASARYKIYIIDEVHMLS 154

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 155 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLQKIAG 214

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+ +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 215 AENAQIAEDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 274

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD  + L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 275 IDMILRGDAASALTELSAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 334

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PE++ R
Sbjct: 335 ARGSQMAEALPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPTPEQLMR 394

Query: 360 YI 361
            +
Sbjct: 395 TL 396


>gi|99080007|ref|YP_612161.1| DNA polymerase III subunits gamma and tau [Ruegeria sp. TM1040]
 gi|99036287|gb|ABF62899.1| DNA polymerase III subunits gamma and tau [Ruegeria sp. TM1040]
          Length = 608

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 242/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 32  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTEP 91

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 92  CGKCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVAYRAASARYKIYIIDEVHMLS 151

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  +I  
Sbjct: 152 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLLRRIAT 211

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 212 SEQAEIADDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 271

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 272 MDMILRGDAAAALTELSAQYAEGADPMAVLRDLAEITHWVSVVKITPDAAEDPTISPDER 331

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    +  + +  L+R WQM+LK + E+      M A EM +IRL H   LPSPEE+ R
Sbjct: 332 ARGQDMAARLPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPSPEELLR 391

Query: 360 YI 361
            +
Sbjct: 392 KL 393


>gi|288959353|ref|YP_003449694.1| DNA polymerase III subunit gamma/tau [Azospirillum sp. B510]
 gi|288911661|dbj|BAI73150.1| DNA polymerase III subunit gamma/tau [Azospirillum sp. B510]
          Length = 636

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 251/360 (69%), Gaps = 1/360 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  +++TLTNA +SGRIAQ++ML+G RG+GKTTTARIIAR+LN      +  PTV  
Sbjct: 40  LIGQDALVRTLTNAIQSGRIAQAFMLTGVRGVGKTTTARIIARALNCTGPDGNGGPTVSP 99

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  ++C+AI    HVDV+E+DAASHT +DD+REIID + Y P+SAR+++YI+DEV MLS
Sbjct: 100 CGVCDNCRAIAEDRHVDVMEMDAASHTGVDDIREIIDGVRYSPVSARYKLYIIDEVHMLS 159

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFN LLKTLEEPP HVKF+FATTEIRK+P+TVLSRCQRFDL R+    L E FT++  
Sbjct: 160 KSAFNALLKTLEEPPSHVKFVFATTEIRKVPVTVLSRCQRFDLRRVDAQVLKEHFTRVTA 219

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  + + +A A+IARA+DGS RDGLSLLDQAIA     +    VR ML LADR R++DL
Sbjct: 220 LEGADIEGDAAALIARAADGSVRDGLSLLDQAIALAAGTVTAQQVRDMLGLADRTRVIDL 279

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F   +       +   +  +  G +P VIL DL +  H +TR+K +P+ A+     EAE 
Sbjct: 280 FEAAVSARPAEAMDILADLHRVGADPVVILQDLLDLVHNLTRLKVVPDSANDPSLPEAER 339

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    S  + +  L+R WQ++LKG++E++    P +A+EMV++RL++A  LP+P E+ R
Sbjct: 340 TRGSSLSARLGMPALTRAWQLLLKGLNEVQAAPVPQQALEMVIVRLSYAADLPTPGELIR 399


>gi|163737243|ref|ZP_02144661.1| DNA polymerase III, subunits gamma and tau [Phaeobacter
           gallaeciensis BS107]
 gi|161389847|gb|EDQ14198.1| DNA polymerase III, subunits gamma and tau [Phaeobacter
           gallaeciensis BS107]
          Length = 606

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/362 (50%), Positives = 244/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT E 
Sbjct: 29  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTEP 88

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 89  CGKCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVQYRAASARYKIYIIDEVHMLS 148

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 149 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIGLLQKIAG 208

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+ +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 209 AENAQIAEDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 268

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 269 IDMILRGDAAAALTELSAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 328

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PE++ R
Sbjct: 329 ARGSQMAEALPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPTPEQLMR 388

Query: 360 YI 361
            +
Sbjct: 389 TL 390


>gi|254474501|ref|ZP_05087887.1| DNA polymerase III, tau subunit [Ruegeria sp. R11]
 gi|214028744|gb|EEB69579.1| DNA polymerase III, tau subunit [Ruegeria sp. R11]
          Length = 607

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 244/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT + 
Sbjct: 30  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGEDGQGGPTTDP 89

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 90  CGKCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVQYRAASARYKIYIIDEVHMLS 149

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I+L  +I  
Sbjct: 150 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIDLLRRIAT 209

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 210 AEGADIAEDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 269

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+    S  E 
Sbjct: 270 MDMILRGDAAAALTELSAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVSPDER 329

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR  Q ++ + +  L+R WQM+LK + E+      M A EM +IRL H   LP+PE++ R
Sbjct: 330 ARGSQMAEALPMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRLTHVADLPTPEQLMR 389

Query: 360 YI 361
            +
Sbjct: 390 TL 391


>gi|255263195|ref|ZP_05342537.1| DNA polymerase III subunits gamma and tau [Thalassiobium sp. R2A62]
 gi|255105530|gb|EET48204.1| DNA polymerase III subunits gamma and tau [Thalassiobium sp. R2A62]
          Length = 585

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 182/358 (50%), Positives = 241/358 (67%), Gaps = 1/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF++ RIAQ+++++G RG GKTTTARIIA+ +N      +  PT + 
Sbjct: 24  LVGQDAMVRTLKNAFEADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTDP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGTCEHCTAIMEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIR++P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 144 KNAFNALLKTLEEPPAHVKFIFATTEIRQVPVTVLSRCQRFDLRRIEPEVMIALMRKIAA 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            ES E   +A+A+I RA++GSARD  SLLDQAI+          VR ML LADR R++DL
Sbjct: 204 SESAEITDDALALITRAAEGSARDATSLLDQAISHGAGATTADQVRSMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD  + L E + QY  G +P  +L DLAE TH V+ IK  PE AD    S  E 
Sbjct: 264 FDMIMRGDAHSALSEINQQYADGADPMAVLRDLAEITHWVSVIKITPEAADDPTVSPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            R  Q + E+ +  ++R WQM+LK + E+      M A EM +IRL H   LP+P ++
Sbjct: 324 TRGTQMASELPMRVMTRMWQMLLKALEEVAMAPNAMMAAEMAVIRLTHVADLPTPGDL 381


>gi|119386357|ref|YP_917412.1| DNA polymerase III subunits gamma and tau [Paracoccus denitrificans
           PD1222]
 gi|119376952|gb|ABL71716.1| DNA polymerase III, subunits gamma and tau [Paracoccus
           denitrificans PD1222]
          Length = 592

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 241/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ LN         PT E 
Sbjct: 23  LVGQDAMVRTLKNAFAADRIAQAFVMTGIRGTGKTTTARIIAKGLNCTGPDGQGGPTTEP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI  G HVDV+E+DAAS T ++D+REII+ ++Y+  SAR+++YI+DEV MLS
Sbjct: 83  CGVCEHCVAISEGRHVDVMEMDAASRTGVNDIREIIESVHYRAASARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPPPHVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  +I  
Sbjct: 143 TSAFNALLKTLEEPPPHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIALLRRIAT 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +   + VR ML LADR R++DL
Sbjct: 203 TEGAQITDDALALITRAAEGSARDATSLLDQAISHGAGETTATQVRAMLGLADRGRVLDL 262

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++G     L E  +QY  G +P  +L DLAE TH V+ +K  PE  D       E 
Sbjct: 263 FDMILRGAAAEALAELQAQYADGADPMAVLRDLAEITHWVSIVKITPEALDDPTIGPDER 322

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    +++V +  L+R WQM+LK + E+      M A EM +IRL H   LP PE + R
Sbjct: 323 ARGQAIAEKVPMRALTRLWQMLLKALDEVGQAPNAMMAAEMAIIRLTHVADLPDPETLIR 382

Query: 360 YI 361
            +
Sbjct: 383 KV 384


>gi|254464305|ref|ZP_05077716.1| DNA polymerase III, tau subunit [Rhodobacterales bacterium Y4I]
 gi|206685213|gb|EDZ45695.1| DNA polymerase III, tau subunit [Rhodobacterales bacterium Y4I]
          Length = 601

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 242/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N         PT + 
Sbjct: 32  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCVGEDGQGGPTTDP 91

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T ++D+REIID + Y+  SAR+++YI+DEV MLS
Sbjct: 92  CGKCEHCTAIMEGRHVDVMEMDAASRTGVNDIREIIDSVQYRAASARYKIYIIDEVHMLS 151

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 152 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEVMISLLRKIAT 211

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++DL
Sbjct: 212 AEGAQIADDALALITRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRVLDL 271

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +++GD    L E S+QY  G +P  +L DLAE TH V+ +K  P+ A+       E 
Sbjct: 272 MDMILRGDAAAALTELSAQYAEGADPLAVLRDLAEITHWVSVVKITPDAAEDPTVGPDER 331

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    +  +++  L+R WQM+LK + E+      M A EM +IR+ H   LPSPEE+ R
Sbjct: 332 ARGQAMADALAMRVLTRMWQMLLKALEEVAAAPNAMMAAEMAVIRITHVADLPSPEELIR 391

Query: 360 YI 361
            +
Sbjct: 392 KL 393


>gi|126463125|ref|YP_001044239.1| DNA polymerase III subunits gamma and tau [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126104789|gb|ABN77467.1| DNA polymerase III, subunits gamma and tau [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 580

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 243/367 (66%), Gaps = 1/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NAF + RIA +++++G RG+GKTTTARIIA+ LN         PT E 
Sbjct: 24  LIGQDAMVRTLKNAFAADRIAHAFVMTGVRGVGKTTTARIIAKGLNCVGPDGTGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEPCRAIAEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    ++   +++  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLKRIEPEVMMAHLSRVAG 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E  E   +A+A+I RA++GS RD +SL+DQAIA    +     VR ML LADR R++DL
Sbjct: 204 KEGAELTRDALALITRAAEGSVRDAMSLMDQAIAHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KG+    L E S QY  G +P  +L DLAE TH ++ IK  PE A+       E 
Sbjct: 264 FDLVMKGEAAAALAELSGQYADGADPMAVLRDLAEITHWISIIKISPEAAEDPTTPPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R L+ ++ + +  L+R WQM+LK I E+      M A EM +IRL H   LP PE + R
Sbjct: 324 TRGLEMAERLPMRVLTRMWQMLLKAIEEVSLAPNAMMAAEMAVIRLTHVADLPDPEALIR 383

Query: 360 YIVEEKK 366
            +  E +
Sbjct: 384 RLQSEPR 390


>gi|77464283|ref|YP_353787.1| DNA polymerase III subunits gamma and tau [Rhodobacter sphaeroides
           2.4.1]
 gi|77388701|gb|ABA79886.1| DNA polymerase III tau and gamma subunits [Rhodobacter sphaeroides
           2.4.1]
          Length = 582

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 243/367 (66%), Gaps = 1/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NAF + RIA +++++G RG+GKTTTARIIA+ LN         PT E 
Sbjct: 24  LIGQDAMVRTLKNAFAADRIAHAFVMTGVRGVGKTTTARIIAKGLNCVGPDGTGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEPCRAISEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    ++   +++  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLKRIEPEVMMAHLSRVAG 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E  E   +A+A+I RA++GS RD +SL+DQAIA    +     VR ML LADR R++DL
Sbjct: 204 KEGAELTRDALALITRAAEGSVRDAMSLMDQAIAHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KG+    L E S QY  G +P  +L DLAE TH ++ IK  PE A+       E 
Sbjct: 264 FDLVMKGEAAAALAELSGQYADGADPMAVLRDLAEITHWISIIKISPEAAEDPTTPPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R L+ ++ + +  L+R WQM+LK I E+      M A EM +IRL H   LP PE + R
Sbjct: 324 TRGLEMAERLPMRVLTRMWQMLLKAIEEVSLAPNAMMAAEMAVIRLTHVADLPDPEALIR 383

Query: 360 YIVEEKK 366
            +  E +
Sbjct: 384 RLQSEPR 390


>gi|221640167|ref|YP_002526429.1| DNA polymerase III subunits gamma and tau [Rhodobacter sphaeroides
           KD131]
 gi|221160948|gb|ACM01928.1| DNA polymerase III, subunits gamma and tau [Rhodobacter sphaeroides
           KD131]
          Length = 582

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 242/367 (65%), Gaps = 1/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NAF + RIA +++++G RG+GKTTTARIIA+ LN         PT E 
Sbjct: 24  LIGQDAMVRTLKNAFAADRIAHAFVMTGVRGVGKTTTARIIAKGLNCVGPDGTGGPTTEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 84  CGQCEPCRAISEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T+AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI    ++    ++  
Sbjct: 144 TSAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLKRIEPEVMMAHLARVAG 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E  E   +A+A+I RA++GS RD +SL+DQAIA    +     VR ML LADR R++DL
Sbjct: 204 KEGAELTRDALALITRAAEGSVRDAMSLMDQAIAHGAGETTADQVRAMLGLADRGRVLDL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++KG+    L E S QY  G +P  +L DLAE TH ++ IK  PE A+       E 
Sbjct: 264 FDLVMKGEAAAALAELSGQYADGADPMAVLRDLAEITHWISIIKISPEAAEDPTTPPDER 323

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R L+ ++ + +  L+R WQM+LK I E+      M A EM +IRL H   LP PE + R
Sbjct: 324 TRGLEMAERLPMRVLTRMWQMLLKAIEEVSLAPNAMMAAEMAVIRLTHVADLPDPEALIR 383

Query: 360 YIVEEKK 366
            +  E +
Sbjct: 384 RLQSEPR 390


>gi|302381707|ref|YP_003817530.1| DNA polymerase III subunits gamma/tau [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192335|gb|ADK99906.1| DNA polymerase III, subunits gamma and tau [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 612

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/358 (48%), Positives = 248/358 (69%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF +GRIA ++ML+G RG+GKTTTAR++AR+LN +T  ID P++E  
Sbjct: 77  LIGQEAMVRTLTNAFATGRIAHAFMLTGVRGVGKTTTARLLARALNNETDVIDRPSLELT 136

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G H  AI+ G H+DV+ELDAASHT ++D+R+I++ + Y P+ AR++VY++DEV MLS 
Sbjct: 137 AHGRHDAAIMAGQHMDVMELDAASHTGVNDIRDILESVRYAPVEARYKVYVLDEVHMLSN 196

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L+E   +I  +
Sbjct: 197 QAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPEILVEHLGRIATK 256

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSVRLMLALADRNRIMD 238
           E ++ + +A+A+IARA++GS RDGLSLLDQA+ +    + + T +VR ML LADR++ + 
Sbjct: 257 EGMKVEDDALALIARAAEGSVRDGLSLLDQALVQGERGEPVATDTVRDMLGLADRSQTIA 316

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  ++ G     L+ F + Y  G +P  + +DL E  H  +  K +   A  L   +A+
Sbjct: 317 LFEQIMAGRTPEALETFRTLYGYGADPVQVTNDLLEHCHAASVAKMLGPNATRLPNDQAQ 376

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
              A+    +VS   LSR W M+LK + E+     P +AVEM ++RLA+A  LP PEE
Sbjct: 377 RLAAM--GSQVSAGTLSRTWSMLLKALDEVRRAPSPADAVEMAIVRLAYAADLPGPEE 432


>gi|254453888|ref|ZP_05067325.1| DNA polymerase III, gamma and tau subunit [Octadecabacter
           antarcticus 238]
 gi|198268294|gb|EDY92564.1| DNA polymerase III, gamma and tau subunit [Octadecabacter
           antarcticus 238]
          Length = 586

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 187/367 (50%), Positives = 244/367 (66%), Gaps = 5/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV---PTV 57
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N     ID    PT 
Sbjct: 24  LVGQDAMVRTLKNAFAANRIAQAFIMTGIRGTGKTTTARIIAKGMN--CIGIDGQGGPTT 81

Query: 58  EFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQM 117
           E  G  E+C AI+ G HVDV+E+DAAS T + D+REII+ ++Y+  SAR++VYI+DEV M
Sbjct: 82  EPCGKCENCVAIMEGRHVDVMEMDAASRTGVGDIREIIESVHYRAASARYKVYIIDEVHM 141

Query: 118 LSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKI 177
           LS  AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI   D I L  KI
Sbjct: 142 LSVNAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEDQIGLLRKI 201

Query: 178 LQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIM 237
              E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++
Sbjct: 202 ATAEGAEITDDALALITRAAEGSARDAQSLLDQAISHGAGETSADQVRAMLGLADRGRVL 261

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DLF  ++KG   + LQE S QY  G +P  IL DLAE  H V+ IK  P+ A+    S  
Sbjct: 262 DLFDMILKGQAADALQELSGQYADGADPMAILRDLAEIAHWVSVIKITPDAAEDPTVSPD 321

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           E  R +  +  +++  L+R WQM+LK + E+      M A EM +IRL H   LPS E++
Sbjct: 322 ERTRGIAMADALAMRVLTRLWQMLLKALEEVAMAPNAMMAAEMAIIRLTHVADLPSVEDL 381

Query: 358 ARYIVEE 364
            R + +E
Sbjct: 382 VRKLDKE 388


>gi|163795453|ref|ZP_02189420.1| DNA polymerase III, gamma/tau subunits [alpha proteobacterium
           BAL199]
 gi|159179439|gb|EDP63970.1| DNA polymerase III, gamma/tau subunits [alpha proteobacterium
           BAL199]
          Length = 610

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 181/364 (49%), Positives = 248/364 (68%), Gaps = 1/364 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ+ +++TL NAF   RI  +++L+G RG+GKTTTARI+A+ LN         PT+  
Sbjct: 35  LVGQETLVRTLRNAFAQNRIHHAFVLTGVRGVGKTTTARIVAKGLNCIGPDGTGGPTMTP 94

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  ++C AI    HVDV+E+DAAS T +DD+REII+ + Y+P+SAR++VYI+DEV ML+
Sbjct: 95  CGTCDNCVAIAGDRHVDVLEMDAASRTGVDDIREIIESVRYRPVSARYKVYIVDEVHMLT 154

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RI +  L ELF K+  
Sbjct: 155 RNAFNALLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRIDVAVLSELFEKVCA 214

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E++E + EA+ MIARA+DGSARDGLS+LDQA+A     +    VR ML L DR R+ DL
Sbjct: 215 AEAVEAEAEALRMIARAADGSARDGLSILDQAMALATGPVTAVQVRDMLGLVDRERVYDL 274

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  ++ G I   L      YD G +P V++ DL E TH +TR+K  P+ +      EAE 
Sbjct: 275 FEAVMAGRISEALDVLRMLYDGGADPVVVIQDLMELTHAITRMKAAPKASGANDLGEAER 334

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R  + ++ + +  L+R WQM+ KG+ E++  + P+ A EMVLIRL +A  LP P ++ R
Sbjct: 335 DRGRKLAETLPVPALTRSWQMLSKGLGEVQNATAPVAAAEMVLIRLGYAADLPDPADLIR 394

Query: 360 YIVE 363
           ++ +
Sbjct: 395 FLTD 398


>gi|254438399|ref|ZP_05051893.1| DNA polymerase III, subunits gamma and tau, putative
           [Octadecabacter antarcticus 307]
 gi|198253845|gb|EDY78159.1| DNA polymerase III, subunits gamma and tau, putative
           [Octadecabacter antarcticus 307]
          Length = 590

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 187/367 (50%), Positives = 244/367 (66%), Gaps = 5/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV---PTV 57
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N     ID    PT 
Sbjct: 24  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMN--CIGIDGQGGPTT 81

Query: 58  EFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQM 117
           E  G  E+C AI+ G HVDV+E+DAAS T + D+REII+ ++Y+  SAR++VYI+DEV M
Sbjct: 82  EPCGTCENCAAIMEGRHVDVMEMDAASRTGVGDIREIIESVHYRAASARYKVYIIDEVHM 141

Query: 118 LSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKI 177
           LS  AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL RI   D I L  KI
Sbjct: 142 LSVNAFNALLKTLEEPPEHVKFIFATTEIRKVPVTVLSRCQRFDLRRIEPEDQIGLLRKI 201

Query: 178 LQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIM 237
            + E  E   +A+A+I RA++GSARD  SLLDQAI+    +     VR ML LADR R++
Sbjct: 202 AKAEKAEITDDALALITRAAEGSARDAQSLLDQAISHGAGETTADQVRAMLGLADRGRVL 261

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DLF  ++KG   + L E SSQY  G +P  IL DLAE  H V+ IK  P+  +    S  
Sbjct: 262 DLFDMILKGRAADALHELSSQYADGADPMAILRDLAEIAHWVSVIKITPDATEDPTVSPD 321

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           E  R +  +  +++  L+R WQM+LK + E+      M A EM +IRL H   LPS EE+
Sbjct: 322 ERTRGIAMADALAMRVLTRLWQMLLKALEEVAMAPNAMMAAEMAIIRLTHVADLPSVEEL 381

Query: 358 ARYIVEE 364
            R + +E
Sbjct: 382 LRKLDKE 388


>gi|126731114|ref|ZP_01746922.1| DNA polymerase III subunits gamma and tau [Sagittula stellata E-37]
 gi|126708416|gb|EBA07474.1| DNA polymerase III subunits gamma and tau [Sagittula stellata E-37]
          Length = 587

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 180/362 (49%), Positives = 243/362 (67%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ  M++TL NAF + RIAQ+++++G RG GKTTTARIIA+ +N      +  PT + 
Sbjct: 22  LVGQDAMVRTLKNAFAADRIAQAFIMTGIRGTGKTTTARIIAKGMNCIGPDGNGGPTTDP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REII+ ++Y+  SAR+++YI+DEV MLS
Sbjct: 82  CGKCEHCVAIMEGRHVDVMEMDAASRTGVGDIREIIESVHYRAASARYKIYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFN LLKTLEEPP HVKFIFATTEIR++P+TVLSRCQRFDL RI    +I L  KI  
Sbjct: 142 KSAFNALLKTLEEPPAHVKFIFATTEIRQVPVTVLSRCQRFDLRRIEPEIMIALLRKIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E+ E   EA+A++ RA++GSARD  SLLDQAI+    +     VR ML LADR R MDL
Sbjct: 202 SEAAEITDEALALVTRAAEGSARDATSLLDQAISHGAGETTADQVRAMLGLADRGRTMDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++GD    L+E ++QY  G +P  +L DLAE TH ++ +K  PE A+    S  E 
Sbjct: 262 FERIMRGDAAGALEELAAQYADGADPLAVLRDLAELTHWISVVKITPEAAEDPTISPDER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR   ++  +    L R WQM+LK I E+      + A EM +IRL H   LP+PE++ R
Sbjct: 322 ARGQAFADGLGQRSLGRAWQMLLKAIEEVSTAPSAIMAAEMAVIRLTHVADLPTPEDLIR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|315497912|ref|YP_004086716.1| DNA polymerase iii, subunits gamma and tau [Asticcacaulis
           excentricus CB 48]
 gi|315415924|gb|ADU12565.1| DNA polymerase III, subunits gamma and tau [Asticcacaulis
           excentricus CB 48]
          Length = 603

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 176/363 (48%), Positives = 243/363 (66%), Gaps = 4/363 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL+NAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY++  +  P+V+  
Sbjct: 56  LIGQEAMVRTLSNAFATGRIAHAFMLTGVRGVGKTTTARLLARALNYESDTMKGPSVDLS 115

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
            FG HCQAII G H+DV+ELDAAS T +D +RE+++ + Y P+ AR++VY++DEV MLST
Sbjct: 116 TFGYHCQAIIEGRHIDVLELDAASRTGVDSMRELLESVRYAPVEARYKVYVIDEVHMLST 175

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L     KI + 
Sbjct: 176 GAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPETLTPHLEKICRL 235

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSS--VRLMLALADRNRIMD 238
           E  + +P+A+A+IARA++GS RD LSLLDQA+ +  +    S+  VR ML LADR+  + 
Sbjct: 236 EGAQIEPDALALIARAAEGSVRDSLSLLDQALVQAEEGQSVSAEVVRDMLGLADRSATLS 295

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  +I G +   L  F + Y  G +PS I+ DL E+ H  +  K +   A  L    A+
Sbjct: 296 LFENIISGQMPEALLAFRTLYGFGADPSQIMGDLLEYCHAASVAKVLGSEATRLPKEPAQ 355

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
              AL    ++S   LSR W ++LK   EI     P  A EM L+R  +A  LP PE + 
Sbjct: 356 RVAAL--GAQLSAGTLSRLWTLMLKAFEEIRRAPDPAAATEMALVRFCYASDLPGPETLL 413

Query: 359 RYI 361
           + +
Sbjct: 414 KRL 416


>gi|241762403|ref|ZP_04760482.1| DNA polymerase III, subunits gamma and tau [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373090|gb|EER62739.1| DNA polymerase III, subunits gamma and tau [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 628

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 183/360 (50%), Positives = 247/360 (68%), Gaps = 6/360 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY--KTAHIDVPTVE 58
           +IGQ  M++TL NA    R+A +++L+G RG+GKT+TAR+IA++LN   K  H  + T++
Sbjct: 26  LIGQDAMVRTLGNAIARDRLAHAFLLTGVRGVGKTSTARLIAKALNCVGKDGHGGM-TID 84

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             G  E C+AI  G H+DVVE+DAASHT +DD+R+I++ + Y  +SARF+VYI+DEV ML
Sbjct: 85  PCGECEACRAIAEGRHIDVVEMDAASHTGVDDIRDIVESVRYASVSARFKVYIIDEVHML 144

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S +AFN LLKTLEEPP HVKF+FATTEI K+PITVLSRCQRFDL RIS   L + F+K++
Sbjct: 145 SKSAFNALLKTLEEPPAHVKFLFATTEINKVPITVLSRCQRFDLRRISTATLTDYFSKVV 204

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q E +E + EA+AMIA+A++GS RDGLS+LDQAIA  +  I+ + VR ML L+DR  I  
Sbjct: 205 QLEQVEAEEEALAMIAKAAEGSVRDGLSILDQAIAHSSGSILAADVREMLGLSDRGVIKS 264

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL-LYSEA 297
           L   L++G   +VL    +QYD GV P  +LH L +  H +TR K      D L L+   
Sbjct: 265 LLVDLLEGKGDHVLDHVKAQYDLGVEPEALLHGLLQLIHAITRSKM--GRPDNLTLHPTE 322

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           E     +  K++S   L R WQ++LKG SE++    P+EA EM L+R+ HA QLP P  I
Sbjct: 323 EEIWLAELGKKLSFPVLHRLWQLLLKGHSEVQNAVLPLEAAEMALLRVIHASQLPDPATI 382


>gi|260752672|ref|YP_003225565.1| DNA polymerase III subunits gamma/tau [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552035|gb|ACV74981.1| DNA polymerase III, subunits gamma and tau [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 628

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 246/359 (68%), Gaps = 4/359 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY--KTAHIDVPTVE 58
           +IGQ  M++TL NA    R+A +++L+G RG+GKT+TAR+IA++LN   K  H  + T++
Sbjct: 26  LIGQDAMVRTLGNAIARDRLAHAFLLTGVRGVGKTSTARLIAKALNCVGKDGHGGM-TID 84

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             G  E C+AI  G H+DVVE+DAASHT +DD+R+I++ + Y  +SARF+VYI+DEV ML
Sbjct: 85  PCGECEACRAIAEGRHIDVVEMDAASHTGVDDIRDIVESVRYASVSARFKVYIIDEVHML 144

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S +AFN LLKTLEEPP HVKF+FATTEI K+PITVLSRCQRFDL RIS   L + F+K++
Sbjct: 145 SKSAFNALLKTLEEPPAHVKFLFATTEINKVPITVLSRCQRFDLRRISTATLTDYFSKVV 204

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q E +E + EA+AMIA+A++GS RDGLS+LDQAIA  +  I+ + VR ML L+DR  I  
Sbjct: 205 QLEQVEAEEEALAMIAKAAEGSVRDGLSILDQAIAHSSGSILAADVREMLGLSDRGVIKS 264

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L   L++G    VL    +QYD GV P  +LH L +  H +TR K +    +  L+   E
Sbjct: 265 LLVDLLEGKGDRVLDHVKAQYDLGVEPEALLHGLLQLIHAITRSK-MGRPDNLTLHPTEE 323

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
                +  K++S   L R WQ++LKG SE++    P+EA EM L+R+ HA QLP P  I
Sbjct: 324 EIWLAELGKKLSFPVLHRLWQLLLKGHSEVQNAVLPLEAAEMALLRVIHASQLPDPATI 382


>gi|161611320|ref|YP_162596.2| DNA polymerase III subunits gamma and tau [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775348|gb|AAV89485.2| DNA polymerase III, subunits gamma and tau [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 628

 Score =  360 bits (923), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/357 (50%), Positives = 245/357 (68%), Gaps = 6/357 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY--KTAHIDVPTVE 58
           +IGQ  M++TL NA    R+A +++L+G RG+GKT+TAR+IA++LN   K  H  + T++
Sbjct: 26  LIGQDAMVRTLGNAIARDRLAHAFLLTGVRGVGKTSTARLIAKALNCVGKDGHGGM-TID 84

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             G  E C+AI  G H+DVVE+DAASHT +DD+R+I++ + Y  +SARF+VYI+DEV ML
Sbjct: 85  PCGECEACRAIAEGRHIDVVEMDAASHTGVDDIRDIVESVRYASVSARFKVYIIDEVHML 144

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S +AFN LLKTLEEPP HVKF+FATTEI K+PITVLSRCQRFDL RIS   L + F+K++
Sbjct: 145 SKSAFNALLKTLEEPPAHVKFLFATTEINKVPITVLSRCQRFDLRRISTATLTDYFSKVV 204

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           Q E +E + EA+AMIA+A++GS RDGLS+LDQAIA  +  I+ + VR ML L+DR  I  
Sbjct: 205 QLEQVEAEEEALAMIAKAAEGSVRDGLSILDQAIAHSSGSILAADVREMLGLSDRGVIKS 264

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL-LYSEA 297
           L   L++G    VL    +QYD GV P  +LH L +  H +TR K      D L L+   
Sbjct: 265 LLVDLLEGKGDRVLDHVKAQYDLGVEPEALLHGLLQLIHAITRSKM--GRPDNLTLHPTE 322

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
           E     +  K++S   L R WQ++LKG SE++    P+EA EM L+R+ HA QLP P
Sbjct: 323 EEIWLAELGKKLSFPVLHRLWQLLLKGHSEVQNAVLPLEAAEMALLRVIHASQLPDP 379


>gi|16124522|ref|NP_419086.1| DNA polymerase III subunits gamma and tau [Caulobacter crescentus
           CB15]
 gi|13421402|gb|AAK22254.1| DNA polymerase III, gamma and tau subunits [Caulobacter crescentus
           CB15]
          Length = 608

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 247/358 (68%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY+T  +  P+V+  
Sbjct: 71  LIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNYETDTVKGPSVDLT 130

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC++II G H+DV+ELDAAS T +D++RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 131 TEGYHCRSIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVYIIDEVHMLST 190

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L++ F +I  +
Sbjct: 191 AAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPDVLVKHFDRISAK 250

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DKIVTSS-VRLMLALADRNRIMD 238
           E    + +A+A+IARA++GS RDGLSLLDQAI +    + VTS+ VR ML LADR++ + 
Sbjct: 251 EGARIEMDALALIARAAEGSVRDGLSLLDQAIVQTERGQTVTSTVVRDMLGLADRSQTIA 310

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L+ +++ G   + L+ F + +  G +P+V++ D+ +  H     K +    D L   + +
Sbjct: 311 LYEHVMAGKTKDALEGFRALWGFGADPAVVMLDVLDHCHASAVSKAL--GPDALSMPKEQ 368

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            AR        S   LSR WQM+LK   E+      M A EM LIRL +A  LP PEE
Sbjct: 369 AARLAAIGAHTSAGTLSRLWQMLLKAHDEVRRAPDAMAAAEMALIRLCYAADLPGPEE 426


>gi|1293572|gb|AAB61695.1| DNA polymerase III tau homolog DnaX [Caulobacter crescentus CB15]
          Length = 608

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 247/358 (68%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY+T  +  P+V+  
Sbjct: 71  LIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNYETDTVKGPSVDLT 130

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC++II G H+DV+ELDAAS T +D++RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 131 TEGYHCRSIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVYIIDEVHMLST 190

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L++ F +I  +
Sbjct: 191 AAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPDVLVKHFDRISAK 250

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DKIVTSS-VRLMLALADRNRIMD 238
           E    + +A+A+IARA++GS RDGLSLLDQAI +    + VTS+ VR ML LADR++ + 
Sbjct: 251 EGARIEMDALALIARAAEGSVRDGLSLLDQAIVQTERGQTVTSTVVRDMLGLADRSQTIA 310

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L+ +++ G   + L+ F + +  G +P+V++ D+ +  H     K +    D L   + +
Sbjct: 311 LYEHVMAGKTKDALEGFRALWGFGADPAVVMLDVLDHCHASAVSKAL--GPDALSMPKEQ 368

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            AR        S   LSR WQM+LK   E+      M A EM LIRL +A  LP PEE
Sbjct: 369 AARLAAIGAHTSAGTLSRLWQMLLKAHDEVRRAPDAMAAAEMALIRLVYAADLPGPEE 426


>gi|84516011|ref|ZP_01003372.1| DNA polymerase III subunits gamma and tau [Loktanella vestfoldensis
           SKA53]
 gi|84510453|gb|EAQ06909.1| DNA polymerase III subunits gamma and tau [Loktanella vestfoldensis
           SKA53]
          Length = 572

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 179/362 (49%), Positives = 239/362 (66%), Gaps = 1/362 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           ++GQ  M++TL NAF + RIAQ++M++G RG GKTTTARIIA+ +N         PT + 
Sbjct: 22  LVGQDAMVRTLRNAFAADRIAQAFMMTGIRGTGKTTTARIIAKGMNCIGPDGTGGPTTDP 81

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  EHC AI+ G HVDV+E+DAAS T + D+REIID ++Y+  SAR+++YI+DEV MLS
Sbjct: 82  CGTCEHCVAIMEGRHVDVMEMDAASRTGVGDIREIIDSVHYRAASARYKIYIIDEVHMLS 141

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKFIFATTEIR++P+TVLSRCQRFDL RI     I L  KI  
Sbjct: 142 KNAFNALLKTLEEPPEHVKFIFATTEIRQVPVTVLSRCQRFDLRRIEPETQIALLRKIAT 201

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E  +   +A+A+I RA++GSARD  SLLDQAI+    +   + VR ML LADR R++DL
Sbjct: 202 AEGAQISDDALALITRAAEGSARDAQSLLDQAISHGAGETSAAQVRAMLGLADRGRVLDL 261

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
           F  +++G   + L E S QY  G +P  +L DLAE  H V+ +K  P+ A+       E 
Sbjct: 262 FDMILRGRAADALTELSGQYADGADPMAVLRDLAEVCHWVSVVKITPDAANDPTIGPDER 321

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           AR    ++ + +  LSR WQM+LK + E+      M A EM +IRL H   LPSP+++ R
Sbjct: 322 ARGQAMAEGLPMRVLSRMWQMLLKALEEVAMAPNAMMAAEMAVIRLTHVADLPSPDDLVR 381

Query: 360 YI 361
            +
Sbjct: 382 KL 383


>gi|295691235|ref|YP_003594928.1| DNA polymerase III subunits gamma and tau [Caulobacter segnis ATCC
           21756]
 gi|295433138|gb|ADG12310.1| DNA polymerase III, subunits gamma and tau [Caulobacter segnis ATCC
           21756]
          Length = 616

 Score =  359 bits (921), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 175/358 (48%), Positives = 243/358 (67%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY+T  +  P+V+  
Sbjct: 79  LIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNYETDTVKGPSVDLT 138

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC+AII G H+DV+ELDAAS T +D++RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 139 TEGYHCRAIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVYIIDEVHMLST 198

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L++ F +I  +
Sbjct: 199 AAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPDVLVKHFDRISAK 258

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSVRLMLALADRNRIMD 238
           E    + +A+A+IARA++GS RDGLSLLDQAI +      +  + VR ML LADR + + 
Sbjct: 259 EGARIEMDALALIARAAEGSVRDGLSLLDQAIVQTERGATVTATVVRDMLGLADRGQTIA 318

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L+ +++ G   + L+ F + +  G +P+V++ D+ +  H     K +    D L   + +
Sbjct: 319 LYEHVMAGKTKDALEGFRALWGFGADPAVVMLDVLDHCHASAVSKAL--GPDALSMPKEQ 376

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            AR        S   LSR WQM+LK   E+      M A EM LIRL +A  LP PEE
Sbjct: 377 AARLAAIGAHTSAGTLSRLWQMLLKAHEEVRRAPDAMAAAEMALIRLCYAADLPGPEE 434


>gi|221233207|ref|YP_002515643.1| DNA polymerase III subunits gamma and tau [Caulobacter crescentus
           NA1000]
 gi|220962379|gb|ACL93735.1| DNA polymerase III subunit gamma/tau [Caulobacter crescentus
           NA1000]
          Length = 623

 Score =  359 bits (921), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 177/358 (49%), Positives = 247/358 (68%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY+T  +  P+V+  
Sbjct: 86  LIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNYETDTVKGPSVDLT 145

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC++II G H+DV+ELDAAS T +D++RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 146 TEGYHCRSIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVYIIDEVHMLST 205

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L++ F +I  +
Sbjct: 206 AAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPDVLVKHFDRISAK 265

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DKIVTSS-VRLMLALADRNRIMD 238
           E    + +A+A+IARA++GS RDGLSLLDQAI +    + VTS+ VR ML LADR++ + 
Sbjct: 266 EGARIEMDALALIARAAEGSVRDGLSLLDQAIVQTERGQTVTSTVVRDMLGLADRSQTIA 325

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L+ +++ G   + L+ F + +  G +P+V++ D+ +  H     K +    D L   + +
Sbjct: 326 LYEHVMAGKTKDALEGFRALWGFGADPAVVMLDVLDHCHASAVSKAL--GPDALSMPKEQ 383

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            AR        S   LSR WQM+LK   E+      M A EM LIRL +A  LP PEE
Sbjct: 384 AARLAAIGAHTSAGTLSRLWQMLLKAHDEVRRAPDAMAAAEMALIRLCYAADLPGPEE 441


>gi|114568986|ref|YP_755666.1| DNA polymerase III subunits gamma and tau [Maricaulis maris MCS10]
 gi|114339448|gb|ABI64728.1| DNA polymerase III, tau subunit [Maricaulis maris MCS10]
          Length = 606

 Score =  358 bits (919), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  M++TLTNAF +GRIA +YML+G RG+GKTTTAR+IAR+LN++T  ID P++   
Sbjct: 47  LIGQDAMVRTLTNAFAAGRIAHAYMLTGVRGVGKTTTARLIARALNFQTDGIDAPSMALG 106

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC AI R  HVDV+E+DAAS T + D+REI++ + Y P+SAR++VYI+DEV MLST
Sbjct: 107 EKGRHCDAIGRSAHVDVMEMDAASRTGVGDIREILEGVRYAPVSARYKVYIIDEVHMLST 166

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP H KFIFATTEIRK+P+TVLSRCQRFDL RI    L +   +I   
Sbjct: 167 SAFNALLKTLEEPPEHAKFIFATTEIRKVPVTVLSRCQRFDLKRIDREVLTDHLDRICGL 226

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDK---IVTSSVRLMLALADRNRIM 237
           E    + + +++IARA++GS RD LSLLDQAI + +D+   +    +R ML LAD  R++
Sbjct: 227 EGASVERDGLSLIARAAEGSVRDALSLLDQAIVQGSDEDGPVSAPQIRDMLGLADHARVL 286

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DL    + G   + L E SS +D+G +P VI  DL ++ H   R+K     AD     EA
Sbjct: 287 DLLEQTLTGKTADALAELSSLHDAGGDPVVITRDLLDYVHATARVKAAGPGAD---LGEA 343

Query: 298 EN--ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
            +  AR +  ++  ++  L+R W+++L G+ ++      + A EM ++RLA A  LP PE
Sbjct: 344 ADTVARIVTLAEGQTLGQLTRMWKILLTGLDDVRNAPDALAAAEMTVLRLASAASLPPPE 403

Query: 356 EIARYIV 362
           + AR + 
Sbjct: 404 DAARLLA 410


>gi|114326925|ref|YP_744082.1| DNA polymerase III subunits gamma and tau [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315099|gb|ABI61159.1| DNA polymerase III subunit gamma/tau [Granulibacter bethesdensis
           CGDNIH1]
          Length = 686

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/365 (49%), Positives = 242/365 (66%), Gaps = 3/365 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  +++TL NAF   R+A ++ML+G RG+GKTTTARIIAR+LN   A     PT + 
Sbjct: 63  LIGQDALVRTLRNAFALNRVAHAFMLTGVRGVGKTTTARIIARALNCTGADGQGGPTADP 122

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DVVE+DAAS T +DDVREII+   ++P+ AR +V+I+DEV MLS
Sbjct: 123 CGVCPNCTAILADRHPDVVEMDAASRTGVDDVREIIEATRFRPLQARTKVFIIDEVHMLS 182

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPPHV FIFATTE+RK+P+TVLSRCQRFDL RI    L   F++IL+
Sbjct: 183 RNAFNALLKTLEEPPPHVTFIFATTELRKVPVTVLSRCQRFDLRRIDAEVLSAHFSRILE 242

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRL--MLALADRNRIM 237
           +E +   P+A+A+IARA+DGS RDGLSLLDQAIA+ +  I  S  ++  ML LADR  ++
Sbjct: 243 QEGVSASPQALALIARAADGSVRDGLSLLDQAIAQNDPGIPISEAQVADMLGLADRGMVL 302

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DL   L+ GD  + L    + +  G +  ++L DL E  H +TR+K IP +      +EA
Sbjct: 303 DLLEALMAGDTASALAVTDTAHARGADLGMVLQDLLELIHTLTRLKTIPHLRTAPGMAEA 362

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           E  R    +  +++  L R WQM+LKGI+E+E       A EMVLIRL +   LP P E+
Sbjct: 363 ERLRGSALADRLAMPVLGRAWQMLLKGIAEVEAAPDRRAAAEMVLIRLCYVADLPPPAEL 422

Query: 358 ARYIV 362
            R + 
Sbjct: 423 VRRLT 427


>gi|167648530|ref|YP_001686193.1| DNA polymerase III subunits gamma and tau [Caulobacter sp. K31]
 gi|167350960|gb|ABZ73695.1| DNA polymerase III, subunits gamma and tau [Caulobacter sp. K31]
          Length = 632

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 242/358 (67%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TL NAF SGRIA ++ML+G RG+GKTTTAR++AR+LNY+T  +  P+V+  
Sbjct: 98  LIGQEAMVRTLANAFSSGRIAHAFMLTGVRGVGKTTTARLLARALNYETDTVHQPSVDLT 157

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC+AII G H+DV+ELDAAS T +D++RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 158 IDGRHCKAIIEGRHMDVLELDAASRTKVDEMRELLDGVRYAPVEARYKVYIIDEVHMLST 217

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSR QRFDL R+    L++ F +I  +
Sbjct: 218 AAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRTQRFDLRRVEPDVLVKHFARIAAK 277

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSVRLMLALADRNRIMD 238
           E  + + + +A+IARA++GS RDGLSLLDQAI +      +  + VR ML LADR + + 
Sbjct: 278 EGAKVEEDGLALIARAAEGSVRDGLSLLDQAIVQGERGSTVTAAVVRDMLGLADRGQTIA 337

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  ++ G   + L  F + +  G +P+V++ DL +  H  +  K +    D L   + +
Sbjct: 338 LFENVMSGKPGDSLAGFRALWGFGADPAVVMLDLLDHCHGASVAKAL--GPDALTLPKEQ 395

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            AR      + S   LSR WQM+LK   E+      M A EM LIRL +A  LP PEE
Sbjct: 396 AARLTAIGAQTSAGTLSRLWQMLLKAHEEVRRAPDAMAAAEMALIRLCYAADLPGPEE 453


>gi|254421036|ref|ZP_05034760.1| DNA polymerase III, subunits gamma and tau, putative [Brevundimonas
           sp. BAL3]
 gi|196187213|gb|EDX82189.1| DNA polymerase III, subunits gamma and tau, putative [Brevundimonas
           sp. BAL3]
          Length = 623

 Score =  356 bits (914), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 245/358 (68%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ M++TLTNAF +GRIA ++ML+G RG+GKTTTAR++AR+LN +T  ID P++   
Sbjct: 87  LIGQEAMVRTLTNAFSTGRIAHAFMLTGVRGVGKTTTARLLARALNNETESIDRPSLTLT 146

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G H  AI+ G H+DV+E+DAASHT ++D+R+I++ + Y P+ AR++VY++DEV MLST
Sbjct: 147 AHGRHDAAIMAGQHMDVMEMDAASHTGVNDIRDILESVRYAPVEARYKVYVLDEVHMLST 206

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    LI    +I + 
Sbjct: 207 QAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPEILIGHLGRIAER 266

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAI--ARCNDKIVTSSVRLMLALADRNRIMD 238
           E ++ + +A+A+I+RA++GS RDGLSLLDQA+  A   + + T +VR ML LADR++ + 
Sbjct: 267 EGMKIEQDALALISRAAEGSVRDGLSLLDQALVQAERGEMVKTETVRDMLGLADRSQTIA 326

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  ++ G     L+ F + Y  G +P  + +DL E  H  +  K +   A  L   +A+
Sbjct: 327 LFESVMAGRTPEALENFRTLYGFGADPVQVTNDLLEHCHAASVAKMLGPNATRLPNDQAQ 386

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
             +       +    LSR WQM+LK + E+     P +AVEM ++RLA+A  LP PEE
Sbjct: 387 --KLAALGAAIPAATLSRTWQMLLKALDEVRRAPNPADAVEMAIVRLAYAADLPGPEE 442


>gi|312114329|ref|YP_004011925.1| DNA polymerase III subunits gamma and tau [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311219458|gb|ADP70826.1| DNA polymerase III, subunits gamma and tau [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 574

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 178/358 (49%), Positives = 250/358 (69%), Gaps = 2/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHI-DVPTVEF 59
           +IGQ  +++TL NAF   RIAQ+YML+G RG+GKTTTARI+AR+LNY+   + D P+++ 
Sbjct: 37  LIGQDILVRTLRNAFAMDRIAQAYMLTGVRGVGKTTTARILARALNYERDGLPDRPSLDI 96

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
              G HCQAI+   HVDV+E+DAAS+T IDD+REII+ + YKP +AR+RV+I+DEV MLS
Sbjct: 97  AELGRHCQAIMDSRHVDVLEMDAASNTGIDDIREIIEAVRYKPAAARYRVFIIDEVHMLS 156

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFNGLLKTLEEPPPHVKFIFATTEIRK+P+T+LSRCQRFDL R+    L   F +IL+
Sbjct: 157 KSAFNGLLKTLEEPPPHVKFIFATTEIRKVPVTILSRCQRFDLRRVEPEVLSAHFARILE 216

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E    D  A+A+IARA++GS RDGLSLLDQA+     ++  +SV  ML L+ R+ I DL
Sbjct: 217 KEGYAADDSALALIARAAEGSVRDGLSLLDQALTMAEGRLTAASVLDMLGLSGRDAIFDL 276

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +  GD    L    +  + G +P++I+ D+A+  H ++R+K +P      L ++ + 
Sbjct: 277 LERIFDGDAAGALTALGALNERGADPTLIISDVADAVHALSRLKVLPGAYPHDLSAD-DR 335

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           ARA + +  + +  L+  WQM+LKGI E     RP+ A EM++ R+ +  QLPSP ++
Sbjct: 336 ARADRLAASLPVPRLAMAWQMLLKGIDEAARAPRPLAAAEMLVFRMCYTAQLPSPADV 393


>gi|6466222|gb|AAF12838.1|AF203881_11 DNA polymerase III subunits tau and gamma [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 597

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 179/351 (50%), Positives = 241/351 (68%), Gaps = 6/351 (1%)

Query: 7   MIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY--KTAHIDVPTVEFEGFGE 64
           M++TL NA    R+A +++L+G RG+GKT+TAR+IA++LN   K  H  + T++  G  E
Sbjct: 1   MVRTLGNAIARDRLAHAFLLTGVRGVGKTSTARLIAKALNCVGKDGHGGM-TIDPCGECE 59

Query: 65  HCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFN 124
            C+AI  G H+DVVE+DAASHT +DD+R+I++ + Y  +SARF+VYI+DEV MLS +AFN
Sbjct: 60  ACRAIAEGRHIDVVEMDAASHTGVDDIRDIVESVRYASVSARFKVYIIDEVHMLSKSAFN 119

Query: 125 GLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIE 184
            LLKTLEEPP HVKF+FATTEI K+PITVLSRCQRFDL RIS   L + F+K++Q E +E
Sbjct: 120 ALLKTLEEPPAHVKFLFATTEINKVPITVLSRCQRFDLRRISTATLTDYFSKVVQLEQVE 179

Query: 185 FDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLI 244
            + EA+AMIA+A++GS RDGLS+LDQAIA  +  I+ + VR ML L+DR  I  L   L+
Sbjct: 180 AEEEALAMIAKAAEGSVRDGLSILDQAIAHSSGSILAADVREMLGLSDRGVIKSLLVDLL 239

Query: 245 KGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL-LYSEAENARAL 303
           +G    VL    +QYD GV P  +LH L +  H +TR K      D L L+   E     
Sbjct: 240 EGKGDRVLDHVKAQYDLGVEPEALLHGLLQLIHAITRSKM--GRPDNLTLHPTEEEIWLA 297

Query: 304 QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
           +  K++S   L R WQ++LKG SE++    P+EA EM L+R+ HA QLP P
Sbjct: 298 ELGKKLSFPVLHRLWQLLLKGHSEVQNAVLPLEAAEMALLRVIHASQLPDP 348


>gi|326404392|ref|YP_004284474.1| DNA polymerase III gamma/tau subunit [Acidiphilium multivorum
           AIU301]
 gi|325051254|dbj|BAJ81592.1| DNA polymerase III gamma/tau subunit [Acidiphilium multivorum
           AIU301]
          Length = 614

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 175/367 (47%), Positives = 243/367 (66%), Gaps = 3/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  +++TL NAF   RIA ++ML+G RG+GKTTTARI+AR+LN   A     PT + 
Sbjct: 58  LIGQDGLVRTLRNAFAMNRIAHAFMLTGVRGVGKTTTARILARALNCTGADGQGGPTPDP 117

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  ++C AI+   H DVVE+DAAS+T +DDVREII+   ++P+ AR +V+I+DEV MLS
Sbjct: 118 CGVCDNCVAILADRHPDVVEMDAASNTGVDDVREIIEATRFRPMIARTKVFIVDEVHMLS 177

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPPHVKF+FATTEIRK+PITVLSRCQRFDL R+ +  L   F +I +
Sbjct: 178 RNAFNALLKTLEEPPPHVKFVFATTEIRKVPITVLSRCQRFDLKRVPVDVLAAHFARIAE 237

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND--KIVTSSVRLMLALADRNRIM 237
           +E++  +  A+  +ARA+DGS RDGLSLLDQAIAR ++   +    V  ML LADR  + 
Sbjct: 238 KEAVAVEGGALDAVARAADGSVRDGLSLLDQAIARADEGAPVTAELVADMLGLADRGMVF 297

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DL   +  GD    L      +++G +P +++ DL    H ++R+K IP +A+     E 
Sbjct: 298 DLLEAVAAGDPAGALGVMDRAHEAGADPVLVMQDLLGLAHTLSRLKAIPALAEGSELPEL 357

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           + AR    +  +S+ FL R WQM+LKG++E+E  +    A +M+LIRL +   LP P E+
Sbjct: 358 DRARGAPLAARLSVPFLGRLWQMLLKGVAEVEQATDRRAAADMILIRLCYVSDLPPPGEL 417

Query: 358 ARYIVEE 364
            R +  E
Sbjct: 418 VRRLSGE 424


>gi|148260992|ref|YP_001235119.1| DNA polymerase III subunits gamma and tau [Acidiphilium cryptum
           JF-5]
 gi|146402673|gb|ABQ31200.1| DNA polymerase III, subunits gamma and tau [Acidiphilium cryptum
           JF-5]
          Length = 614

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 175/367 (47%), Positives = 243/367 (66%), Gaps = 3/367 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  +++TL NAF   RIA ++ML+G RG+GKTTTARI+AR+LN   A     PT + 
Sbjct: 58  LIGQDGLVRTLRNAFAMNRIAHAFMLTGVRGVGKTTTARILARALNCTGADGQGGPTPDP 117

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  ++C AI+   H DVVE+DAAS+T +DDVREII+   ++P+ AR +V+I+DEV MLS
Sbjct: 118 CGVCDNCVAILADRHPDVVEMDAASNTGVDDVREIIEATRFRPMIARTKVFIVDEVHMLS 177

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPPHVKF+FATTEIRK+PITVLSRCQRFDL R+ +  L   F +I +
Sbjct: 178 RNAFNALLKTLEEPPPHVKFVFATTEIRKVPITVLSRCQRFDLKRVPVDVLAAHFARIAE 237

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND--KIVTSSVRLMLALADRNRIM 237
           +E++  +  A+  +ARA+DGS RDGLSLLDQAIAR ++   +    V  ML LADR  + 
Sbjct: 238 KEAVAVEGGALDAVARAADGSVRDGLSLLDQAIARADEGAPVTAELVADMLGLADRGMVF 297

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           DL   +  GD    L      +++G +P +++ DL    H ++R+K IP +A+     E 
Sbjct: 298 DLLEAVAAGDPAGALGVMDRAHEAGADPVLVMQDLLGLAHTLSRLKAIPALAEGSELPEL 357

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
           + AR    +  +S+ FL R WQM+LKG++E+E  +    A +M+LIRL +   LP P E+
Sbjct: 358 DRARGAPLAARLSVPFLGRLWQMLLKGVAEVEQATDRRAAADMILIRLCYVSDLPPPGEL 417

Query: 358 ARYIVEE 364
            R +  E
Sbjct: 418 VRRLSGE 424


>gi|197103834|ref|YP_002129211.1| DNA polymerase III subunits gamma and tau [Phenylobacterium
           zucineum HLK1]
 gi|196477254|gb|ACG76782.1| DNA polymerase III subunits gamma and tau [Phenylobacterium
           zucineum HLK1]
          Length = 605

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 172/358 (48%), Positives = 239/358 (66%), Gaps = 4/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ M++TL NAF SGRIA ++ML+G RG+GKTTTAR++AR+LNY+TA +  PT++ +
Sbjct: 58  LYGQEAMVRTLRNAFASGRIAHAFMLTGVRGVGKTTTARLLARALNYETATVHEPTLDLK 117

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC+AII G H+DV+ELDAAS T ++D+RE++D + Y P+ AR++VYI+DEV MLST
Sbjct: 118 EEGLHCRAIIEGRHMDVLELDAASRTGVNDIRELLDGVRYAPVEARYKVYIIDEVHMLST 177

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSR QRFDL R+    L++    I + 
Sbjct: 178 GAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRTQRFDLRRVEPEMLVKNLEMICEN 237

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAI--ARCNDKIVTSSVRLMLALADRNRIMD 238
           E    + E + +IARA++GS RDG S+LDQAI  A     +  +++R ML LADR + + 
Sbjct: 238 EGARVEAEGLMLIARAAEGSVRDGQSMLDQAIVQAEPGQTVTAATIRDMLGLADRAQTIG 297

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  L++G     ++ F + Y  G NP  ++ DL +  H  +  K I   A  +   +A+
Sbjct: 298 LFEQLMRGQAGEAIETFRTLYGYGANPDQVMLDLLDHVHGASVAKAIGPQALVMPKEQAQ 357

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
              A+  +  VS   LSR WQ+ LK   E+        AV+M LIR+A+A  LP PEE
Sbjct: 358 RLAAIGAA--VSAGVLSRLWQLTLKAYEEVRRAPDAAAAVDMALIRMAYAADLPGPEE 413


>gi|89056367|ref|YP_511818.1| DNA polymerase III subunits gamma and tau [Jannaschia sp. CCS1]
 gi|88865916|gb|ABD56793.1| DNA polymerase III subunits gamma and tau [Jannaschia sp. CCS1]
          Length = 584

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/368 (48%), Positives = 245/368 (66%), Gaps = 2/368 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ+ M++TL NAF + RIAQ++ML+G RG GKTTTARIIA+ LN   A  +  PT + 
Sbjct: 24  LIGQEAMVRTLKNAFDADRIAQAFMLTGIRGTGKTTTARIIAKGLNCIGADGEGGPTTDP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVRE-IIDQIYYKPISARFRVYIMDEVQML 118
            G  ++C AI  G HVDV+E+DAAS+T + ++R+ II+ + Y+   AR++++I+DEV ML
Sbjct: 84  CGVCQNCVAITEGRHVDVMEMDAASNTGVQNIRDAIIETVSYRAAQARYKIFIIDEVHML 143

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           ST+AFN LLKTLEEPP HVKF+FATTEIRK+P+TVLSRCQRFDL RI    +I    +I 
Sbjct: 144 STSAFNALLKTLEEPPAHVKFLFATTEIRKVPVTVLSRCQRFDLRRIEPEVMIAHLQRIA 203

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
             ES E   +AVA+I RA++GS RD +SLLDQAIA    +     VR ML LADR R+MD
Sbjct: 204 GLESAEIAEDAVALITRAAEGSVRDAMSLLDQAIAHGAGETTADQVRAMLGLADRGRVMD 263

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  ++ G+    L E S+QY  G +P  +L DLAE TH ++ I   P+ A+    S  E
Sbjct: 264 LFEAIMAGEAATALDELSAQYADGADPVAVLRDLAEITHWLSVISITPDAAEDPTISPDE 323

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             R L  ++++ +  L+R WQM+LK + E+      M A EM +IRL H   LP+P ++ 
Sbjct: 324 RTRGLVLAEKLPMRVLTRMWQMLLKALEEVAMAPNAMMAAEMAVIRLTHVADLPTPGDLV 383

Query: 359 RYIVEEKK 366
           + + E  +
Sbjct: 384 KKLAETPR 391


>gi|332185894|ref|ZP_08387641.1| DNA polymerase III, subunits gamma and tau [Sphingomonas sp. S17]
 gi|332014252|gb|EGI56310.1| DNA polymerase III, subunits gamma and tau [Sphingomonas sp. S17]
          Length = 559

 Score =  349 bits (895), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 239/367 (65%), Gaps = 10/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NA K  R+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 34  LIGQDAMVQTLGNAIKRDRLAHAFLMTGVRGVGKTSTARLIAKALNCVGPDGTGGPTIQP 93

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DV+E+DAASHT +DDVREII+   Y  +SARF++YI+DEV MLS
Sbjct: 94  CGQCEPCRAIAEGRHIDVIEMDAASHTGVDDVREIIEASRYAAVSARFKIYIVDEVHMLS 153

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+PITVLSRCQRFDL RI+   L   F  I  
Sbjct: 154 KNAFNALLKTLEEPPAHVKFLFATTEVNKVPITVLSRCQRFDLRRITADKLAAHFADICV 213

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN---DKIVTSSVRLMLALADRNRI 236
           +E +  + EA+ ++ARA++GSARDGLS+LDQAIA  +     +  S+VR ML L+DR  +
Sbjct: 214 KEGVTAEDEALMLVARAAEGSARDGLSILDQAIAHADLEGGGVTASAVREMLGLSDRGAV 273

Query: 237 MDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTH--LVTRIKYIPEMADTLLY 294
            DL G ++ GD    L     QYD GV+P  +L  L E  H   +T++   P+ A  L  
Sbjct: 274 RDLLGLVLNGDGAGALASLRRQYDYGVDPQSVLRSLLETVHGITLTKVGTPPDAAQPL-- 331

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
              E A   +++  +S   L R WQ+ LKG  E+   + P+EA EM L+R  HA  LP P
Sbjct: 332 --EERAAREEWAGSLSFPALHRLWQLFLKGHDEVARAALPIEAAEMALLRAIHASTLPDP 389

Query: 355 EEIARYI 361
            E+AR I
Sbjct: 390 GELARQI 396


>gi|114798398|ref|YP_759102.1| DNA polymerase III subunits gamma and tau [Hyphomonas neptunium
           ATCC 15444]
 gi|114738572|gb|ABI76697.1| DNA polymerase III, subunits gamma and tau [Hyphomonas neptunium
           ATCC 15444]
          Length = 578

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 242/377 (64%), Gaps = 13/377 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV------ 54
           +IGQ+ M++TL+NAF++GRIA  +ML+G RG+GKTTTAR++AR LNY+            
Sbjct: 44  LIGQEAMVRTLSNAFETGRIAHGFMLTGVRGVGKTTTARLLARGLNYEPKADAKGKKGKA 103

Query: 55  --PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIM 112
             P++  +  GEHC AI+   H DV+ELDAAS T + D+R+++D   Y P+SAR++VYI+
Sbjct: 104 AGPSIHLDPPGEHCDAIMASRHPDVLELDAASRTGVADMRDLLDSARYGPVSARYKVYII 163

Query: 113 DEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIE 172
           DEV MLS A+FN LLKTLEEPPPH+KFIFATTEIRK+P+TVLSRCQRFDL R+  G+L  
Sbjct: 164 DEVHMLSNASFNALLKTLEEPPPHLKFIFATTEIRKVPVTVLSRCQRFDLKRLDSGELSR 223

Query: 173 LFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND--KIVTSSVRLMLAL 230
               + Q E      EA+A+IARA++GS RDGLSLLDQ I +  D  ++  ++VR ML L
Sbjct: 224 HLGNVAQSEGANVSEEALALIARAAEGSVRDGLSLLDQGIVQTTDGEEVSGAAVRAMLGL 283

Query: 231 ADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMAD 290
            DR R++D     + GD    L E   Q   G +P+VIL D+ +    ++  +   +  D
Sbjct: 284 GDRARLLDAVEKAVGGDAKGALAEVREQVAGGADPAVILKDILDIAADISVAQATGD--D 341

Query: 291 TLLYSEAENA-RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAV 349
                 A+ A R    ++ ++    +R WQ++L G  +++    P  A+ MV++RLA A 
Sbjct: 342 WTQAGPADWANRTRALAQRLTPAQAARNWQLLLSGYGDLQVAPDPATALNMVILRLAAAS 401

Query: 350 QLPSPEEIARYIVEEKK 366
            LPSPEE AR I E  +
Sbjct: 402 TLPSPEEAARMIAEGSR 418


>gi|329849471|ref|ZP_08264317.1| DNA polymerase III, subunits gamma and tau [Asticcacaulis
           biprosthecum C19]
 gi|328841382|gb|EGF90952.1| DNA polymerase III, subunits gamma and tau [Asticcacaulis
           biprosthecum C19]
          Length = 602

 Score =  345 bits (884), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 172/363 (47%), Positives = 235/363 (64%), Gaps = 10/363 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV------ 54
           +IGQ+ M++TLTNAF +GRIA ++ML+G RG+GKTTTAR++AR+LNY++  +        
Sbjct: 57  LIGQEAMVRTLTNAFSAGRIAHAFMLTGVRGVGKTTTARLLARALNYESDTVQSSGGRGG 116

Query: 55  PTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDE 114
           P+V+    G HCQAII G H+DV+ELDAAS T +D +R++++ + Y P+ AR++VY++DE
Sbjct: 117 PSVDLTTMGIHCQAIIDGRHIDVLELDAASRTGVDAMRDLLESVRYAPVEARYKVYVIDE 176

Query: 115 VQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELF 174
           V MLST AFN LLKTLEEPPPH KFIFATTEIRK+P+T+LSRCQRFDL R+    L    
Sbjct: 177 VHMLSTGAFNALLKTLEEPPPHAKFIFATTEIRKVPVTILSRCQRFDLRRVEPETLTPHL 236

Query: 175 TKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAI--ARCNDKIVTSSVRLMLALAD 232
            KI   E +  D +AVA+IARA++GS RD LSLLDQA+      + +    VR ML LAD
Sbjct: 237 EKICGLEGVRIDADAVALIARAAEGSVRDSLSLLDQALVQGEAGEIVGAEVVRDMLGLAD 296

Query: 233 RNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL 292
           R+  + LF  +I G +   L  F + Y  G +P+ I+ DL E+ H  +  K +   AD  
Sbjct: 297 RSATLALFENIISGQMSEALLGFRTLYGYGADPTQIMGDLLEYCHGTSVAKIL--GADAT 354

Query: 293 LYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
              +A+  R      ++S   LSR W ++LK   E+        A EM L+RL +A  LP
Sbjct: 355 RMPKAQAMRVTALGAQLSAGTLSRLWTLMLKAFEELRRAPDAPAAFEMALVRLCYAADLP 414

Query: 353 SPE 355
            PE
Sbjct: 415 GPE 417


>gi|94497479|ref|ZP_01304049.1| DNA polymerase III, subunits gamma and tau [Sphingomonas sp. SKA58]
 gi|94423110|gb|EAT08141.1| DNA polymerase III, subunits gamma and tau [Sphingomonas sp. SKA58]
          Length = 538

 Score =  342 bits (878), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/369 (46%), Positives = 246/369 (66%), Gaps = 7/369 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NA + GR+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 23  LIGQDAMVQTLGNAIRRGRLAHAFLMTGVRGVGKTSTARLIAKALNCVGPDGQGGPTIDP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DVVE+DAASHT +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 83  CGQCEPCKAIAEGRHIDVVEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSRCQRFDL RI    L   FT +++
Sbjct: 143 KNAFNALLKTLEEPPAHVKFLFATTEVNKVPVTVLSRCQRFDLRRIPAELLATHFTHVVE 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC----NDKIVTSS-VRLMLALADRN 234
            ES+  +PEA+A+IA+A++GSARDGLS+LDQAIA         +VT++ VR ML L+DR 
Sbjct: 203 AESVAAEPEALALIAQAAEGSARDGLSILDQAIAHAEMDDGPSLVTAAQVREMLGLSDRG 262

Query: 235 RIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
            +  L   L++G+  +++     QY  GV P  ++  L E  H VT +K   ++A     
Sbjct: 263 SVRRLLALLLEGETASLIAAVREQYALGVEPLALMRGLMELVHAVTLMKAGRDIASPGQP 322

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
           +E E      ++ ++    L R WQ++LKG  E+     P+E+ EM L+R+ HA  +P P
Sbjct: 323 AE-EREMLADWAAQLGFAPLHRLWQLLLKGHDEVANAVLPIESCEMALLRVMHAATMPDP 381

Query: 355 EEIARYIVE 363
            E+AR + E
Sbjct: 382 AEVARLLRE 390


>gi|304320347|ref|YP_003853990.1| DNA polymerase III subunits gamma and tau [Parvularcula bermudensis
           HTCC2503]
 gi|303299249|gb|ADM08848.1| DNA polymerase III subunits gamma and tau [Parvularcula bermudensis
           HTCC2503]
          Length = 607

 Score =  342 bits (877), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 232/358 (64%), Gaps = 2/358 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++G + M++TL NAF + RIA +++L+G RG+GKTTTARIIAR+LNY+T  ID PTV+  
Sbjct: 29  LLGHEAMVRTLRNAFAADRIAHAFILTGVRGVGKTTTARIIARALNYETETIDRPTVDMP 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HC+AI    H DV E+DAAS T + D+RE+I+ + Y PI  R++VYI+DEV MLST
Sbjct: 89  VEGRHCRAIAESRHPDVYEMDAASRTGVGDIRELIEGVRYAPIEGRYKVYIIDEVHMLST 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFIFATTEIRK+P+TVLSRCQRFDL R  I  L      I ++
Sbjct: 149 NAFNALLKTLEEPPAHVKFIFATTEIRKVPVTVLSRCQRFDLRRFDITSLSAHLAGIAEK 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQA-IARCNDKIVTSSVRLMLALADRNRIMDL 239
           E      EA+ MIA+A++GS RD LSLLDQA + +  + I  + +R ML L DR +  DL
Sbjct: 209 EEAAISKEALDMIAQAAEGSVRDALSLLDQALVQKAGEAIGAADIRDMLGLVDRTQTWDL 268

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTR-IKYIPEMADTLLYSEAE 298
            G  + GD    L+ F  QYD G +   ++ DL   THL+TR +    E A      EA+
Sbjct: 269 LGAAMAGDAKTALRLFREQYDGGADAGQVMRDLLSLTHLLTRTLVAGDEAAAHGQAGEAD 328

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
             RA   +  V +  L+R W +++K + E++       A E+ LIR+A+A   P+PEE
Sbjct: 329 TERAQAMAHGVPLPALTRSWSLLMKALEEVQNAPDAAAAAEIGLIRVAYAAGQPTPEE 386


>gi|254293230|ref|YP_003059253.1| DNA polymerase III subunits gamma and tau [Hirschia baltica ATCC
           49814]
 gi|254041761|gb|ACT58556.1| DNA polymerase III, subunits gamma and tau [Hirschia baltica ATCC
           49814]
          Length = 619

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 171/365 (46%), Positives = 248/365 (67%), Gaps = 8/365 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ M++TLTNAFK+GRIA ++ML+G RG+GKTTTAR++AR+LNY    ++ P+V+  
Sbjct: 52  MVGQEAMVRTLTNAFKTGRIAHAFMLTGVRGVGKTTTARLLARALNYSRDGVEEPSVQLS 111

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             G HCQAI+   H DV+ELDAAS T + D+RE++D + Y P++AR++VYI+DEV MLST
Sbjct: 112 PVGRHCQAIMESRHPDVLELDAASRTGVADMRELLDGVRYSPVNARYKVYIIDEVHMLST 171

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPHVKFIFATTEIRK+P+TVLSRCQRF+L R++   L     +I ++
Sbjct: 172 AAFNALLKTLEEPPPHVKFIFATTEIRKVPVTVLSRCQRFNLARLTTDALAAHLGRICEK 231

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC-NDKIVTSSVRLMLALADRNRIMDL 239
           E  +   E +A+I+RA++GSARD LS+LDQAI +   D++   +VR ML LADR R+ DL
Sbjct: 232 EGAKVSEEGLALISRAAEGSARDALSVLDQAIVQSTGDEVSVDAVRDMLGLADRARVFDL 291

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE---MADTLLYSE 296
               I G+    L+E ++Q   G    +++ DL +    + R + + E    A  + +++
Sbjct: 292 LDAAIAGEHKVALEETNAQLQEGAEAQILMKDLLDAMAEIARAQAMGESYVFAGPVEWTQ 351

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
               R  + +  +S    +R+W+++L+G  +      P  A EM ++RLA A  LPSPE+
Sbjct: 352 ----RTKKLASSISNAQSARYWKLLLQGYEDCARAPDPNVAAEMAVLRLAAAAALPSPED 407

Query: 357 IARYI 361
            AR +
Sbjct: 408 AARML 412


>gi|329114766|ref|ZP_08243523.1| DNA polymerase III subunit Tau [Acetobacter pomorum DM001]
 gi|326695897|gb|EGE47581.1| DNA polymerase III subunit Tau [Acetobacter pomorum DM001]
          Length = 712

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 242/368 (65%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+ M++TL NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 112 LIGQEAMVRTLRNAFALGRVAHAFMLTGVRGVGKTTTARIIARALNCIGPDGKGGPTADP 171

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREIID   ++P+  R +V+I+DEV MLS
Sbjct: 172 CGVCANCVAILNDRHPDVLEMDAASRTGVDDVREIIDATRFRPMQGRMKVFIIDEVHMLS 231

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP  V FIFATTE+RK+P+TVLSRCQRFDL R+   +L+ LF++I  
Sbjct: 232 RNAFNALLKTLEEPPAQVTFIFATTELRKVPVTVLSRCQRFDLRRVPQSELVGLFSRIAD 291

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-----DKIVTSSV-RLMLALADR 233
           +E +   P+A+A++ARA+DGS RDGLSLLDQAIA+       D ++ ++V   ML LADR
Sbjct: 292 KEHVRLSPDALALVARAADGSVRDGLSLLDQAIAQGTGQTDADGVIGATVISDMLGLADR 351

Query: 234 NRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLL 293
             + DL   ++ G     L    + Y  G +P ++L D+ E  H V+R++ +P + D+  
Sbjct: 352 EVVFDLLEAVLTGKPEQALALLDAAYARGADPGLVLGDMLELVHTVSRLRAVPSLRDSAD 411

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
             EAE  R    +   ++  L R WQM++KG+ E+E  S    A +MVLIRL +   LPS
Sbjct: 412 MPEAERVRGTHMADTFTVPVLMRAWQMLVKGMQEVEAASDRRAAADMVLIRLCYVADLPS 471

Query: 354 PEEIARYI 361
           PE++ + +
Sbjct: 472 PEDLIKRL 479


>gi|162149236|ref|YP_001603697.1| DNA polymerase III subunits gamma and tau [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787813|emb|CAP57411.1| putative DNA polymerase III tau subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 629

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 231/368 (62%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ   ++ L NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 14  LIGQDSTVRILRNAFALGRVAHAFMLTGVRGVGKTTTARIIARALNCVGPDGTGGPTADP 73

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREII+   ++P+  R +V+I+DEV MLS
Sbjct: 74  CGVCANCVAILADRHPDVLEMDAASRTGVDDVREIIEATRFRPMQGRMKVFIIDEVHMLS 133

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP  V F+FATTE+RK+P+TVLSRCQRFDL R+   DL   F +I +
Sbjct: 134 RNAFNALLKTLEEPPAQVTFVFATTELRKVPVTVLSRCQRFDLRRVPQSDLAAHFGRIAR 193

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN------DKIVTSSVRLMLALADR 233
            E  E  P+A+A+IARA+DGS RDGLSLLDQAIA+ +        I    V  ML LADR
Sbjct: 194 AEGAECTPDALALIARAADGSVRDGLSLLDQAIAQGSVEGDGAAPIGAERVADMLGLADR 253

Query: 234 NRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLL 293
            R+ DL   ++ G     L      +  G +  V+L D+ E  H V+R+K +P +  +  
Sbjct: 254 GRVFDLLEAVLAGQPDRALAITDEAHARGADLGVMLGDVLELVHTVSRLKAVPALRQSAD 313

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
             EAE  R    +  +S+  L R WQM+LKG+SE+E      EA EM+LIRL +   LP 
Sbjct: 314 LPEAERERGGALADRLSVPVLGRTWQMLLKGLSEVEMAPDRREAAEMILIRLCYVADLPP 373

Query: 354 PEEIARYI 361
           P ++ R +
Sbjct: 374 PGDLVRRL 381


>gi|209545026|ref|YP_002277255.1| DNA polymerase III subunits gamma and tau [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532703|gb|ACI52640.1| DNA polymerase III, subunits gamma and tau [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 687

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 231/368 (62%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ   ++ L NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 72  LIGQDSTVRILRNAFALGRVAHAFMLTGVRGVGKTTTARIIARALNCVGPDGTGGPTADP 131

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREII+   ++P+  R +V+I+DEV MLS
Sbjct: 132 CGVCANCVAILADRHPDVLEMDAASRTGVDDVREIIEATRFRPMQGRMKVFIIDEVHMLS 191

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP  V F+FATTE+RK+P+TVLSRCQRFDL R+   DL   F +I +
Sbjct: 192 RNAFNALLKTLEEPPAQVTFVFATTELRKVPVTVLSRCQRFDLRRVPQSDLAAHFGRIAR 251

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN------DKIVTSSVRLMLALADR 233
            E  E  P+A+A+IARA+DGS RDGLSLLDQAIA+ +        I    V  ML LADR
Sbjct: 252 AEGAECTPDALALIARAADGSVRDGLSLLDQAIAQGSVEGDGAAPIGAERVADMLGLADR 311

Query: 234 NRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLL 293
            R+ DL   ++ G     L      +  G +  V+L D+ E  H V+R+K +P +  +  
Sbjct: 312 GRVFDLLEAVLAGQPDRALAITDEAHARGADLGVMLGDVLELVHTVSRLKAVPALRQSAD 371

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
             EAE  R    +  +S+  L R WQM+LKG+SE+E      EA EM+LIRL +   LP 
Sbjct: 372 LPEAERERGGALADRLSVPVLGRTWQMLLKGLSEVEMAPDRREAAEMILIRLCYVADLPP 431

Query: 354 PEEIARYI 361
           P ++ R +
Sbjct: 432 PGDLVRRL 439


>gi|258541156|ref|YP_003186589.1| DNA polymerase III subunits gamma/tau [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632234|dbj|BAH98209.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635291|dbj|BAI01260.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638346|dbj|BAI04308.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641400|dbj|BAI07355.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644455|dbj|BAI10403.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-26]
 gi|256647510|dbj|BAI13451.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-32]
 gi|256650563|dbj|BAI16497.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256653554|dbj|BAI19481.1| DNA polymerase III gamma/tau subunit [Acetobacter pasteurianus IFO
           3283-12]
          Length = 657

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 243/368 (66%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ+ M++TL NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN      +  PT + 
Sbjct: 65  LIGQEAMVRTLRNAFALGRVAHAFMLTGVRGVGKTTTARIIARALNCIGPDGNGGPTADP 124

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREII+   ++P+  R +V+I+DEV MLS
Sbjct: 125 CGVCANCVAILNDRHPDVLEMDAASRTGVDDVREIIEATRFRPMQGRMKVFIIDEVHMLS 184

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP  V FIFATTE+RK+P+TVLSRCQRFDL R+   +L+ LF++I +
Sbjct: 185 RNAFNALLKTLEEPPAQVTFIFATTELRKVPVTVLSRCQRFDLRRVPQSELVGLFSRIAE 244

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-----DKIVTSSV-RLMLALADR 233
           +E +    +A+A++ARA+DGS RDGLSLLDQAIA+       D ++ ++V   ML LADR
Sbjct: 245 KEHVRLSSDALALVARAADGSVRDGLSLLDQAIAQGTGQTDADGVIGATVISDMLGLADR 304

Query: 234 NRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLL 293
             + DL   ++ G     L    + Y  G +P ++L D+ E  H V+R++ +P + D+  
Sbjct: 305 EVVFDLLEAVLTGKPEQALALLDAAYARGADPGLVLGDMLELVHTVSRLRAVPSLRDSAD 364

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
             EAE  R    +   ++  L R WQM++KG+ E+E  S    A +MVLIRL +   +PS
Sbjct: 365 MPEAERVRGTHMADTFTVPVLMRAWQMLIKGMQEVEAASDRRAAADMVLIRLCYVADMPS 424

Query: 354 PEEIARYI 361
           PE++ + +
Sbjct: 425 PEDLIKRL 432


>gi|296533588|ref|ZP_06896155.1| DNA polymerase III, gamma/tau subunit DnaX [Roseomonas cervicalis
           ATCC 49957]
 gi|296266081|gb|EFH12139.1| DNA polymerase III, gamma/tau subunit DnaX [Roseomonas cervicalis
           ATCC 49957]
          Length = 444

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 178/367 (48%), Positives = 238/367 (64%), Gaps = 4/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  +++TL NAF   R+A ++ML+G RG+GKTTTARIIAR+LN      +  PT + 
Sbjct: 71  LIGQDALVRTLRNAFAQNRVAHAFMLTGVRGVGKTTTARIIARALNCVGPDGNGGPTADP 130

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G    CQAI+   H DV+ELDAAS+  +D++RE+ + + Y+P  ARF+VYI+DEV MLS
Sbjct: 131 CGVCAECQAILADRHPDVLELDAASNNGVDNIRELREAVRYRPARARFKVYILDEVHMLS 190

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           TAAFN LLKTLEEPPP VKF+FATTEIRK+P T+LSRCQRFDL R+    L   F +I +
Sbjct: 191 TAAFNALLKTLEEPPPQVKFLFATTEIRKVPATILSRCQRFDLKRVPQEQLRAHFARIAE 250

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLD---QAIARCNDKIVTSSVRLMLALADRNRI 236
            E++     A+AMIARA+DGS RDGLSLLD      A     +    VR ML LADR+ +
Sbjct: 251 AEAVPASEAALAMIARAADGSVRDGLSLLDQAIAQAAGSAAGVEADLVRDMLGLADRSLL 310

Query: 237 MDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
            DL     +GDI  +L    + ++ G +P V+L DL E TH +TR++ +P +       E
Sbjct: 311 FDLLEAAFRGDIPAMLAAMDAGHERGADPGVVLADLLELTHTLTRLRAVPALRQDPSLPE 370

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R +  ++ ++I  L R WQ++LKGISE+        A EMVLIRLAH   LPSP +
Sbjct: 371 QERVRGVALAERLTIPVLGRAWQVLLKGISEVAEAPDRRAAAEMVLIRLAHLADLPSPGD 430

Query: 357 IARYIVE 363
           + R + E
Sbjct: 431 LVRRLTE 437


>gi|103486288|ref|YP_615849.1| DNA polymerase III subunits gamma and tau [Sphingopyxis alaskensis
           RB2256]
 gi|98976365|gb|ABF52516.1| DNA polymerase III, subunits gamma and tau [Sphingopyxis alaskensis
           RB2256]
          Length = 565

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 242/366 (66%), Gaps = 7/366 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ  M+KTL NA    R+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 44  LIGQDAMVKTLGNAIARDRLAHAFLMTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDP 103

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DV+E+DAAS+T +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 104 CGVCEPCRAITEGRHIDVIEMDAASNTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 163

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPPHVKF+FATTE+ K+P+TVLSRCQRFDL RI+   L   F+ ILQ
Sbjct: 164 RNAFNALLKTLEEPPPHVKFLFATTEVNKVPVTVLSRCQRFDLRRITPDMLFAHFSAILQ 223

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN----DKIVTSSVRLMLALADRNR 235
           +E +E +  A+ +IA A++GS RDGLS+LDQAIA  +     K+    VR ML L+DR+ 
Sbjct: 224 KEGVEAEAPAIWLIANAAEGSVRDGLSILDQAIAHADLDGGGKVSAEQVRAMLGLSDRSS 283

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           I  L   +++G+    +    +QY  G+ P  ++  L E TH +T  K      D    +
Sbjct: 284 IAGLMAAILEGNSGGAIDLARAQYALGIEPVAMVRGLMELTHAITLAKV--SRHDDPALA 341

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
            A+  R   +++++    L+R WQ++LKG  E+   + P+E +EM+L+R+ +A  LP P 
Sbjct: 342 VADRERITDWAQKLGFAPLNRLWQLLLKGHDEVLRANNPLEHLEMLLLRVIYAASLPDPG 401

Query: 356 EIARYI 361
           E+A+ +
Sbjct: 402 ELAKLL 407


>gi|296284716|ref|ZP_06862714.1| DNA polymerase III subunits gamma and tau [Citromicrobium
           bathyomarinum JL354]
          Length = 606

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 238/371 (64%), Gaps = 7/371 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+PM++TL NA +  R+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 77  LIGQEPMVQTLANAIRRDRLAHAFLMTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDP 136

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DV+E+DAASHT +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 137 CGVCEPCRAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 196

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSR QRFDL RI    L E F  +  
Sbjct: 197 RNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRTQRFDLRRIPTERLGEHFAWVCG 256

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC----NDKIVTSSVRLMLALADRNR 235
           +E +E +PEA+ ++A A++GS RDGLS+LDQAIA      + K+  + VR ML LAD   
Sbjct: 257 QEGVEAEPEALNLVAAAAEGSVRDGLSILDQAIAHADLDSDAKVTAARVRDMLGLADAGA 316

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
              L G +++G+   +L   + QY  GV P  ++  L E  H +T ++    M D  L  
Sbjct: 317 QRRLLGAILEGEPKTMLDAVADQYALGVEPLALMRSLMEIVHRITVMQIGGAMPD--LAG 374

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E E  +  Q++  ++   L R WQM+L+G  E+     P+ + +M L+RL HA   P P 
Sbjct: 375 EEEREQLSQWAARLTPGQLHRLWQMLLRGYDEVNTAPDPLVSAQMALLRLIHAANAPDPG 434

Query: 356 EIARYIVEEKK 366
            + + + E  K
Sbjct: 435 SLVKRMEELAK 445


>gi|330993788|ref|ZP_08317720.1| DNA polymerase III subunit tau [Gluconacetobacter sp. SXCC-1]
 gi|329759056|gb|EGG75568.1| DNA polymerase III subunit tau [Gluconacetobacter sp. SXCC-1]
          Length = 690

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 233/379 (61%), Gaps = 10/379 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHI-DVPTVEF 59
           +IGQ+  ++ L NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 77  LIGQETTVRILRNAFAQGRVAHAFMLTGVRGVGKTTTARIIARALNCTGPDGRGGPTADP 136

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREII+   ++P+  R +V+I+DEV MLS
Sbjct: 137 CGVCPNCVAILADRHPDVLEIDAASRTGVDDVREIIEATRFRPLQGRMKVFIIDEVHMLS 196

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPP V FIFATTE+RK+ +TVLSRCQ F L R+   +L   F ++ Q
Sbjct: 197 RNAFNALLKTLEEPPPQVTFIFATTELRKVLVTVLSRCQTFALRRVPQVELAAHFDRVAQ 256

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN---------DKIVTSSVRLMLAL 230
            E + F  +A+A+IARA+DGS RDGLSLLDQAIA+             I    V  ML L
Sbjct: 257 AEHVRFSADALALIARAADGSVRDGLSLLDQAIAQGTLDGEGGADAAPIGVDLVAGMLGL 316

Query: 231 ADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMAD 290
           ADR  + DL   +++G     L+     Y  G +  V+L D+ E  H V+RIK IP + D
Sbjct: 317 ADRGLVFDLLDAVLEGRADRALEITGDVYMRGGDLGVMLGDVLELVHTVSRIKAIPALRD 376

Query: 291 TLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ 350
                EAE  R    ++ V +  L R WQM+LKG+ E+E      +AV+MVLIRL +   
Sbjct: 377 NPEMPEAERQRGAALAERVPVPVLGRTWQMLLKGVEEVEHAPDRRQAVDMVLIRLCYVAD 436

Query: 351 LPSPEEIARYIVEEKKKKT 369
           LP P ++ R ++ +    T
Sbjct: 437 LPPPGDVVRRMLGQDGPAT 455


>gi|296116792|ref|ZP_06835398.1| DNA polymerase III subunits gamma and tau [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976593|gb|EFG83365.1| DNA polymerase III subunits gamma and tau [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 690

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 169/373 (45%), Positives = 229/373 (61%), Gaps = 10/373 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ   ++ L NAF  GR+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 63  LIGQDTTVRILRNAFALGRVAHAFMLTGVRGVGKTTTARIIARALNCTGPDGQGGPTADP 122

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREIID   ++PI  R +V+I+DEV MLS
Sbjct: 123 CGVCPNCVAILADRHPDVMEMDAASRTGVDDVREIIDSTRFRPIQGRMKVFIIDEVHMLS 182

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP  V FIFATTE+RK+P+TVLSRCQ FDL R+    L   F ++  
Sbjct: 183 RNAFNALLKTLEEPPSQVTFIFATTELRKVPVTVLSRCQTFDLRRVPQDMLAAHFGRVAA 242

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN---------DKIVTSSVRLMLAL 230
            E + F P+A+A+IARA+DGS RDGLSLLDQAIA+             I  + V  ML  
Sbjct: 243 AEGVAFAPDALALIARAADGSVRDGLSLLDQAIAQGTLDGEGQGDAAPIDATLVSGMLGQ 302

Query: 231 ADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMAD 290
           ADR  + DL   ++ G     L      +  G +  V+L D+ +  H V+R+K +P + D
Sbjct: 303 ADRGMVFDLLDAVLAGRPDQALTITDEVFARGADLGVMLADVLDLIHSVSRLKAVPNLRD 362

Query: 291 TLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ 350
           +    + E  R L  ++ VS+  L R WQM+LKG  E+E      +A EMVLIR+ +   
Sbjct: 363 SADMPQMERERCLAIAERVSVPVLGRTWQMLLKGQGEVEHAPDRRQAAEMVLIRMCYVAD 422

Query: 351 LPSPEEIARYIVE 363
           LP P ++ R +++
Sbjct: 423 LPPPGDLVRQVLD 435


>gi|307292717|ref|ZP_07572563.1| DNA polymerase III, subunits gamma and tau [Sphingobium
           chlorophenolicum L-1]
 gi|306880783|gb|EFN11999.1| DNA polymerase III, subunits gamma and tau [Sphingobium
           chlorophenolicum L-1]
          Length = 538

 Score =  325 bits (832), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 172/367 (46%), Positives = 245/367 (66%), Gaps = 7/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ  M++TL NA + GR+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 23  LIGQDAMVQTLANAIRRGRLAHAFLMTGVRGVGKTSTARLIAKALNCVGPDGQGGPTIDP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DVVE+DAASHT +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 83  CGACEPCMAIAEGRHIDVVEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSRCQRFDL RI    L   F  +++
Sbjct: 143 KNAFNALLKTLEEPPAHVKFLFATTEVNKVPVTVLSRCQRFDLRRIPAELLAAHFAHVVE 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC----NDKIVTSS-VRLMLALADRN 234
            E++  +P+A+A+IA+A++GSARDGLS+LDQAIA         +VT++ VR ML L+DR 
Sbjct: 203 AEAVAAEPDALALIAQAAEGSARDGLSILDQAIAHAEMGEGAPLVTATQVRDMLGLSDRG 262

Query: 235 RIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
               L G L++GD   +L     QY  GV P  ++  L E  H VT +K   ++A+    
Sbjct: 263 ATRRLLGLLLEGDTGALLGAVRDQYALGVEPLSLMRGLLELAHAVTLVKAGRDIANPGQS 322

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
           +E   A A  ++ ++    L R WQ++LKG  E+   + P+E+ EM L+R+ HA  +P P
Sbjct: 323 AEEREALA-DWASQLGFAPLHRLWQLLLKGHDEVASAALPIESCEMALLRVMHAATMPDP 381

Query: 355 EEIARYI 361
            E+AR +
Sbjct: 382 GEVARLL 388


>gi|294012157|ref|YP_003545617.1| DNA polymerase III gamma and tau subunit [Sphingobium japonicum
           UT26S]
 gi|292675487|dbj|BAI97005.1| DNA polymerase III gamma and tau subunit [Sphingobium japonicum
           UT26S]
          Length = 536

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 171/367 (46%), Positives = 240/367 (65%), Gaps = 7/367 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  M++TL NA + GR+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 23  LIGQDAMVQTLGNAIRRGRLAHAFLMTGVRGVGKTSTARLIAKALNCVGPDGQGGPTIDP 82

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DV+E+DAASHT +DD+R IID       SAR+++YI+DEV MLS
Sbjct: 83  CGLCEPCMAIGEGRHIDVLEMDAASHTGVDDIRSIIDIAGKGAYSARYKIYIIDEVHMLS 142

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+ ATTE+ K+P+TVLSRCQRFDL RI    L   F  +++
Sbjct: 143 RNAFNALLKTLEEPPEHVKFVLATTEVNKVPVTVLSRCQRFDLRRIPAELLAAHFAHVVE 202

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC----NDKIVTSS-VRLMLALADRN 234
            ES+  +P+A+A+IA+A++GSARDGLS+LDQAIA         +VT++ VR ML L+DR 
Sbjct: 203 AESVAAEPDALALIAQAAEGSARDGLSILDQAIAHAEMGEGAPLVTAAQVRDMLGLSDRG 262

Query: 235 RIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
               L G L++GD   +L     QY  GV P  ++  L E  H VT +K   ++A+    
Sbjct: 263 ATRRLLGLLLEGDTGVLLGAVRDQYALGVEPLSLMRGLLELVHAVTLVKAGRDIANPGQS 322

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSP 354
           +E   A A  ++ ++    L R WQ++LKG  E+   + P+E+ EM L+R+ HA  +P P
Sbjct: 323 AEEREALA-DWASQLGFAPLHRLWQLLLKGHDEVASAALPIESCEMALLRVMHAATMPDP 381

Query: 355 EEIARYI 361
            EIAR I
Sbjct: 382 GEIARLI 388


>gi|262277951|ref|ZP_06055744.1| DNA polymerase III subunit gamma/tau [alpha proteobacterium
           HIMB114]
 gi|262225054|gb|EEY75513.1| DNA polymerase III subunit gamma/tau [alpha proteobacterium
           HIMB114]
          Length = 553

 Score =  322 bits (825), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 156/365 (42%), Positives = 241/365 (66%), Gaps = 14/365 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVE-- 58
           +IGQ  M+ ++ NA K  RI  +Y+L+G RG GKTTTARIIA+++N K   +D  + +  
Sbjct: 20  LIGQDSMVISIQNAIKLKRIPNAYLLTGIRGTGKTTTARIIAKAINCK---VDFASDQKC 76

Query: 59  FEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
            EG   HC++I   NH+D++E+DAAS T IDD+REI++   Y P +A ++V+I+DEV ML
Sbjct: 77  SEGDFCHCESITNSNHIDILEMDAASKTGIDDIREILEASKYHPSTAEYKVFIIDEVHML 136

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFN LLKTLEEPPPH+KFI ATTE++KIP+T+LSRCQRFDL RI + ++     KI 
Sbjct: 137 SKQAFNALLKTLEEPPPHLKFILATTEVKKIPVTILSRCQRFDLRRIKVEEMKSFLRKIC 196

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN---DKIVTSSVRLMLALADRNR 235
            +E  + D  ++ +++++S+GS RD LS+LDQAI   N   +K+    VR ML LAD  +
Sbjct: 197 DKEEADVDENSLTLMSKSSEGSVRDALSILDQAIITYNLMGEKVTEDKVRTMLGLADDTK 256

Query: 236 IMDLFGYLIKGDI---INVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL 292
           I+DL  Y+++G+I   IN ++E    +D G +P ++LH L +  +L+TR K + +++  L
Sbjct: 257 IVDLMSYIVEGNIEKSINAVEEI---FDIGADPKLVLHSLLDVCYLMTRTKTLGKISKDL 313

Query: 293 LYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
             SE++  R     K++ +T+L+  W  ++KG+ ++  +     A +M+L RL H   +P
Sbjct: 314 SVSESDAERLNVMVKDLDMTYLTMLWHFLIKGLEDLNLYPNLSIAFQMLLTRLCHLKNMP 373

Query: 353 SPEEI 357
            P+ +
Sbjct: 374 DPQSV 378


>gi|85708099|ref|ZP_01039165.1| DNA polymerase III subunits gamma and tau [Erythrobacter sp. NAP1]
 gi|85689633|gb|EAQ29636.1| DNA polymerase III subunits gamma and tau [Erythrobacter sp. NAP1]
          Length = 601

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 240/372 (64%), Gaps = 7/372 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ+PM++TL NA +  R+A +++++G RG+GKT+TAR+IA++LN      +  PT++ 
Sbjct: 78  LVGQEPMVRTLANAIERDRLAHAFLMTGVRGVGKTSTARLIAKALNCVGPDGNGGPTIDP 137

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DV+E+DAASHT +DDVREII+Q+ Y  +SAR+++YI+DEV MLS
Sbjct: 138 CGVCEFCTAIAEGRHIDVIEMDAASHTGVDDVREIIEQVRYAAVSARYKIYIIDEVHMLS 197

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSR QRFDL RI    L E F  + +
Sbjct: 198 RNAFNALLKTLEEPPAHVKFLFATTEVEKLPVTVLSRTQRFDLRRIPASLLAEHFGNVCK 257

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN----DKIVTSSVRLMLALADRNR 235
            E +E + EA+ +IA A++GSARDGLS+LDQAIA  +     K+    VR ML LAD++ 
Sbjct: 258 AEGVEAEEEALRIIAAAAEGSARDGLSILDQAIAHADMDTEGKVTAERVRSMLGLADKSA 317

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
              L G +++GD   +L     QY  GV P  ++  L +  H VT  +      D    S
Sbjct: 318 QRRLLGTVLEGDAKGLLAGVDEQYALGVEPLALMRALMDLVHRVTVAQVSGGEPDA--PS 375

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E E     +++ ++    L R WQ++LKG  E+     P+ A++M L+R+ HA Q+P P 
Sbjct: 376 EEERTALAEFASKLGAPELHRLWQLLLKGHEEVRTSPDPLVALQMALLRVLHAAQMPDPG 435

Query: 356 EIARYIVEEKKK 367
           ++A  I E  K 
Sbjct: 436 KLAARIEEMAKN 447


>gi|297183472|gb|ADI19603.1| DNA polymerase III, gamma/tau subunits [uncultured SAR11 cluster
           bacterium HF0770_37D02]
          Length = 563

 Score =  318 bits (814), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/362 (44%), Positives = 238/362 (65%), Gaps = 8/362 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  M++T+TN+ K  ++  +Y+L+G RG+GKTTTAR+IA+++N K   +D    E  
Sbjct: 21  LIGQDMMVQTITNSIKLDKLPNAYLLTGIRGVGKTTTARLIAKAINCK---MDFFQGEKC 77

Query: 61  GFGEHCQA--IIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
              EHC    II   H+DV+E+DAAS T IDDVRE+I+   Y P  A+++++I+DEV ML
Sbjct: 78  NSNEHCHCKEIINSRHLDVLEMDAASRTGIDDVRELIESSKYNPTHAKYKIFIIDEVHML 137

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  AFNGLLKTLEEPPPH+KFIFATTE++K+P+T++SRCQRFDLHR+SI  L+    KIL
Sbjct: 138 SKQAFNGLLKTLEEPPPHLKFIFATTEVKKVPVTIVSRCQRFDLHRVSIKVLLGQLKKIL 197

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIAR---CNDKIVTSSVRLMLALADRNR 235
           + E+      A+ +IA+ S+GS RD LSLLD+A+        +I  + VR ML +ADR++
Sbjct: 198 KIENGNISDAALKLIAKTSEGSVRDSLSLLDRALVSQHITEKEIDETFVRKMLGIADRSK 257

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           I++L  ++  G++   +++     + GV P   L+D  E  + + + K I +    L  S
Sbjct: 258 ILELLQFIFYGNLKESIKQLREMINEGVEPVNFLNDFLEMIYFILQKKNIGDFDSDLSIS 317

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E+E       SK+V I+ L+ FWQ I+KGI E+   + P+ ++EM+++RL H   +PS E
Sbjct: 318 ESELKMIDSISKDVKISTLTIFWQFIIKGIDELSVVTNPILSLEMLIVRLIHLKDMPSYE 377

Query: 356 EI 357
            I
Sbjct: 378 SI 379


>gi|149186799|ref|ZP_01865109.1| DNA polymerase III subunits gamma and tau [Erythrobacter sp. SD-21]
 gi|148829466|gb|EDL47907.1| DNA polymerase III subunits gamma and tau [Erythrobacter sp. SD-21]
          Length = 612

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 160/368 (43%), Positives = 232/368 (63%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           +IGQ  M++TL NA    R+A +++++G RG+GKT+TAR+IA++LN      +  PT+  
Sbjct: 93  LIGQDAMVRTLANAIARDRLAHAFLMTGVRGVGKTSTARLIAKALNCIGPDGEGGPTISP 152

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DV+E+DAASHT +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 153 CGVCEPCTAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 212

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSR QRFDL RI +  L   F +I +
Sbjct: 213 RNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRTQRFDLRRIPVELLEAHFAEICR 272

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN----DKIVTSSVRLMLALADRNR 235
           +E +E + EA+ + A A++GS RDGLS+LDQAIA  +     K+    VR ML LADR  
Sbjct: 273 KEGVEAEDEALHIAANAAEGSVRDGLSILDQAIAHADMDTGGKVTADRVRDMLGLADRGA 332

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
              LF +++ GD    L     QY  GV P  ++  L + TH +   +     A+     
Sbjct: 333 QRRLFAHILDGDAKAALAAVDDQYALGVEPLALMRSLMDLTHRIALTQVSGSEAEATTAE 392

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E +  +  ++SK + +  + R WQ++LKG  E+     P+ +  M L+R+ HA  +P P 
Sbjct: 393 ERD--QLTEWSKRLEVGQVHRLWQLLLKGHEEVRHAPDPLVSARMALLRVLHAAGMPDPG 450

Query: 356 EIARYIVE 363
           ++A+ + E
Sbjct: 451 KLAKQLEE 458


>gi|330813511|ref|YP_004357750.1| DNA polymerase III subunits gamma and tau [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486606|gb|AEA81011.1| DNA polymerase III subunits gamma and tau [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 531

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 154/352 (43%), Positives = 230/352 (65%), Gaps = 4/352 (1%)

Query: 7   MIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHC 66
           M   + NA +  R+  +Y+L+G RG+GKTTTARIIA+++N             E +  HC
Sbjct: 1   MSTAIQNAIEMDRVPNAYLLTGIRGVGKTTTARIIAKAINCNKKFGSEEKCSKEEYC-HC 59

Query: 67  QAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGL 126
           +AI+  +H+D++E+DAAS T IDD+REI++   Y P SA+++V+I+DEV MLS  AFN L
Sbjct: 60  EAIVDSSHMDILEMDAASKTGIDDIREILESAQYLPASAKYKVFIIDEVHMLSKQAFNAL 119

Query: 127 LKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFD 186
           LKTLEEPPPH+KFI ATTE++KIP+T+LSRCQRFDL RI + ++      I  +E  + D
Sbjct: 120 LKTLEEPPPHLKFILATTEVKKIPVTILSRCQRFDLRRIKMEEMQLFLRDIAIKEQAKVD 179

Query: 187 PEAVAMIARASDGSARDGLSLLDQAIARCN---DKIVTSSVRLMLALADRNRIMDLFGYL 243
            +A+A+IA++S+GS RD LS+LDQAI   N     I   +VR ML LAD++R+++L  ++
Sbjct: 180 DKALAIIAKSSEGSVRDALSVLDQAIITFNLQDQDITEQNVRDMLGLADQSRVIELLSFI 239

Query: 244 IKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARAL 303
           ++G   + L+E    +D G +P +IL  + E  +L++R K   ++ + L  SE+E+    
Sbjct: 240 VRGSQQDALREAEDIFDIGADPKLILQSMLEIIYLISRTKTFGKIENDLSVSESESILIK 299

Query: 304 QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           Q S E+ +T++S  W   LKGI E+     P  +  M+LIRLAH   +P P+
Sbjct: 300 QISDEIDLTYVSMLWHFTLKGIEELNSTPNPFLSFRMLLIRLAHLKNMPDPQ 351


>gi|162007986|ref|YP_457625.2| DNA polymerase III subunits gamma and tau [Erythrobacter litoralis
           HTCC2594]
          Length = 575

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 240/368 (65%), Gaps = 11/368 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+PM++TL NA +  R+A +++++G RG+GKT+TAR+IA+SLN         PT++ 
Sbjct: 49  LIGQEPMVRTLANAIERDRLAHAFLMTGVRGVGKTSTARLIAKSLNCIGPDGQGGPTIDP 108

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G H+DV+E+DAASHT +DDVREII+ + Y  +SARF++YI+DEV MLS
Sbjct: 109 CGQCEPCTAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARFKIYIIDEVHMLS 168

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSR QRFDL RI    L + F  + +
Sbjct: 169 RNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRTQRFDLRRIPADLLQKHFGWVCE 228

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIAR----CNDKIVTSSVRLMLALADRNR 235
           +E +E + EA+AMIA A++GS RDGLS+LDQAIA      + K+  + VR ML LAD+  
Sbjct: 229 QEQVEAEDEALAMIAAAAEGSVRDGLSILDQAIAHADLDADGKVTATRVRDMLGLADKGA 288

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL--L 293
              +FG +++GD   +L     QY  GV P  ++    E  H +T    + ++  +L   
Sbjct: 289 QRRMFGTILEGDAKALLAAIEDQYSLGVEPLALVRSQMELAHRIT----LAQLGGSLPGA 344

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
            SE E A    + +++S   L R WQ++LK   E++    P+ + +M L+RL HA +LP 
Sbjct: 345 VSEEEQAALTAWGEQLSQGQLHRLWQLLLKAYEEVKTAPDPLVSAQMGLLRLLHASELPD 404

Query: 354 PEEIARYI 361
           P ++ + +
Sbjct: 405 PGKLVKTL 412


>gi|58039074|ref|YP_191038.1| DNA polymerase III subunits gamma and tau [Gluconobacter oxydans
           621H]
 gi|58001488|gb|AAW60382.1| DNA polymerase III subunit gamma/tau [Gluconobacter oxydans 621H]
          Length = 652

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 173/364 (47%), Positives = 230/364 (63%), Gaps = 3/364 (0%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN-YKTAHIDVPTVEF 59
           +IGQ  +++ L  AF+  R+A ++ML+G RG+GKTTTARIIAR+LN         PT + 
Sbjct: 53  LIGQDSLVRILRRAFELKRVAHAFMLTGVRGVGKTTTARIIARALNCVGPDGKGGPTADP 112

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G   +C AI+   H DV+E+DAAS T +DDVREII+   ++P+ AR +V+I+DEV MLS
Sbjct: 113 CGVCPNCTAILADRHPDVLEMDAASRTGVDDVREIIEATRFRPMQARMKVFIIDEVHMLS 172

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPPP V FIFATTE+RK+P+TVLSRCQRFDL R+    L   F  I  
Sbjct: 173 RNAFNALLKTLEEPPPQVTFIFATTELRKVPVTVLSRCQRFDLRRVPQSLLAGHFHNIAV 232

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E      +A+A+IARA+DGS RDGLSLLDQAIA+        +V  ML LADR  + DL
Sbjct: 233 KEGATLSEDALALIARAADGSVRDGLSLLDQAIAQGASD--ADAVADMLGLADRGLVFDL 290

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              L+ G   + L      Y  G +  V+L DL +  HL++R+K IP + +     EAE 
Sbjct: 291 LDALMAGKPADALDLTDQAYARGADLGVLLADLLDLLHLISRLKAIPSLREGRDLPEAER 350

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    +  +S   L R WQ++LKG+ E+E      +A EMVLIRL HA  LP+P+ + R
Sbjct: 351 TRGAALADRLSNAVLGRAWQILLKGVQEVETAPDRRQAAEMVLIRLCHASLLPTPDRLIR 410

Query: 360 YIVE 363
            + E
Sbjct: 411 QLTE 414


>gi|326385522|ref|ZP_08207161.1| DNA polymerase III subunits gamma and tau [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326210061|gb|EGD60839.1| DNA polymerase III subunits gamma and tau [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 622

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 166/371 (44%), Positives = 239/371 (64%), Gaps = 14/371 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ+ M++TL NA + GR+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 88  LIGQEAMVQTLANAIRRGRLAHAFLMTGIRGVGKTSTARLIAKALNCIGPDGQGGPTIDP 147

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DV+E+DAASHT +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 148 CGVCEPCRAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLS 207

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSRCQRFDL RI    L   F  I  
Sbjct: 208 RNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRCQRFDLKRIETPVLAAHFASICD 267

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN--------DKIVTSSVRLMLALA 231
           +E ++ D EA+A+IA A++GS RDGLS+LDQAI+  +          +  + VR ML LA
Sbjct: 268 KEGVKADDEALALIAAAAEGSVRDGLSILDQAISHADLAGGGEAGTHVTAAQVREMLGLA 327

Query: 232 DRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADT 291
           D++    L G ++ GD   +L E + QY  G+ P  ++    +  H VT +  +   AD 
Sbjct: 328 DKSMQRRLLGAVLGGDGRKLLDEVAGQYALGIEPLALMRAQLDLVHKVT-LTQVTGSADA 386

Query: 292 LLYSEAENARAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ 350
                AE   AL +++K +S   L R WQ++LKG  E+     P+ A +M L+R+ HA +
Sbjct: 387 ---PAAEERMALEEWAKGLSAGQLHRLWQLLLKGHDEVRVAPDPLAAAQMALLRVMHATE 443

Query: 351 LPSPEEIARYI 361
           +P P  + R +
Sbjct: 444 MPDPGGLVRKL 454


>gi|218508995|ref|ZP_03506873.1| DNA polymerase III subunits gamma and tau [Rhizobium etli Brasil 5]
          Length = 228

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 140/195 (71%), Positives = 171/195 (87%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+PM++TLTNAF++GRIAQ+YML+G RG+GKTTTARI+AR+LNYKTA +D PT++  
Sbjct: 34  MVGQEPMVRTLTNAFETGRIAQAYMLTGVRGVGKTTTARILARALNYKTADVDKPTIDLR 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
             GEHCQAI+ G HVDV+E+DAASHT IDD+REII+Q+ Y+P+SAR++VYI+DEV MLST
Sbjct: 94  APGEHCQAIMEGRHVDVIEMDAASHTGIDDIREIIEQVRYRPVSARYKVYIIDEVHMLST 153

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFNGLLKTLEEPP HVKFIFATTEIRK+PITVLSRCQRFDL RIS  DL+ LFT I  +
Sbjct: 154 QAFNGLLKTLEEPPEHVKFIFATTEIRKVPITVLSRCQRFDLRRISASDLVGLFTTIAAK 213

Query: 181 ESIEFDPEAVAMIAR 195
           E IE + +A+AMIAR
Sbjct: 214 EGIEAEADALAMIAR 228


>gi|294085056|ref|YP_003551816.1| replication factor C domain-containing protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664631|gb|ADE39732.1| replication factor C conserved domain:ATP/GTP-binding site motif A
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 620

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 166/364 (45%), Positives = 229/364 (62%), Gaps = 5/364 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHID-VPTVEF 59
           +IGQ  +++TL NA   GR+A +++L+G RG+GKT+ AR++A+ LN      +   T+E 
Sbjct: 24  LIGQDALVRTLGNALSLGRLAHAFVLTGVRGVGKTSAARLLAKGLNCIGPDGNGAATLEP 83

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C AI  G HVDV+E+DAASHT +DD REII+ + Y+P+SARF++YI+DEV M+S
Sbjct: 84  CGTCEPCTAIAAGRHVDVLEIDAASHTGVDDAREIIEAVNYRPVSARFKIYIIDEVHMMS 143

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
            +AFN LLKTLEEPP  VKFIFATTEIRK+P+T+LSRCQR+DL R+    L      I  
Sbjct: 144 KSAFNALLKTLEEPPDAVKFIFATTEIRKVPVTILSRCQRYDLRRVPATLLASHLEMICG 203

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
           +E I+ +  A+A IA A++GS RD LSLLDQA A   D +   SV  ML    R   + L
Sbjct: 204 KEDIKAEAGALAAIASAAEGSVRDALSLLDQAAAMTADTLSAESVSDMLGRPGRAEALAL 263

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              ++  D+ + L  F+  Y  G  P +++ DL +  H  +        A TL+  E E 
Sbjct: 264 LKSVLANDVASALASFNDIYQRGAEPEMLIADLLDIVHSASLCATGGSSA-TLI--EGER 320

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           A +++    + I  L R WQ++LKG  E+     P  A EM+LIRLAHA Q+PSP+EI R
Sbjct: 321 A-SIEELATLGIAKLGRAWQILLKGHGELNAAPNPANACEMLLIRLAHAAQMPSPDEILR 379

Query: 360 YIVE 363
            + E
Sbjct: 380 ALPE 383


>gi|84786646|gb|ABC62828.1| DNA polymerase III tau subunit [Erythrobacter litoralis HTCC2594]
          Length = 521

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 162/362 (44%), Positives = 234/362 (64%), Gaps = 11/362 (3%)

Query: 7   MIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEFEGFGEH 65
           M++TL NA +  R+A +++++G RG+GKT+TAR+IA+SLN         PT++  G  E 
Sbjct: 1   MVRTLANAIERDRLAHAFLMTGVRGVGKTSTARLIAKSLNCIGPDGQGGPTIDPCGQCEP 60

Query: 66  CQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNG 125
           C AI  G H+DV+E+DAASHT +DDVREII+ + Y  +SARF++YI+DEV MLS  AFN 
Sbjct: 61  CTAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARFKIYIIDEVHMLSRNAFNA 120

Query: 126 LLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEF 185
           LLKTLEEPP HVKF+FATTE+ K+P+TVLSR QRFDL RI    L + F  + ++E +E 
Sbjct: 121 LLKTLEEPPAHVKFLFATTEVDKLPVTVLSRTQRFDLRRIPADLLQKHFGWVCEQEQVEA 180

Query: 186 DPEAVAMIARASDGSARDGLSLLDQAIAR----CNDKIVTSSVRLMLALADRNRIMDLFG 241
           + EA+AMIA A++GS RDGLS+LDQAIA      + K+  + VR ML LAD+     +FG
Sbjct: 181 EDEALAMIAAAAEGSVRDGLSILDQAIAHADLDADGKVTATRVRDMLGLADKGAQRRMFG 240

Query: 242 YLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTL--LYSEAEN 299
            +++GD   +L     QY  GV P  ++    E  H +T    + ++  +L    SE E 
Sbjct: 241 TILEGDAKALLAAIEDQYSLGVEPLALVRSQMELAHRIT----LAQLGGSLPGAVSEEEQ 296

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           A    + +++S   L R WQ++LK   E++    P+ + +M L+RL HA +LP P ++ +
Sbjct: 297 AALTAWGEQLSQGQLHRLWQLLLKAYEEVKTAPDPLVSAQMGLLRLLHASELPDPGKLVK 356

Query: 360 YI 361
            +
Sbjct: 357 TL 358


>gi|42520868|ref|NP_966783.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Drosophila melanogaster]
 gi|42410608|gb|AAS14717.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Drosophila melanogaster]
          Length = 533

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/368 (44%), Positives = 231/368 (62%), Gaps = 14/368 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   +I QS +LSG+ G+GKTTTARIIA  LN        P  E  
Sbjct: 15  LVGQDILVRVLENAFILNKIPQSILLSGSSGVGKTTTARIIALCLNCSLG----PIFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C AI   +H DV+E+DAASHTSIDD++ I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 71  GSCENCLAIKNSSHPDVIEIDAASHTSIDDIKVILGDICYSPISSKFKVYIIDEVHMLSS 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP  VKFI ATTEI+KIPIT+++RCQRFDLH I +  ++E    + Q+
Sbjct: 131 SAFNALLKTLEEPPSSVKFILATTEIKKIPITIIARCQRFDLHNIPVAKIVERLNDVAQK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND-KIVTSSVRLMLALADRNRIMDL 239
           ES   +  A+ +IAR S  S R+ L L++QA+    D  I T +V  +L L D++ I DL
Sbjct: 191 ESYSIEKGALELIARHSGNSMRNALFLMNQAVLYSKDGAISTKNVTDILGLVDKDIIFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGV---NPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
            G +++GD    LQ+  S +D  V   NP  I   L +   LV R     E+ + +  +E
Sbjct: 251 LGAILEGD----LQKALSVFDKAVKTANPLSIFEGLLQTIQLVCRFLITKEIDNAV--TE 304

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R    S + S+ F SR W+M+LKGI +I+  +    A EM+LI L +   LPSPE+
Sbjct: 305 HEKNRIKDLSIKRSLIFFSRLWKMLLKGIQDIKTSTCNDVAAEMMLISLCYLSDLPSPEQ 364

Query: 357 IARYIVEE 364
           + + ++ +
Sbjct: 365 VIKKVLSQ 372


>gi|58699909|ref|ZP_00374504.1| DNA polymerase III, subunits gamma and tau, programmed [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58533574|gb|EAL57978.1| DNA polymerase III, subunits gamma and tau, programmed [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 396

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 231/369 (62%), Gaps = 14/369 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   +I QS +LSG+ G+GKTTTARIIA  LN        P  E  
Sbjct: 15  LVGQYILVRVLENAFILNKIPQSILLSGSSGVGKTTTARIIALCLNCSLG----PIFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C AI   +H DV+E+DAASHTSIDD++ I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 71  GSCENCLAIKNSSHPDVIEIDAASHTSIDDIKVILGDICYSPISSKFKVYIIDEVHMLSS 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP  VKFI ATTEI+KIPIT+++RCQRFDLH I +  ++E    + Q+
Sbjct: 131 SAFNALLKTLEEPPSSVKFILATTEIKKIPITIIARCQRFDLHNIPVAKIVERLNDVAQK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND-KIVTSSVRLMLALADRNRIMDL 239
           ES   +  A+ +IAR S  S R+ L L++QA+    D  I T +V  +L L D++ I DL
Sbjct: 191 ESYSIEKGALELIARHSGNSMRNALFLMNQAVLYSKDGAISTKNVTDILGLVDKDIIFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGV---NPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
            G +++GD    LQ+  S +D  V   NP  I   L +   LV R     E+ + +  +E
Sbjct: 251 LGAILEGD----LQKALSVFDKAVKTANPLSIFEGLLQTIQLVCRFLITKEIDNAV--TE 304

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R    S + S+ F SR W+M+LKGI +I+  +    A EM+LI L +   LPSPE+
Sbjct: 305 HEKNRIKDLSIKRSLIFFSRLWKMLLKGIQDIKTSTCNDVAAEMMLISLCYLSDLPSPEQ 364

Query: 357 IARYIVEEK 365
           + + ++ + 
Sbjct: 365 VIKKVLSQN 373


>gi|225630794|ref|YP_002727585.1| DNA polymerase III, gamma/tau subunit [Wolbachia sp. wRi]
 gi|225592775|gb|ACN95794.1| DNA polymerase III, gamma/tau subunit [Wolbachia sp. wRi]
          Length = 533

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/368 (44%), Positives = 231/368 (62%), Gaps = 14/368 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   +I QS +LSG+ G+GKTTTARIIA  LN        P  E  
Sbjct: 15  LVGQDILVRVLENAFILNKIPQSILLSGSSGVGKTTTARIIALCLNCSLG----PIFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C AI   +H DV+E+DAASHTSIDD++ I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 71  GSCENCLAIKNSSHPDVIEIDAASHTSIDDIKVILGDICYSPISSKFKVYIIDEVHMLSS 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP  VKFI ATTEI+KIPIT+++RCQRFDLH I +  ++E    + Q+
Sbjct: 131 SAFNALLKTLEEPPSSVKFILATTEIKKIPITIIARCQRFDLHNIPVAKIVERLNDVAQK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND-KIVTSSVRLMLALADRNRIMDL 239
           ES   +  A+ +IAR S  S R+ L L++QA+    D  I T +V  +L L D++ I DL
Sbjct: 191 ESYSIEKGALELIARHSGNSMRNALFLMNQAVLYSKDGAISTKNVTDILGLVDKDIIFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGV---NPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
            G +++GD    LQ+  S +D  V   NP  I   L +   LV R     E+ + +  +E
Sbjct: 251 LGAILEGD----LQKALSVFDKAVKTANPLSIFEGLLQTIQLVCRFLITKEIDNAV--TE 304

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R    S + S+ F SR W+M+LKGI +I+  +    A EM+LI L +   LPSPE+
Sbjct: 305 HEKNRIKDLSIKRSLIFFSRLWKMLLKGIQDIKTSTCNDVAAEMMLISLCYLSDLPSPEQ 364

Query: 357 IARYIVEE 364
           + + ++ +
Sbjct: 365 VIKKVLSQ 372


>gi|58584691|ref|YP_198264.1| DNA polymerase III, gamma/tau subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419007|gb|AAW71022.1| DNA polymerase III, gamma/tau subunit [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 494

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 156/369 (42%), Positives = 226/369 (61%), Gaps = 8/369 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   RI QS +LSG  G+GKTTTARIIA  LN        PT E  
Sbjct: 15  LVGQDILVRILENAFTLNRIPQSILLSGASGVGKTTTARIIALCLNCSLG----PTFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C  I   +H DV+E+DAASHTS+DD++ I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 71  GSCKNCLTIKNSSHPDVIEIDAASHTSVDDIKVILGDICYSPISSKFKVYIIDEVHMLSS 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPPP VKFI ATTEI+KIPIT+++RCQRFDL+ I +  ++E    I Q 
Sbjct: 131 SAFNALLKTLEEPPPSVKFILATTEIKKIPITIIARCQRFDLYNIPVAKIVERLNDIAQR 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIV-TSSVRLMLALADRNRIMDL 239
           ES   + EA  +IAR S  S R+ L L++QA+      ++ T SV  +L L D++ I DL
Sbjct: 191 ESYFIEKEASELIARHSGNSMRNALFLMNQAVLYNKGGVISTKSVMDILGLVDKDIIFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              ++  D+   L  F    ++  NP  I   L +   L+ R     E+  ++  +E E 
Sbjct: 251 MEAILGSDLQKALSLFDKAVETA-NPLSIFEGLLQTIQLICRFLVTKEIDSSV--TECEK 307

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R      + S+ F SR W+M+LKG+ +I+  +    A EM+LI L +   LPSPE++ +
Sbjct: 308 NRIKDLGVKKSLIFFSRLWRMLLKGVQDIKASTCSDVAAEMILISLCYLSDLPSPEQVVK 367

Query: 360 YIVEEKKKK 368
            ++ +  ++
Sbjct: 368 KVLAQSTQQ 376


>gi|24475504|dbj|BAC22717.1| dnaX [Wolbachia endosymbiont of Callosobruchus chinensis]
          Length = 516

 Score =  295 bits (755), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 162/372 (43%), Positives = 231/372 (62%), Gaps = 14/372 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   +I QS +LSG+ G+GKTTTARIIA  LN        P  E  
Sbjct: 37  LVGQDILVRVLENAFILNKIPQSILLSGSSGVGKTTTARIIALCLNCSLG----PIFEPC 92

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C AI   +H DV+E+DAASHTSIDDV+ I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 93  GSCENCLAIKNSSHPDVIEIDAASHTSIDDVKVILGDICYSPISSKFKVYIIDEVHMLSS 152

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP  VKFI A  EI+KIPIT+++RCQRFDLH I +  ++E    + Q+
Sbjct: 153 SAFNALLKTLEEPPSSVKFILAPPEIKKIPITIIARCQRFDLHNIPVAKIVERLNDVAQK 212

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND-KIVTSSVRLMLALADRNRIMDL 239
           ES   +  A+ +IAR S  S R+ L L++QA+    D  I T +V  +L L D++ I DL
Sbjct: 213 ESYSIEKGALELIARHSGNSMRNALFLMNQAVLYSKDGAISTKNVIDILGLVDKDIIFDL 272

Query: 240 FGYLIKGDIINVLQEFSSQYDSGV---NPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
            G +++GD    LQ+  S +D  +   NP  I   L +   LV R     E+ + +  +E
Sbjct: 273 LGAILEGD----LQKALSVFDKAIKTANPLSIFEGLLQTIQLVCRFLITKEIDNAV--TE 326

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
            E  R    S + S+ F SR W+++LKGI +I+  +    A EM+LI L +   LPSPE+
Sbjct: 327 YEKNRIKDLSIKKSLIFFSRLWKVLLKGIQDIKTSTCNDVAAEMMLISLCYLSDLPSPEQ 386

Query: 357 IARYIVEEKKKK 368
           + + I+ +  ++
Sbjct: 387 VVKKILSQNAQQ 398


>gi|87199378|ref|YP_496635.1| DNA polymerase III subunits gamma and tau [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135059|gb|ABD25801.1| DNA polymerase III, subunits gamma and tau [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 573

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 162/372 (43%), Positives = 237/372 (63%), Gaps = 11/372 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNY-KTAHIDVPTVEF 59
           +IGQ  M++TL NA K  R+A +++++G RG+GKT+TAR+IA++LN         PT++ 
Sbjct: 41  LIGQDAMVQTLANAIKRDRLAHAFLMTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDP 100

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
            G  E C+AI  G H+DV+E+DAAS+T +DDVREII+ + Y  +SAR+++YI+DEV MLS
Sbjct: 101 CGVCEPCRAIAEGRHIDVIEMDAASNTGVDDVREIIEAVRYAAVSARYKIYIVDEVHMLS 160

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
             AFN LLKTLEEPP HVKF+FATTE+ K+P+TVLSRCQRFDL RI    L   F  I +
Sbjct: 161 RNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRCQRFDLKRIPAPLLASHFAMICE 220

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN--------DKIVTSSVRLMLALA 231
           +E +E + EA+AM+A A++GS RDGLS+LDQAI+  +         ++    VR ML LA
Sbjct: 221 KEGVEAEAEALAMVAAAAEGSVRDGLSILDQAISHADLVGSDDGKTRVTAEQVRQMLGLA 280

Query: 232 DRNRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADT 291
           D+     L   ++ G+   VL+E + QY  G+ P  ++    +  H VT +  I  +   
Sbjct: 281 DKTMQRRLLDAVLSGNGSAVLEEVAQQYALGIEPVAMMRAQMDVVHRVT-VAQIGGVGPD 339

Query: 292 LLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQL 351
           +  +E   A    ++K +S   L R WQ++LKG  E++    P+ A +M L+R+ HA ++
Sbjct: 340 VRSTEEREALE-GWAKAISAGQLHRLWQLLLKGYEEVKTAPDPLVAAQMALLRVMHAAEM 398

Query: 352 PSPEEIARYIVE 363
           P P  + R + E
Sbjct: 399 PDPGGLVRKLEE 410


>gi|190571334|ref|YP_001975692.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|213018730|ref|ZP_03334538.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
 gi|190357606|emb|CAQ55047.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|212995681|gb|EEB56321.1| DNA polymerase III, gamma and tau subunits [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
          Length = 527

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 222/366 (60%), Gaps = 11/366 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF   +I QS +LSG+ GIGKTTTARIIA  LN        PT E  
Sbjct: 15  LVGQDILVRILENAFTLNKIPQSILLSGSSGIGKTTTARIIALCLNCSLG----PTFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C AI   +H DVVE+DAASHTS++DVR I+  I Y PIS++F+VYI+DEV MLS+
Sbjct: 71  GSCTSCLAIKNSSHPDVVEIDAASHTSVEDVRAILGDICYLPISSKFKVYIIDEVHMLSS 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP  VKFI ATTEI+KIPITV++RCQRFDLH I    ++E    I Q+
Sbjct: 131 NAFNALLKTLEEPPSSVKFILATTEIKKIPITVIARCQRFDLHNIPSAKIMERLNDIAQK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND-KIVTSSVRLMLALADRNRIMDL 239
           E+   + EA  +IA     S R+ L L++QA+    D  I T SV  +L L DRN I DL
Sbjct: 191 ENYFIEKEASELIAHHCSNSMRNALFLMNQALLYSKDGTISTQSVTDILGLVDRNVIFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              ++  D+   L  F +   +  NP  I  DL +   L+ R     E+ DT    E E 
Sbjct: 251 LEAVLDSDLQKALLVFDNVVKTA-NPLNIFEDLLQTIQLICRFLITKEI-DT----EYEK 304

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
           +R    S + S+ F SR W+++LKGI +I+  +    A EM+LI L +   LPSPE++ +
Sbjct: 305 SRVKDLSAKKSLIFFSRLWKVLLKGIQDIKISTCNEVAAEMMLISLCYLSDLPSPEQVIK 364

Query: 360 YIVEEK 365
            I+ + 
Sbjct: 365 KILSQN 370


>gi|321472924|gb|EFX83893.1| hypothetical protein DAPPUDRAFT_315316 [Daphnia pulex]
          Length = 556

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/374 (40%), Positives = 229/374 (61%), Gaps = 9/374 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ ++ A K  R+   ++ SG RGIGKTTTAR++A  LN          +E  
Sbjct: 41  VVGQNILVRLISQALKRDRLGHGFLFSGMRGIGKTTTARLLACYLNCLNLRQTEGEIEPC 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+A     H+D++E+DAASHT +DD+REI++   Y+P+  R++V+I+DEV MLS 
Sbjct: 101 GVCDSCRAFEAEKHIDIIEMDAASHTGVDDIREILEACRYRPVLGRYKVFIIDEVHMLSK 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFIFATTEI+K+  TV+SRC RFDL R+    L+     I  +
Sbjct: 161 NAFNALLKTLEEPPEHVKFIFATTEIQKVLPTVVSRCLRFDLKRLDPAVLVPYLQDICTK 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAI------ARCNDKIVTSSVRLMLALADRN 234
           E+I+ DPEA+ ++A+A  GSARD LSLLDQAI      ++ N  I    V  ML L DR 
Sbjct: 221 ETIKADPEALLLLAQAGGGSARDSLSLLDQAILLAEQQSQENPCIQAQDVGQMLGLLDRK 280

Query: 235 RIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
               LF  +++GD    ++   S    G++P  ++ +L+ F H ++ +K    + + LL 
Sbjct: 281 AFHTLFEAILQGDAKASVETAQSLEGEGIDPLRVMEELSTFVHHLSCLKV--GVKEGLLG 338

Query: 295 SEAENARALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
              E    L++ +++  +  L R WQM+LKG  E+E  + P  A EMVL+RLA+   LP+
Sbjct: 339 MSVEEKNFLEHKAQQAELPTLGRLWQMLLKGREEVERAAFPQRAFEMVLVRLAYVTTLPT 398

Query: 354 PEEIARYIVEEKKK 367
           P+++ +     KK+
Sbjct: 399 PDQLLKGAASPKKE 412


>gi|297182623|gb|ADI18781.1| DNA polymerase III, gamma/tau subunits [uncultured SAR11 cluster
           bacterium HF4000_37C10]
          Length = 547

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 150/362 (41%), Positives = 225/362 (62%), Gaps = 8/362 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  M++TL N+ KS RIAQ++ML+G RG GKT+TARII++SL      ++    E  
Sbjct: 13  LIGQDVMVETLVNSIKSNRIAQAFMLTGERGTGKTSTARIISKSLTCTGNFLEGVKCET- 71

Query: 61  GFGE--HCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             GE  HC+ I    H+DV E DAAS T +DDVR+IID   YKP +A++++YI+DE  ML
Sbjct: 72  --GEICHCEEITNDKHLDVTECDAASRTGVDDVRQIIDAARYKPTTAKYKIYIIDECHML 129

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S +A+N LLKTLEEPP  +KFIF TTE +KIP+T+ SRCQ F LHR SI  L +   KI 
Sbjct: 130 SRSAWNALLKTLEEPPDQLKFIFCTTEPKKIPLTIASRCQTFHLHRASIKVLFDHLKKIS 189

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIAR---CNDKIVTSSVRLMLALADRNR 235
           + E+ +    A+ +IA+AS GS RD +SLLD+A+        ++  ++VR ML +ADR++
Sbjct: 190 RIENGKISDSAIKLIAKASTGSVRDAISLLDRALVNQHVSEKEVDEATVRKMLGVADRSK 249

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           I++L  ++  GD    ++      D G++ + + +D+ E  + + + K + +    L  S
Sbjct: 250 ILELLKFIFDGDQKQSIESLKQMIDEGLDAASLKNDILELLYFILQKKNLGDFDSDLTIS 309

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E+E       SK+V    L  FWQ  LK + E +  + P+  +EM++IRL H   +P+ E
Sbjct: 310 ESELEMIDVISKDVRTETLILFWQFTLKALDEDKILTNPLLGLEMLVIRLLHLKGMPTYE 369

Query: 356 EI 357
           ++
Sbjct: 370 DL 371


>gi|167041262|gb|ABZ06018.1| putative ATPase family associated with various cellular activities
           (AAA) [uncultured marine microorganism HF4000_005D21]
 gi|167045767|gb|ABZ10413.1| putative ATPase family associated with various cellular activities
           (AAA) [uncultured marine bacterium HF4000_APKG3108]
          Length = 555

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/362 (40%), Positives = 224/362 (61%), Gaps = 8/362 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  M++TL N+ KS RIAQ++ML+G RG GKT+TARII++SL      ++    +  
Sbjct: 21  LIGQDIMVETLVNSIKSNRIAQAFMLTGERGTGKTSTARIISKSLTCTGNFLEGVKCKT- 79

Query: 61  GFGE--HCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             GE  HC+ I    H+DV E DAAS T +DDVR+IID   YKP +A++++YI+DE  ML
Sbjct: 80  --GEICHCEEITNDKHLDVTECDAASRTGVDDVRQIIDAARYKPTTAKYKIYIIDECHML 137

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S +A+N LLKTLEEPP  +KFIF TTE +KIP+T+ SRCQ F LHR SI  L +   KI 
Sbjct: 138 SRSAWNALLKTLEEPPNQLKFIFCTTEPKKIPLTIASRCQTFHLHRASIKVLFDHLKKIS 197

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIAR---CNDKIVTSSVRLMLALADRNR 235
           + E  +    A+ +IA+AS GS RD +SLLD+A+        ++  +++R ML +ADR++
Sbjct: 198 KIEEGKISDSAIKLIAKASTGSVRDAISLLDRALINQHVSEKEVDEATMRKMLGVADRSK 257

Query: 236 IMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYS 295
           I++L  ++  GD    ++      D G++ + + +D+ E  + + + K + +    L  S
Sbjct: 258 ILELLKFIFDGDQKQSIESLKQMIDEGLDAASLKNDILELLYFILQKKNLGDFESDLTIS 317

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
           E+E       SK+V    L  FWQ  LK + E +  + P+  +EM++IRL H   +P+ E
Sbjct: 318 ESELEMIDVISKDVRTETLILFWQFTLKALDEDKILTNPLLGLEMLVIRLLHLKGMPTYE 377

Query: 356 EI 357
           ++
Sbjct: 378 DL 379


>gi|117925035|ref|YP_865652.1| DNA polymerase III subunits gamma/tau [Magnetococcus sp. MC-1]
 gi|117608791|gb|ABK44246.1| DNA polymerase III, gamma subunit [Magnetococcus sp. MC-1]
          Length = 605

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 146/352 (41%), Positives = 219/352 (62%), Gaps = 6/352 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+  ++ L +A + GRI  +++ +G RGIGKTT +R++A  LN  T     P     
Sbjct: 22  LIGQEHTVQALRHALEQGRIPHAFLFTGIRGIGKTTLSRLLAMCLNCGTGVTANPC---- 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+AI+RG H DV E+DAAS T ++ +RE++D + Y P  +R+++YI+DEV MLS 
Sbjct: 78  GACDSCRAIVRGEHPDVFEVDAASRTKVEQMRELLDGVAYTPSLSRYKIYILDEVHMLSA 137

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKFIFATTE+RKI  T+LSRCQR+DL R+    L      +L  
Sbjct: 138 SSFNALLKTLEEPPTHVKFIFATTEVRKILPTILSRCQRYDLRRLDRDGLARYLAHVLDV 197

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I +D E +A I+ A+DGS RD LSLLDQAIA    ++  + V  +L L DR  ++ LF
Sbjct: 198 EQIAYDQEGLAAISHAADGSVRDALSLLDQAIAHGGGRVDYTHVSGLLGLTDRQAVVALF 257

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G ++ +L+  +  +  GV P V+L+DL + TH VTR   +         SE E  
Sbjct: 258 ADLCRGRLLEMLERAAYFHRDGVEPVVLLNDLLDITHQVTRELAVGVGDAAQALSEHEGL 317

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
           +  +   ++ +  L   +Q++L+G  +++    P +A+EM+L+R AH   +P
Sbjct: 318 K--EVWPKLGLEHLQMLYQVLLRGREDLQMARLPRQALEMLLLRAAHLRPVP 367


>gi|157826506|ref|YP_001495570.1| DNA polymerase III subunits gamma and tau [Rickettsia bellii OSU
           85-389]
 gi|157801810|gb|ABV78533.1| DNA polymerase III subunits gamma and tau [Rickettsia bellii OSU
           85-389]
          Length = 508

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/375 (39%), Positives = 232/375 (61%), Gaps = 11/375 (2%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +   ++    
Sbjct: 27  GQEVLVKVLSYTILNNRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITEDNNIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  +++++I+DEV MLS  A
Sbjct: 87  CVNCVSFNNHNHSDIIEIDAASKTSVDDIRRIIESAEYKPLQGKYKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I++EE+
Sbjct: 147 FNALLKTLEEPPPHVIFIFATTEVQKIPATIISRCQRYDLKRLSFEEIFKLLEYIVKEEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           ++ D EA+ +IA  SDGSARD +S+LDQA    A+ +  I   ++  ML L D N I++ 
Sbjct: 207 LKTDIEALRVIAYKSDGSARDAVSILDQAASLSAKSDSMITRQAINQMLGLVDNNVILEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             Y++  DI N +   +  Y S VN  + +  ++EF   + ++K +P  +  L   E+ N
Sbjct: 267 SEYIVNRDIANSISLINKLYSSSVNLEIFIESVSEFIAYLNKVKMLPSYSMPLY--ESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP---SPE- 355
            R      ++S   LS  WQ+  KGI+EI+     +   EM++I+  ++  LP   SP  
Sbjct: 325 DRIKNILSKISFPHLSILWQIYSKGIAEIKISYNQLIETEMLIIKSIYSASLPLDDSPSD 384

Query: 356 --EIARYIVEEKKKK 368
             ++ +   EE KKK
Sbjct: 385 NRDLKQPSTEEIKKK 399


>gi|91204862|ref|YP_537217.1| DNA polymerase III subunits gamma and tau [Rickettsia bellii
           RML369-C]
 gi|91068406|gb|ABE04128.1| DNA polymerase III gamma and tau chains [Rickettsia bellii
           RML369-C]
          Length = 508

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 148/375 (39%), Positives = 232/375 (61%), Gaps = 11/375 (2%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +   ++    
Sbjct: 27  GQEVLVKVLSYTILNNRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITEDNNIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  +++++I+DEV MLS  A
Sbjct: 87  CVNCVSFNNHNHSDIIEIDAASKTSVDDIRRIIESAEYKPLQGKYKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I++EE+
Sbjct: 147 FNALLKTLEEPPPHVIFIFATTEVQKIPATIISRCQRYDLKRLSFEEIFKLLEYIVKEEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           ++ D EA+ +IA  SDGSARD +S+LDQA    A+ +  I   ++  ML L D N I++ 
Sbjct: 207 LKTDIEALRVIAYKSDGSARDAVSILDQAASLSAKSDSMITRQAINQMLGLVDNNVILEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             Y++  DI N +   +  Y S VN  + +  ++EF   + ++K +P  +  L   E+ N
Sbjct: 267 SEYIVNRDIANSISLINKLYSSSVNLEIFIESVSEFIAYLNKVKMLPSYSMPLY--ESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP---SPE- 355
            R      ++S   LS  WQ+  KG++EI+     +   EM++I+  ++  LP   SP  
Sbjct: 325 DRIKNILSKISFPHLSILWQIYSKGVAEIKISYNQLIETEMLIIKSIYSASLPLDDSPSD 384

Query: 356 --EIARYIVEEKKKK 368
             ++ +   EE KKK
Sbjct: 385 NRDLKQPSTEEIKKK 399


>gi|111035803|emb|CAL29430.1| DNA polymerase III tau subunit [Wolbachia endosymbiont of
           Onchocerca volvulus]
          Length = 494

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 220/369 (59%), Gaps = 8/369 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  +++ L NAF   +I QS +LSG+ G+GKTTTARIIA  LN        PT E  
Sbjct: 15  LIGQDVLVRILKNAFTLNKIPQSILLSGSSGVGKTTTARIIALCLNCSLG----PTFEPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C AI   NH DV+E+DAASHTSI+D++ I++ I Y PIS++F++YI+DEV MLS 
Sbjct: 71  GLCENCLAIKNSNHSDVIEIDAASHTSIEDIKVILENICYLPISSKFKIYIIDEVHMLSG 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP  VKFI ATTEI+K+PIT+++RCQRFDL++I    ++     I Q+
Sbjct: 131 SAFNALLKTLEEPPSSVKFILATTEIKKMPITIIARCQRFDLYKIPATKIVGRLNDIAQK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC-NDKIVTSSVRLMLALADRNRIMDL 239
           E+   +  A+ +IA     S R+ L L++QA+    N  I T  V  +L L D   + DL
Sbjct: 191 ENYLIENRALELIAHHCSNSMRNALFLMNQAMLYSKNGPISTEDVTEILGLVDEGIVFDL 250

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              ++  D+   L  F     +  NP  I  +L +   L+ R     E+  +LL  E   
Sbjct: 251 MEAVLDSDLRKALLVFDKAAKTA-NPLSIFENLLQTIQLICRFLITKEVDSSLL--EHGK 307

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
            R    S   S+ F SR W+++LKGI  I+  S    A EM+LI L +   LPSPE++ +
Sbjct: 308 DRIKDLSARKSLIFFSRLWKVLLKGIQAIKVSSCNDIAAEMMLISLCYLSDLPSPEQVIK 367

Query: 360 YIVEEKKKK 368
            I+ +  ++
Sbjct: 368 KILAQNTRQ 376


>gi|58617668|ref|YP_196867.1| DNA polymerase III gamma and tau chains [Ehrlichia ruminantium str.
           Gardel]
 gi|58417280|emb|CAI28393.1| DNA polymerase III gamma and tau chains [Ehrlichia ruminantium str.
           Gardel]
          Length = 500

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 225/357 (63%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  +++ L NAF   ++ QS +L+G  GIGKTT ARII+  LN  +     PT    
Sbjct: 28  LIGQDVLVRILRNAFHLNKVPQSILLTGGSGIGKTTAARIISMCLNCASG----PTSNPC 83

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               +C +I   NH DV+E+DAAS+TSI+DV+ I++  +Y PI+++F+VYI+DEV MLS 
Sbjct: 84  NTCINCISIKNFNHPDVIEIDAASNTSIEDVKIILENSHYVPITSKFKVYIIDEVHMLSN 143

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP P+VKFI ATTE++KIP+T++SRCQRFDL RI   ++++    I +E
Sbjct: 144 SAFNALLKVLEEPAPYVKFILATTEVKKIPVTIISRCQRFDLQRIPTENIVDHLRIIAKE 203

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I FD E++ +IA  SDGS R+ LSLL+Q+    N  +   S + ML   +R+ ++ + 
Sbjct: 204 ENILFDEESIKLIAYNSDGSMRNALSLLEQSAIYSNKNLSEESTKKMLGYVNRHVLLKII 263

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +  G+I   L +F    ++  +P ++L ++ +   ++  I Y           +++  
Sbjct: 264 ESITNGNITEALNKFEEVCNT-YSPVIVLDNILQ---MIYEICYFSITKKNDFLPDSDII 319

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            ++Q +K  S TFLSR WQ++ KGI E++  +   +A  M++IRL +   LPSP++I
Sbjct: 320 TSIQNNKIQSPTFLSRLWQILSKGIQEVKSSACVKQAANMLIIRLCYLSDLPSPKQI 376


>gi|91762357|ref|ZP_01264322.1| DNA-directed DNA polymerase gamma/tau subunit [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718159|gb|EAS84809.1| DNA-directed DNA polymerase  gamma/tau subunit [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 557

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 221/349 (63%), Gaps = 5/349 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  + +T++N+ K+ ++  +Y+ +G RGIGKTTTARI+A+SLN       +  +  E
Sbjct: 20  LIGQDVVAETISNSIKANKVPNAYLFTGIRGIGKTTTARIVAKSLNCSNG---IDNLCKE 76

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              E+C AI   NH+DV+E+DAAS T +DDVR++I+   Y P +A+++++I+DEV MLS 
Sbjct: 77  ELCENCNAISNSNHIDVLEMDAASKTGVDDVRDLIEFSRYGPTTAKYKIFIIDEVHMLSK 136

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP ++KFIFATTEI+KIPITV+SRCQRFDL RI   +L +   KI ++
Sbjct: 137 QAFNALLKTLEEPPEYLKFIFATTEIKKIPITVVSRCQRFDLSRIKSLELFDFIKKIKEK 196

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DK-IVTSSVRLMLALADRNRIMD 238
           E+     +A+ +I + S+GS RD LSLLD+A+   + DK +  ++ + +    D+++++D
Sbjct: 197 ENGNASDDALKLIVKISEGSVRDALSLLDRALLTLDKDKELDLAAAQKIFGYFDKSQLID 256

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  + +G    VL  +   Y+ GV P + ++D  E  +    I  +    +  L ++ E
Sbjct: 257 LFELIFEGKETEVLNTYREIYNQGVEPKIFINDFLELLYYFKNIDSLNLDGNNFLLNDEE 316

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
             +    S++V+   L  FWQ  +K + E++  S    ++EM LIRL H
Sbjct: 317 FNKIKDLSEKVNNETLILFWQFTIKTLEELDIVSNQHLSMEMFLIRLIH 365


>gi|88657800|ref|YP_506849.1| DNA polymerase III, subunits gamma and tau [Ehrlichia chaffeensis
           str. Arkansas]
 gi|88599257|gb|ABD44726.1| DNA polymerase III, subunits gamma and tau [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 505

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 223/357 (62%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ +++ L NAF   +I +S +L+G  G+GKTT ARII+  LN     I  PT +  
Sbjct: 28  LIGQEVLVRVLHNAFHLNKIPESILLTGISGVGKTTAARIISMCLNC----ISGPTSDPC 83

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              ++C +I   NH DV+E+DAAS+TSI+DV+ I++   Y PIS++F+VYI+DEV MLS 
Sbjct: 84  NTCQNCISIKNFNHPDVIEIDAASNTSIEDVKVILENSRYMPISSKFKVYIIDEVHMLSN 143

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP P+VKFI ATTE++KIP+T++SRCQRFD  RIS   L++    + ++
Sbjct: 144 SAFNALLKVLEEPAPYVKFILATTEVKKIPVTIISRCQRFDFQRISTDKLVDHLKVVAKK 203

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ FD E++ +IA  +DGS R+ LSLL+QA    N  +  +  + ML    R+ ++++ 
Sbjct: 204 ENVSFDEESIKLIAYNADGSIRNALSLLEQAAIYSNKILSENITKEMLGYVSRHTLLEII 263

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI G+    L +F    +S  N  +IL ++ +   ++  I Y          S+    
Sbjct: 264 EPLIIGNATEALNKFEEACNS-YNSVIILDNMLQ---IIYEICYFSITKKDNSTSDNSII 319

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
             ++  K +S TFLSR WQM+ KGI E++  S   +A  M++IRL +   LPSP++I
Sbjct: 320 TYIKNEKILSPTFLSRLWQMLFKGIQEVKSSSCIKQAANMLIIRLCYLSSLPSPKQI 376


>gi|68171405|ref|ZP_00544797.1| DNA-directed DNA polymerase [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999172|gb|EAM85830.1| DNA-directed DNA polymerase [Ehrlichia chaffeensis str. Sapulpa]
          Length = 492

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 223/357 (62%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ +++ L NAF   +I +S +L+G  G+GKTT ARII+  LN     I  PT +  
Sbjct: 15  LIGQEVLVRVLHNAFHLNKIPESILLTGISGVGKTTAARIISMCLNC----ISGPTSDPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              ++C +I   NH DV+E+DAAS+TSI+DV+ I++   Y PIS++F+VYI+DEV MLS 
Sbjct: 71  NTCQNCISIKNFNHPDVIEIDAASNTSIEDVKVILENSRYMPISSKFKVYIIDEVHMLSN 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP P+VKFI ATTE++KIP+T++SRCQRFD  RIS   L++    + ++
Sbjct: 131 SAFNALLKVLEEPAPYVKFILATTEVKKIPVTIISRCQRFDFQRISTDKLVDHLKVVAKK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ FD E++ +IA  +DGS R+ LSLL+QA    N  +  +  + ML    R+ ++++ 
Sbjct: 191 ENVSFDEESIKLIAYNADGSIRNALSLLEQAAIYSNKILSENITKEMLGYVSRHTLLEII 250

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI G+    L +F    +S  N  +IL ++ +   ++  I Y          S+    
Sbjct: 251 EPLIIGNATEALNKFEEACNS-YNSVIILDNMLQ---IIYEICYFSITKKDNSTSDNSII 306

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
             ++  K +S TFLSR WQM+ KGI E++  S   +A  M++IRL +   LPSP++I
Sbjct: 307 TYIKNEKILSPTFLSRLWQMLFKGIQEVKSSSCIKQAANMLIIRLCYLSSLPSPKQI 363


>gi|73667555|ref|YP_303571.1| DNA-directed DNA polymerase [Ehrlichia canis str. Jake]
 gi|72394696|gb|AAZ68973.1| DNA-directed DNA polymerase [Ehrlichia canis str. Jake]
          Length = 491

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 147/357 (41%), Positives = 226/357 (63%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ +++ L NAF   +I +S +L+GT G+GKTT ARII+  LN        PT +  
Sbjct: 15  LIGQEVLVRVLHNAFHLDKIPESILLTGTSGVGKTTAARIISMCLNCAFG----PTSDPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              ++C +I   NH DV+E+DAAS+TSI+DV+ I++   Y PIS++F+VYI+DEV MLS 
Sbjct: 71  NTCQNCISIKNFNHPDVIEIDAASNTSIEDVKVILENSRYMPISSKFKVYIIDEVHMLSN 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP  +VKFI ATTE++KIP+T++SRCQRFD  +IS   LI+    I ++
Sbjct: 131 SAFNALLKVLEEPAHYVKFILATTEVKKIPVTIISRCQRFDFQKISTDKLIKHLKAISEK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  D E++ +IA  +DGS R+ LS+L+QA    N  +   S + ML    R+ ++++ 
Sbjct: 191 ENITSDEESIKLIADNADGSIRNALSILEQAAIYSNKVLSEKSTKEMLGYVSRHTLLEII 250

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G+ +  L++F    +S  +P +IL ++ +  + +     I +  D+L  S+    
Sbjct: 251 EPLVTGNTLEALKKFEESCNS-YSPVIILDNMLQIIYEICYFS-ITKNNDSL--SDNNVI 306

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
             ++  K +S TFLSR WQM+ KGI E++  S    A  M++IRL +   LPSP++I
Sbjct: 307 THIKNDKILSTTFLSRLWQMLFKGIQEVKLSSCTKHAANMLIIRLCYLSPLPSPKQI 363


>gi|71083213|ref|YP_265932.1| DNA-directed DNA polymerase subunit gamma/tau [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062326|gb|AAZ21329.1| DNA-directed DNA polymerase gamma/tau subunit [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 557

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 221/349 (63%), Gaps = 5/349 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  + +T++N+ K+ ++  +Y+ +G RGIGKTTTARI+A+SLN       +  +  E
Sbjct: 20  LIGQDVVAETISNSIKANKVPNAYLFTGIRGIGKTTTARIVAKSLNCSNG---IDNLCKE 76

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              E+C AI   NH+DV+E+DAAS T +DDVR++I+   Y P +A+++++I+DEV MLS 
Sbjct: 77  ELCENCNAISNSNHIDVLEMDAASKTGVDDVRDLIEFSRYGPTTAKYKIFIIDEVHMLSK 136

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP ++KFIFATTEI+KIPITV+SRCQRFDL RI   +L +   KI ++
Sbjct: 137 QAFNALLKTLEEPPEYLKFIFATTEIKKIPITVVSRCQRFDLSRIKSLELFDFIRKIKEK 196

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN-DK-IVTSSVRLMLALADRNRIMD 238
           E+     +A+ +I + S+GS RD LSLLD+A+   + DK +  ++ + +    D+++++D
Sbjct: 197 ENGNASDDALKLIVKISEGSVRDALSLLDRALLTLDKDKELDLAAAQKIFGYFDKSQLID 256

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  + +G    VL  +   Y+ GV P + ++D  E  +    I  +    +  L ++ E
Sbjct: 257 LFELIFEGKETEVLNTYREIYNQGVEPKIFINDFLELLYYFKNIDSLNLDGNNFLLNDEE 316

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
             +    S++V+   L  FWQ  +K + E++  S    ++EM LIRL H
Sbjct: 317 FNKIKDLSEKVNNETLILFWQFTIKTLEELDIVSNQHLSMEMFLIRLIH 365


>gi|254456249|ref|ZP_05069678.1| DNA-directed DNA polymerase gamma/tau subunit [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083251|gb|EDZ60677.1| DNA-directed DNA polymerase gamma/tau subunit [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 556

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 220/349 (63%), Gaps = 5/349 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + +T+TN+ K+ +I  +Y+ +G RGIGKTTTARI+A+ LN       +  +  +
Sbjct: 20  LIGQEVVAETITNSIKADKIPNAYLFTGIRGIGKTTTARIVAKGLNCSKG---IENLCKK 76

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              E+C++I   +H+DV+E+DAAS T +DDVR++I+   Y P SA+++++I+DEV MLS 
Sbjct: 77  DLCENCKSIADASHIDVLEMDAASKTGVDDVRDLIEFSRYGPTSAKYKIFIIDEVHMLSK 136

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP ++KFIFATTEI+KIPITV+SRCQRFDL RI   +L E   KI  +
Sbjct: 137 QAFNALLKTLEEPPAYLKFIFATTEIKKIPITVVSRCQRFDLSRIKSTELFEFIKKIKDK 196

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSVRLMLALADRNRIMD 238
           E+     EA+ +I + S+GS RD LSLLD+ +     N ++  ++ + +    D++++++
Sbjct: 197 ENGNVSDEALKLIVKISEGSVRDALSLLDRGLLSLEQNTELDLNAAQKIFGYFDKSQLIN 256

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           LF  ++KG+   V+  +   YD GV P V ++D  E  +    I  +   +     ++ E
Sbjct: 257 LFELILKGEEKKVINIYRKIYDQGVEPKVFINDFLEILYYYKNINSLSLESTNFSLNDEE 316

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
            ++  + S +V+   L  FWQ  +  + E++  S    ++EM LIRL H
Sbjct: 317 FSKIKEISNQVNSEILILFWQFAVSSLEELDIVSNQHLSIEMFLIRLMH 365


>gi|57238735|ref|YP_179871.1| DNA polymerase III gamma and tau chains [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57160814|emb|CAH57712.1| putative DNA polymerase III, gamma subunit [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 487

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 222/357 (62%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  +++ L NAF   ++ QS +L+G+ GIGKTT ARII+  LN     I  PT    
Sbjct: 15  LIGQDVLVRILRNAFHLNKVPQSILLTGSSGIGKTTAARIISMCLNC----ISGPTSNPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               +C +I   NH DV+E+DAAS+TSI+DV+ I++  +Y PI+++F+VYI+DEV MLS 
Sbjct: 71  NTCNNCISIKNFNHPDVIEIDAASNTSIEDVKIILENSHYVPITSKFKVYIIDEVHMLSN 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP P+VKFI ATTE++KIP+T++SRCQRFDL RI    ++     I +E
Sbjct: 131 SAFNALLKVLEEPAPYVKFILATTEVKKIPVTIISRCQRFDLQRIPTESIVNHLRIIAKE 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I FD E++ +IA  SDGS R+ LSLL+Q+    N  +   S + ML   +R+ ++ + 
Sbjct: 191 ENILFDEESIKLIAYNSDGSMRNALSLLEQSAIYSNKNLSEESTKKMLGYVNRHVLLKII 250

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +  G+I   L +F  +  +  +P ++L ++ +   ++  I Y           +++  
Sbjct: 251 ESITNGNITEALNKF-EEVCNMYSPVIVLDNILQ---MIYEICYFSITKKNDFLPDSDII 306

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            + Q +K  S  FLSR WQ++ KGI E++  +   +A  M++IRL +   LPSP++I
Sbjct: 307 TSTQNNKIQSPIFLSRLWQILSKGIQEVKSSACVKQAANMLIIRLCYLSDLPSPKQI 363


>gi|67809793|gb|AAY81977.1| DNA polymerase III gamma and tau subunit [Wolbachia pipientis]
          Length = 446

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/337 (44%), Positives = 210/337 (62%), Gaps = 14/337 (4%)

Query: 32  IGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDV 91
           +GKTTTARIIA  LN        P  E  G  E+C AI   +H DV+E+DAASHTSIDD+
Sbjct: 1   VGKTTTARIIALCLNCSLG----PIFEPCGSCENCLAIKNSSHPDVIEIDAASHTSIDDI 56

Query: 92  REIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTEIRKIPI 151
           + I+  I Y PIS++F+VYI+DEV MLS++AFN LLKTLEEPP  VKFI ATTEI+KIPI
Sbjct: 57  KVILGDICYSPISSKFKVYIIDEVHMLSSSAFNALLKTLEEPPSSVKFILATTEIKKIPI 116

Query: 152 TVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQA 211
           T+++RCQRFDLH I +  ++E    + Q+ES   +  A+ +IAR S  S R+ L L++QA
Sbjct: 117 TIIARCQRFDLHNIPVAKIVERLNDVAQKESYSIEKGALELIARHSGNSMRNALFLMNQA 176

Query: 212 IARCND-KIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDSGV---NPSV 267
           +    D  I T +V  +L L D++ I DL G +++GD    LQ+  S +D  V   NP  
Sbjct: 177 VLYSKDGAISTKNVTDILGLVDKDIIFDLLGAILEGD----LQKALSVFDKAVKTANPLS 232

Query: 268 ILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISE 327
           I   L +   LV R     E+ + +  +E E  R    S + S+ F SR W+M+LKGI +
Sbjct: 233 IFEGLLQTIQLVCRFLITKEIDNAV--TEHEKNRIKDLSIKRSLIFFSRLWKMLLKGIQD 290

Query: 328 IEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARYIVEE 364
           I+  +    A EM+LI L +   LPSPE++ + ++ +
Sbjct: 291 IKTSTCNDVAAEMMLISLCYLSDLPSPEQVIKKVLSQ 327


>gi|58579613|ref|YP_197825.1| DNA polymerase III gamma and tau chains [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418239|emb|CAI27443.1| DNA polymerase III gamma and tau chains [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 500

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 218/357 (61%), Gaps = 8/357 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  +++ L NAF   ++ QS +L+G+ GIGKTT ARII+  LN     I  PT    
Sbjct: 28  LIGQDVLVRILRNAFHLNKVPQSILLTGSSGIGKTTAARIISMCLNC----ISGPTSNPC 83

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               +C +I   NH DV+E+DAAS+TSI+DV+ I++  +Y PI+++F+VYI+DEV MLS 
Sbjct: 84  NTCNNCISIKNFNHPDVIEIDAASNTSIEDVKIILENSHYVPITSKFKVYIIDEVHMLSN 143

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEP P+VKFI ATTE++KIP+T++SRCQRFDL RI    ++     I +E
Sbjct: 144 SAFNALLKVLEEPAPYVKFILATTEVKKIPVTIISRCQRFDLQRIPTESIVNHLRIIAKE 203

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I FD  ++ +IA  SDGS R+ LSLL+Q+    N  +   S + ML   +R+ ++ + 
Sbjct: 204 ENILFDEASIKLIAYNSDGSMRNALSLLEQSAIYSNKNLSEESTKKMLGYVNRHVLLKII 263

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +  G+I   L +F  +  +  +P ++   LA    ++  I Y            ++  
Sbjct: 264 ESITNGNITEALNKF-EEVCNMYSPVIV---LANILQMIYEICYFSITKKNDFLPASDII 319

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            + Q +K  S  FLSR WQ++ KGI E++  +   +A  M++IRL +   LPSP++I
Sbjct: 320 TSTQNNKIQSPIFLSRLWQILSKGIQEVKSSACVKQAANMLIIRLCYLSDLPSPKQI 376


>gi|157375987|ref|YP_001474587.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
 gi|157318361|gb|ABV37459.1| DNA-directed DNA polymerase [Shewanella sediminis HAW-EB3]
          Length = 955

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 214/344 (62%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALSQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEKGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCIEISEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  +++ ++ +  T +L +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTLEEIEQQLTHVLSQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+P+A+ ++A++++GS RD LSL DQAIA    +++ + V+ ML   D + ++ L 
Sbjct: 194 EQLSFEPQALKLLAKSANGSMRDALSLTDQAIAFGAGQVMLTQVQTMLGSIDEHHVITLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GDI N++Q  +     G +P  +L  L E  H +T  ++ P  A   +YSE   A
Sbjct: 254 NALIQGDIENLMQVTAKVLSFGADPQEVLRSLLELLHQITLSQFAPAAAQLSIYSEQITA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
               +++++S   +  ++Q++L G  ++     P   +EM L+R
Sbjct: 314 ----FAEQISPEQIQLYYQLLLTGRKDLPHAPDPKSGLEMALLR 353


>gi|170726146|ref|YP_001760172.1| DNA polymerase III subunits gamma and tau [Shewanella woodyi ATCC
           51908]
 gi|169811493|gb|ACA86077.1| DNA polymerase III, subunits gamma and tau [Shewanella woodyi ATCC
           51908]
          Length = 911

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 220/364 (60%), Gaps = 13/364 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GQCSSCVEISEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++I+  + +L +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEIIQQLSHVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+ F+ +A+ ++A+A++GS RD LSL DQAIA    ++    V+ ML   D   ++ LF
Sbjct: 194 ESLVFENQALTLLAKAANGSMRDALSLTDQAIAFGGGEVRLKQVQTMLGSIDERHVITLF 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +GDI +++Q  S     G +P  +L  L E  H +T  ++ P  A   +YSE  +A
Sbjct: 254 NAITQGDIEHLMQVISQVLSFGADPEEVLRSLLELLHQITLSQFAPAAAQLSIYSEQISA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE-EIAR 359
            A+Q S E     +  ++Q++L G  ++     P   +EM L+R    V    PE  + R
Sbjct: 314 FAIQLSPEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLRAVSFV----PEVPVKR 365

Query: 360 YIVE 363
           +IV+
Sbjct: 366 WIVD 369


>gi|254283726|ref|ZP_04958694.1| DNA polymerase III, gamma and tau subunit [gamma proteobacterium
           NOR51-B]
 gi|219679929|gb|EED36278.1| DNA polymerase III, gamma and tau subunit [gamma proteobacterium
           NOR51-B]
          Length = 672

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 134/348 (38%), Positives = 214/348 (61%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN        P     
Sbjct: 101 MVGQQHVLRALVNALDNDRLHHAYLFTGTRGVGKTTVARILAKCLNCDQGVSSTPC---- 156

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C  I  G  VD++E+DAAS T ++D RE+++ + Y P  +RF++Y++DEV MLS 
Sbjct: 157 GTCDSCLEIAEGRSVDLLEVDAASRTKVEDTRELLENVLYAPTRSRFKIYLIDEVHMLSG 216

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPH KF+ ATT+ +K+P TVLSRC +F+L  +   +++    K+L+E
Sbjct: 217 HSFNALLKTLEEPPPHAKFLLATTDPQKLPATVLSRCLQFNLKNMVPEEIVAHLGKVLEE 276

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+ FD  ++A++ARA++GS RD LSL DQAI   +  +  S VR ML   DR R++D+ 
Sbjct: 277 ESVAFDNGSLALLARAAEGSMRDALSLTDQAIGFGDGGLAESDVRAMLGTVDRARVLDVL 336

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             ++  D   ++ V+++ +S     V     L DLA   H VT  +++P+ AD    + +
Sbjct: 337 DAILDNDPKTLLAVIEQIASHAPDYV---ATLDDLASVLHQVTIAQWVPDAADP---TAS 390

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           ++ R  + +   ++  +  F+Q    G  E++    P  A+EMVL+R+
Sbjct: 391 QSERIAKVAASTTVDEVQLFYQFAAAGRPEVQRSPDPRAALEMVLLRM 438


>gi|91793733|ref|YP_563384.1| DNA polymerase III, subunits gamma and tau [Shewanella
           denitrificans OS217]
 gi|91715735|gb|ABE55661.1| DNA polymerase III, subunits gamma and tau [Shewanella
           denitrificans OS217]
          Length = 921

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 220/364 (60%), Gaps = 11/364 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  MVGQSHVLLALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCETGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GTCSSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  +S  ++ +    IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLSQDEISQQLEFILGQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ +A+ ++A+A++GS RD LSL DQAIA  + +++ + V+ ML   D  +++ L 
Sbjct: 194 EQLPFESQALTLLAKAANGSMRDALSLTDQAIAFGSGQVMLTQVQTMLGSIDERQVIGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI +++Q  +     G +   +L  L E  H +T  ++ P  A   LYSE    
Sbjct: 254 KSLCDADIAHLMQTTAQVLSFGADADEVLRSLLELLHQITLSQFAPAAAQHSLYSE---- 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           + L ++K++    +  ++Q++L G  E+     P   +EM L+R   AV     + + R+
Sbjct: 310 QILAFAKQLKPEQVQLYYQILLTGRKELAFAPDPKSGLEMALLR---AVAFVPEKTVNRW 366

Query: 361 IVEE 364
           +V++
Sbjct: 367 VVDD 370


>gi|197116612|ref|YP_002137039.1| DNA polymerase III, gamma/tau subunits [Geobacter bemidjiensis Bem]
 gi|197085972|gb|ACH37243.1| DNA polymerase III, gamma and tau subunits [Geobacter bemidjiensis
           Bem]
          Length = 582

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 213/347 (61%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + +TL NA   GR+A +++ +G RG+GKT++ARI+A++LN ++      TVE  
Sbjct: 18  LVGQEHVSQTLKNAIDGGRVAHAFLFTGARGVGKTSSARILAKALNCESGL----TVEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  GN VDV E+D AS+T +DD+RE+ D I Y P  +R++++I+DEV ML+T
Sbjct: 74  NTCSTCLEITEGNSVDVFEIDGASNTGVDDIRELRDNIKYLPSRSRYKIFIIDEVHMLTT 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  RI++  ++     I+ +
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKVPITILSRCQRFDFKRIALPRIVSRLRYIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++   EA+A++AR  DGS RD LS LDQ +A C +++  + V  +L + DR  IMD  
Sbjct: 194 EGVQVSDEALAVVARKGDGSMRDSLSTLDQVLAFCGNQVADADVAALLGVVDRRLIMDGC 253

Query: 241 GYLIKGDIINVLQEFSSQYDS-GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             ++  ++   LQ   +Q DS G +      +L +    V  +K + E  D L  SEAE 
Sbjct: 254 RAVLSKEVREALQ-IVAQVDSFGYSMRQFCRELIDQFRNVAILKAVGEPGDLLELSEAEL 312

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
                 +   + T L R   ++LK  +E+   S P   +EM ++++A
Sbjct: 313 GELRTLADAATGTDLQRHLTLLLKAEAEMAHASFPRLVLEMTMMKMA 359


>gi|153872370|ref|ZP_02001285.1| DNA polymerase III [Beggiatoa sp. PS]
 gi|152071164|gb|EDN68715.1| DNA polymerase III [Beggiatoa sp. PS]
          Length = 529

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 213/345 (61%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  +++ LTNA ++ R+  +Y+ +GTRG+GKTT ARI+A+SLN  T     P     
Sbjct: 18  MVGQAHVLRALTNALENNRLHHAYLFTGTRGVGKTTIARILAKSLNCDTGITAYPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D R+++D + Y P   R++VY++DEV MLST
Sbjct: 74  GQCSACREIDEGRFVDLIEVDAASRTKVEDTRDLLDNVQYAPTRGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P T+LSRC +F+L R+ +  + +  TKI++E
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPPTILSRCLQFNLKRLPLEQITQHLTKIIEE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++  A+ ++A+A+DGS RD LSLLDQAIA    K+ +  V  ML   D+NR+++L 
Sbjct: 194 EDINYELPALRLLAQAADGSLRDALSLLDQAIAFGAGKLSSDDVSSMLGTLDQNRVLELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L + +       +  ++L D+  F   +   +++P   D    ++ ++ 
Sbjct: 254 NLLAANDAAGLLAQIAQLAAQNPDFFILLGDILSFMQRIALAQFVPATVDA---NQPDSE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             LQ S+ +S   +  F+Q+ L G  ++     P    EMVL+R+
Sbjct: 311 AILQLSQTLSPEDVQLFYQIGLLGRRDLPLAPEPRGGFEMVLLRM 355


>gi|253698849|ref|YP_003020038.1| DNA polymerase III subunits gamma/tau [Geobacter sp. M21]
 gi|251773699|gb|ACT16280.1| DNA polymerase III, subunits gamma and tau [Geobacter sp. M21]
          Length = 579

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 211/347 (60%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + +TL NA   GR+A +++ +G RG+GKT++ARI+A++LN ++      TVE  
Sbjct: 18  LVGQEHVSQTLKNAIDGGRVAHAFLFTGARGVGKTSSARILAKALNCESGL----TVEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  GN VDV E+D AS+T +DD+RE+ D I Y P  +R++++I+DEV ML+T
Sbjct: 74  NTCSTCLEITEGNSVDVFEIDGASNTGVDDIRELRDNIKYLPSRSRYKIFIIDEVHMLTT 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  RI++  ++     I+ +
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKVPITILSRCQRFDFKRIALPRIVSRLRYIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++   EA+A++AR  DGS RD LS LDQ +A C +++  + V  +L + DR  IMD  
Sbjct: 194 EGVQVSDEALAVVARKGDGSMRDSLSTLDQVLAFCGNQVADADVAALLGVVDRRLIMDGC 253

Query: 241 GYLIKGDIINVLQEFSSQYDS-GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             ++  ++   LQ   +Q DS G +      +L +    V  +K I E  D L  SEAE 
Sbjct: 254 RAVLSKEVRCALQ-IVAQVDSFGYSMRQFCRELIDQFRNVAILKAIGEPGDLLELSEAEL 312

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
                 +   S   L R   ++LK   E+   S P   +EM ++R+A
Sbjct: 313 GELRTLADCASGPDLQRHLTLLLKAEGEMAHASFPRLVLEMTMMRMA 359


>gi|297182771|gb|ADI18925.1| DNA polymerase III, gamma/tau subunits [uncultured SAR11 cluster
           bacterium HF0010_09O16]
          Length = 557

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 221/362 (61%), Gaps = 10/362 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + +T+ N+ K+ ++  +Y+ +G RG+GKTT ARI+A++LN       +  +   
Sbjct: 20  LIGQEVIAETIINSIKANKVPNAYLFNGIRGVGKTTIARIVAKALNCSNG---LDKICKN 76

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              ++C+ I   +H+DV+E+DAAS T +DDVR++I+   Y P +++++++I+DEV MLS 
Sbjct: 77  NLCDNCEGITNSSHIDVLEMDAASKTGVDDVRDLIEFSRYGPTTSKYKIFIIDEVHMLSK 136

Query: 121 AAFNGLLKTLEEPPPH-----VKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFT 175
            AFN LLKTLEEPP +     +KFIFATTEI+KIPITV+SRCQRFDL R+   +L E   
Sbjct: 137 QAFNALLKTLEEPPQYENGGGLKFIFATTEIKKIPITVVSRCQRFDLSRVKSTELFEFIK 196

Query: 176 KILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCND--KIVTSSVRLMLALADR 233
           KI  +E  +   +A+ +I + S+GS RD LSLLD+A+   ++  ++  +S + +    D+
Sbjct: 197 KIKDQEKGKVTDDALRLIIKISEGSVRDALSLLDRALLSLDEGKELDLNSAQKIFGYFDK 256

Query: 234 NRIMDLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLL 293
           ++++DLF  ++K D    ++ +   YD GV P V ++D  E  +    I  +   +    
Sbjct: 257 SQLIDLFELILKADETKAIEIYRKIYDQGVEPKVFINDFLELIYYFKNINSLNMESTNFA 316

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPS 353
            ++ E  +  + + EVS   L  FWQ  L+ + E+E  +    ++EM LIRL +   L +
Sbjct: 317 LNDDEFTKIKKIANEVSNETLILFWQFTLRTLGELEIVNNQNLSIEMFLIRLMYLKSLKT 376

Query: 354 PE 355
            E
Sbjct: 377 NE 378


>gi|330502977|ref|YP_004379846.1| DNA polymerase III subunits gamma and tau [Pseudomonas mendocina
           NK-01]
 gi|328917263|gb|AEB58094.1| DNA polymerase III subunits gamma and tau [Pseudomonas mendocina
           NK-01]
          Length = 710

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 208/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGISSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F L  +    ++E  T +L  
Sbjct: 134 SSFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFSLKNMPPERVVEHLTHVLTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GD   +++      + G + + +L ++    H V   + +P+  D     + +  
Sbjct: 254 HALIEGDARALIEAVRHLAEQGPDWNGVLAEMLNVLHRVAIAQALPDAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R LQ ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLQLAQALPAEDVQFYYQMALIGRRDLPLAPEPRGGFEMVLLRM 355


>gi|330432966|gb|AEC18025.1| DNA polymerase III subunits gamma and tau [Gallibacterium anatis
           UMN179]
          Length = 724

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 215/350 (61%), Gaps = 22/350 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +I  LTNA  + R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  VVGQEHIIAALTNALNNQRLHHAYLFSGTRGVGKTSIARLFAKGLNCEKGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E+C+AI  GN +D++E+DAAS T ++D RE++D + YKP+  RF++Y++DEV MLS 
Sbjct: 74  GECENCRAIKEGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVRGRFKIYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PITVLSRC +F L  +    +     K+LQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITVLSRCIQFHLKALDADVIAAHLQKLLQK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I++ P+A+  IARA+ GS RD LSL DQAIA  N  I  + V +ML L D ++ + L 
Sbjct: 194 EQIDYQPQALMKIARAAQGSVRDALSLTDQAIALSNGNINVNDVNMMLGLLDNDKSIALL 253

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYI---PEMADTLLY 294
             L + D    + VL E + Q   GV+   +L ++AE  H +  ++++   PE A+T L 
Sbjct: 254 KALSQADGEQAMQVLYEIAQQ---GVDWERVLQEMAETLHQIAMLQFLPPNPEQANTALT 310

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
             A+N         +S   +  ++++++KG  E+     P   VEM ++R
Sbjct: 311 LLAKN---------LSPEDVQFYYELMIKGREELSYSPDPRIGVEMTMLR 351


>gi|262372722|ref|ZP_06066001.1| DNA polymerase III [Acinetobacter junii SH205]
 gi|262312747|gb|EEY93832.1| DNA polymerase III [Acinetobacter junii SH205]
          Length = 673

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 140/345 (40%), Positives = 210/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCRAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++    T IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITTHLTTILDK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ESI  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 ESINADRDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++A  L YSE  N 
Sbjct: 253 LAIHQNQQARVSQLLLQFRQQALDVSLVLDQLVSTLHELALLQYLPDLA--LKYSEEINR 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + LQ SK +S   L  ++Q+  KG S+I+      +  EM+++RL
Sbjct: 311 KILQLSKLISAQDLQLYYQIACKGRSDIQLAVTQEQGFEMIVLRL 355


>gi|255319321|ref|ZP_05360538.1| DNA polymerase III, subunits gamma and tau [Acinetobacter
           radioresistens SK82]
 gi|262379765|ref|ZP_06072921.1| DNA polymerase III [Acinetobacter radioresistens SH164]
 gi|255303714|gb|EET82914.1| DNA polymerase III, subunits gamma and tau [Acinetobacter
           radioresistens SK82]
 gi|262299222|gb|EEY87135.1| DNA polymerase III [Acinetobacter radioresistens SH164]
          Length = 721

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 219/358 (61%), Gaps = 7/358 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LTNA + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQSHVSRALTNALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ E  T+ILQ+
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITEHLTRILQK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  I  ++ GS RD LSL DQAIA    ++    V+ ML L DR  I DL 
Sbjct: 193 EEINADSDAIWQIGESAQGSLRDALSLTDQAIAYGQGEVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + + +   V Q         ++ S++L  L    H +  ++Y+P++   L YS+  N 
Sbjct: 253 LAIHQNNQARVSQLLLQFRHQALDVSLVLDQLISTLHELALLQYLPDLG--LKYSDEINR 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
           + LQ S+ +S   L  ++Q+  KG ++++      +  EM ++RL  A +  +P+EI+
Sbjct: 311 KILQLSRLISAQDLQLYYQIACKGRADLQLSVTQEQGFEMCILRLL-AFRPLAPDEIS 367


>gi|212634550|ref|YP_002311075.1| DNA-directed DNA polymerase [Shewanella piezotolerans WP3]
 gi|212556034|gb|ACJ28488.1| DNA-directed DNA polymerase [Shewanella piezotolerans WP3]
          Length = 946

 Score =  262 bits (669), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 205/344 (59%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GQCSACVEIAEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++ +  T +L  
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEISDQLTNVLTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+EF+  A+ ++A+A++GS RD LSL DQAIA    ++    V+ ML   D  +++ L 
Sbjct: 194 ESLEFEATALTLLAKAANGSMRDALSLTDQAIAFGAGQVKLELVQTMLGSIDEKQVIALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L K D++ ++Q  +     G  P  +L  L E  H +T  ++ P  A   LYSE   A
Sbjct: 254 EALAKADVMALMQVSAGVLSFGAEPEEVLRSLLELLHQITLTQFAPAAAQMSLYSEQIKA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q S E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 314 FAQQLSPEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLR 353


>gi|50085108|ref|YP_046618.1| DNA polymerase III subunits tau and gamma [Acinetobacter sp. ADP1]
 gi|49531084|emb|CAG68796.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter sp. ADP1]
          Length = 711

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGITSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++    T IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITSHLTTILAK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIEADKDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+PE+  +L YSE  N 
Sbjct: 253 LAIHQNQTARVSQLLMQFRQQALDVSLVLDQLISTLHELALLQYLPEL--SLKYSEEINQ 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L+ +K VS   L  ++Q+  KG SE++      +  EM ++RL
Sbjct: 311 KILKLAKIVSAQDLQLYYQIACKGRSELQLSVTQEQGFEMCVLRL 355


>gi|157829166|ref|YP_001495408.1| DNA polymerase III subunits gamma and tau [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165933895|ref|YP_001650684.1| DNA polymerase III subunits gamma and tau [Rickettsia rickettsii
           str. Iowa]
 gi|157801647|gb|ABV76900.1| DNA polymerase III subunits gamma and tau [Rickettsia rickettsii
           str. 'Sheila Smith']
 gi|165908982|gb|ABY73278.1| DNA polymerase III subunit gamma/tau [Rickettsia rickettsii str.
           Iowa]
          Length = 509

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/353 (38%), Positives = 218/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 207 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             Y+I  +    +   +  Y S VN  + +   ++F   + ++K +P  +  L   E+ N
Sbjct: 267 VEYIIHRETEKAINLINKLYGSSVNLEIFIESASDFIAYLNKVKMLPNYS--LPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 325 DRTKNILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 377


>gi|237799328|ref|ZP_04587789.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022184|gb|EGI02241.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 384

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 1   MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 56

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 57  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 116

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 117 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 176

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 177 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 236

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + S +L ++    H V   + +PE  D       +  
Sbjct: 237 TALLEGDARGVLEAVRYLAEQGPDWSGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 293

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 294 RVLALAQALPAEDVQFYYQMCLIGRRDLPLAPDPRGGFEMVLLRM 338


>gi|167034829|ref|YP_001670060.1| DNA polymerase III subunits gamma and tau [Pseudomonas putida GB-1]
 gi|166861317|gb|ABY99724.1| DNA polymerase III, subunits gamma and tau [Pseudomonas putida
           GB-1]
          Length = 687

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 207/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLSA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+P+A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEPDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGSLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+   +  + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRNLAEQGPDWSGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  +  +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALASALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|297538152|ref|YP_003673921.1| DNA polymerase III subunits gamma and tau [Methylotenera sp. 301]
 gi|297257499|gb|ADI29344.1| DNA polymerase III, subunits gamma and tau [Methylotenera sp. 301]
          Length = 573

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 211/346 (60%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ LTNA +  R+  +Y+ +GTRG+GKTT ARI+A+SLN +      P     
Sbjct: 18  LVGQDHVVRALTNALEQNRLHHAYLFTGTRGVGKTTVARILAKSLNCEKGITAKPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C  I RG  VD++E+DAAS+T +D +R+++D   Y P S RF+VYI+DEV MLS 
Sbjct: 74  GVCDACTEIDRGRFVDLIEVDAASNTQVDAMRDLLDNAQYAPTSGRFKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +K+P+TVLSRC +F+L +++   +IE    IL +
Sbjct: 134 SAFNAMLKTLEEPPAHVKFILATTDPQKVPVTVLSRCLQFNLRQMAGTSIIEHLQNILGQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+P A+ +IARA+ GS RD LSL DQAIA     +  S VR ML   D++ +  L 
Sbjct: 194 ENIPFEPTALHLIARAAAGSMRDALSLTDQAIAYGGQTVNESEVRAMLGAIDQSYLYQLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE-MADTLLYSEAEN 299
             L+  D  +++ +  S  +  ++  V L+DLA+  H +   + +P+ +AD L     E 
Sbjct: 254 NALLANDGASIIAQAKSMEERSLSFEVALNDLAQLLHQIAVAQTVPDSIADDL----PER 309

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              L  ++ +S   L  ++Q+ L G  +I           M L+R+
Sbjct: 310 HLLLDLAQRISSETLQLYYQIALLGRRDISLAPDEFAGFTMSLLRM 355


>gi|220918864|ref|YP_002494168.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|219956718|gb|ACL67102.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 601

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 205/343 (59%), Gaps = 6/343 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M GQ+ +++TL+NA K+G++A +++ +G RG+GKTTTAR++A++LN +      PT E  
Sbjct: 18  MSGQEHVVRTLSNALKTGQLAHAFLFTGPRGVGKTTTARLVAKALNCEKG----PTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VDVVE+DAAS+  +D+VR+I++ + Y+P   RF+V+++DEV MLS 
Sbjct: 74  GVCTPCVEIAEGRAVDVVEIDAASNNGVDNVRDIVEAVKYRPARDRFKVFVVDEVHMLSQ 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKF+ ATT++ K+P T+LSRCQRFD  R+++  + +   K+  E
Sbjct: 134 GAFNALLKTLEEPPPHVKFVLATTDVHKVPETILSRCQRFDFRRLTLQQIADQLAKVAAE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +   P A+A++AR ++G  RD LSLLDQ  A C D     +V   L   D   +  + 
Sbjct: 194 EGMRLSPAALALVARQAEGGMRDALSLLDQVRAACGDAPGDDAVAEALGAVDAAAVSRIA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G L+  D   +L+E  + +D G+    +  +L      V   K +P+    L   +AE A
Sbjct: 254 GALVGRDGAALLREIEALHDRGLEVKRLAEELVRHLRNVVVAKLVPQAPIDL--PDAELA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLI 343
                +       L+R + +  + + +++   +P  A+E+ L+
Sbjct: 312 EVRAQAAAADAAQLTRLFDLAQRAVVDVKLAEQPRYALEVALL 354


>gi|170722750|ref|YP_001750438.1| DNA polymerase III subunits gamma and tau [Pseudomonas putida W619]
 gi|169760753|gb|ACA74069.1| DNA polymerase III, subunits gamma and tau [Pseudomonas putida
           W619]
          Length = 689

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 208/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L+ 
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLEA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+P+A+ ++ RA+DGS RD +SL DQAIA    +++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEPDALWLLGRAADGSMRDAMSLTDQAIAFGEGRVLAADVRAMLGSLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+   +  + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRNLAEQGPDWSGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  +  +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALASALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|325919111|ref|ZP_08181170.1| DNA polymerase III, subunit gamma/tau [Xanthomonas gardneri ATCC
           19865]
 gi|325550420|gb|EGD21215.1| DNA polymerase III, subunit gamma/tau [Xanthomonas gardneri ATCC
           19865]
          Length = 689

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 206/345 (59%), Gaps = 9/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +LQ  ++  +   + S +L  LAE  H +   + +P +A        +  
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDWSGVLEALAEALHRIQVQQLVPSVAFV-----GDGI 308

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               Y+ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 DPTAYAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|197124085|ref|YP_002136036.1| DNA polymerase III subunits gamma/tau [Anaeromyxobacter sp. K]
 gi|196173934|gb|ACG74907.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter sp. K]
          Length = 601

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 130/343 (37%), Positives = 205/343 (59%), Gaps = 6/343 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M GQ+ +++TL+NA K+G++A +++ +G RG+GKTTTAR++A++LN +      PT E  
Sbjct: 18  MSGQEHVVRTLSNALKTGQLAHAFLFTGPRGVGKTTTARLVAKALNCEKG----PTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VDVVE+DAAS+  +D+VR+I++ + Y+P   RF+V+++DEV MLS 
Sbjct: 74  GVCTPCVEIAEGRAVDVVEIDAASNNGVDNVRDIVEAVKYRPARDRFKVFVVDEVHMLSQ 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKF+ ATT++ K+P T+LSRCQRFD  R+++  + +   K+  E
Sbjct: 134 GAFNALLKTLEEPPPHVKFVLATTDVHKVPETILSRCQRFDFRRLTLQQIADQLAKVAAE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +   P A+A++AR ++G  RD LSLLDQ  A C D     +V   L   D   +  + 
Sbjct: 194 EGMRLSPAALALVARQAEGGMRDALSLLDQVRAACGDAPGDDAVAEALGAVDAAAVSRIA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G L+  D   +L+E  + +D G+    +  +L      V   K +P+    L   +AE A
Sbjct: 254 GALVGRDGAALLREIEALHDRGLEVKRLAEELVRHLRNVVVAKLVPQAPIDL--PDAELA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLI 343
                +       L+R + +  + + +++   +P  A+E+ L+
Sbjct: 312 EVRAQAAAADAAQLTRLFDLAQRAVVDVKLAEQPRYALEVALL 354


>gi|294666543|ref|ZP_06731784.1| DNA polymerase III subunits gamma and tau [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292603687|gb|EFF47097.1| DNA polymerase III subunits gamma and tau [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 689

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|229587233|ref|YP_002845734.1| DNA polymerase III subunits gamma and tau [Rickettsia africae
           ESF-5]
 gi|228022283|gb|ACP53991.1| DNA polymerase III gamma and tau chains [Rickettsia africae ESF-5]
          Length = 533

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 137/353 (38%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 51  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 110

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 111 CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 170

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 171 FNALLKTLEEPPPHVIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 230

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 231 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 290

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y S VN  + +   A+F   + ++K +P  +  L   E+ N
Sbjct: 291 VECIIYRETEKAINLINKLYGSSVNLEIFIESAADFIAYLNKVKMLPNYS--LPIYESFN 348

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 349 DRTKNILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 401


>gi|294627932|ref|ZP_06706511.1| DNA polymerase III subunits gamma and tau [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292597846|gb|EFF42004.1| DNA polymerase III subunits gamma and tau [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 689

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|78046683|ref|YP_362858.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|78035113|emb|CAJ22758.1| DNA polymerase III tau and gamma subunits [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 683

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|21241864|ref|NP_641446.1| DNA polymerase III subunits gamma and tau [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|21107246|gb|AAM35982.1| DNA polymerase III tau and gamma subunits [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 689

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EPIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 HALTDGDGARLLQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|169633760|ref|YP_001707496.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter baumannii SDF]
 gi|169152552|emb|CAP01532.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter baumannii]
          Length = 682

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 214/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A +SGR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALESGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|193077651|gb|ABO12483.2| DNA polymerase III tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter baumannii ATCC 17978]
          Length = 702

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCTTCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  DP+A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADPDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 IAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            N + LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INTKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|322417711|ref|YP_004196934.1| DNA polymerase III subunits gamma and tau [Geobacter sp. M18]
 gi|320124098|gb|ADW11658.1| DNA polymerase III, subunits gamma and tau [Geobacter sp. M18]
          Length = 575

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 216/366 (59%), Gaps = 5/366 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + +TL NA   GR+A +++ +G RG+GKT++ARI+A++LN ++      TVE  
Sbjct: 18  LVGQEHVSQTLKNAIDGGRVAHAFLFTGARGVGKTSSARILAKALNCESGL----TVEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  GN VDV E+D AS+T +DD+RE+ D I Y P  +R++++I+DEV ML+T
Sbjct: 74  NSCSTCLEITDGNSVDVFEIDGASNTGVDDIRELRDNIKYLPSRSRYKIFIIDEVHMLTT 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  RI++  ++     I+ +
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKVPITILSRCQRFDFKRIALPRIVSRLRYIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++   EA++++AR  DGS RD LS LDQ +A C + +  + V  +L + DR  IM+  
Sbjct: 194 EGVQVSDEALSVVARKGDGSMRDSLSTLDQVLAFCGNSVSDADVAALLGVVDRRLIMEGC 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++ D+   L   +     G +     H+L +       +K + E  D L  S+AE +
Sbjct: 254 RSVLEADLRGALGIVARVDSFGYSMRQFCHELIDQFRNAAILKAVGEPGDLLELSDAELS 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH-AVQLPSPEEIAR 359
                    +   L R   ++LK  +E+     P   +EM L+++A  A  +P  E +AR
Sbjct: 314 ELRALGAHATPQDLQRHLAILLKAEAEMAHAGFPRLILEMALMKMATLAPAIPVQELLAR 373

Query: 360 YIVEEK 365
               EK
Sbjct: 374 LDALEK 379


>gi|166710949|ref|ZP_02242156.1| DNA polymerase III subunits gamma and tau [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 698

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GQCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 QSLADGDGARLMQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|330973302|gb|EGH73368.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 461

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|146307669|ref|YP_001188134.1| DNA polymerase III subunits gamma and tau [Pseudomonas mendocina
           ymp]
 gi|145575870|gb|ABP85402.1| DNA polymerase III, subunits gamma and tau [Pseudomonas mendocina
           ymp]
          Length = 692

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 207/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGISSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F L  +    ++E  + +L  
Sbjct: 134 SSFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFSLKNMPPERVVEHLSHVLTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   +++      + G + + +L ++    H V   + +P+  D     + +  
Sbjct: 254 HALFEGDARALIEAVRHLAEQGPDWNGVLAEMLNVLHRVAIAQALPDAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R LQ ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLQLAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|301385366|ref|ZP_07233784.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tomato Max13]
          Length = 740

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|28870802|ref|NP_793421.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|28854051|gb|AAO57116.1| DNA polymerase III, subunits gamma and tau [Pseudomonas syringae
           pv. tomato str. DC3000]
          Length = 743

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|330954421|gb|EGH54681.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae Cit
           7]
          Length = 736

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|330986180|gb|EGH84283.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 733

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|330879129|gb|EGH13278.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 739

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|157961334|ref|YP_001501368.1| DNA polymerase III subunits gamma and tau [Shewanella pealeana ATCC
           700345]
 gi|157846334|gb|ABV86833.1| DNA polymerase III, subunits gamma and tau [Shewanella pealeana
           ATCC 700345]
          Length = 948

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 210/365 (57%), Gaps = 11/365 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GQCSACVEIAEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++      IL  
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEIGAQLNHILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+  A+ ++A+A++GS RD LSL DQAIA    ++    V+ ML   D   ++ L 
Sbjct: 194 EQLTFEESALTLLAKAANGSMRDALSLTDQAIAFGAGQVKLEQVQTMLGSIDEKHVIALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L K D++++++  +     G  P  +L  L E  H +T  ++ P  A   LYSE   A
Sbjct: 254 EALAKADVMDLMRVTAKVLSFGAEPEEVLRSLLELLHQITLTQFAPAAAQMSLYSEQIKA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
            A Q S E     +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 314 FAQQLSAEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLR---AVTFVPEKPVTRW 366

Query: 361 IVEEK 365
            VE K
Sbjct: 367 AVESK 371


>gi|302063638|ref|ZP_07255179.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tomato K40]
 gi|302133891|ref|ZP_07259881.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tomato NCPPB 1108]
          Length = 740

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|213968912|ref|ZP_03397052.1| DNA polymerase III, subunits gamma and tau [Pseudomonas syringae
           pv. tomato T1]
 gi|213926211|gb|EEB59766.1| DNA polymerase III, subunits gamma and tau [Pseudomonas syringae
           pv. tomato T1]
          Length = 744

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|331015914|gb|EGH95970.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 736

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|330963243|gb|EGH63503.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 741

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|302185103|ref|ZP_07261776.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           syringae 642]
          Length = 736

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|330960239|gb|EGH60499.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 717

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|257484501|ref|ZP_05638542.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331013236|gb|EGH93292.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 737

 Score =  258 bits (659), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|325927129|ref|ZP_08188395.1| DNA polymerase III, subunit gamma/tau [Xanthomonas perforans
           91-118]
 gi|325542497|gb|EGD13973.1| DNA polymerase III, subunit gamma/tau [Xanthomonas perforans
           91-118]
          Length = 420

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 206/345 (59%), Gaps = 9/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +LQ  ++  +   + S +L  LAE  H V   + +P +A        +  
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDWSGVLEALAEALHRVQVQQLVPSVAFV-----GDGI 308

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 DPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|298486349|ref|ZP_07004411.1| DNA polymerase III subunits gamma and tau [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298159077|gb|EFI00136.1| DNA polymerase III subunits gamma and tau [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 737

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|289649552|ref|ZP_06480895.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 741

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMATDVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|67459756|ref|YP_247380.1| DNA polymerase III subunits gamma and tau [Rickettsia felis
           URRWXCal2]
 gi|67005289|gb|AAY62215.1| DNA polymerase III gamma and tau chains [Rickettsia felis
           URRWXCal2]
          Length = 521

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+   Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 39  GQEVLVKVLSYTILNDRLTGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 98

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 99  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 158

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 159 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 218

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA    A+ ++ I    +  ML L D + I++ 
Sbjct: 219 LKTDIEALRIIAHKSEGSARDAVSILDQAASMSAKFDNIISPQVINQMLGLVDSSVIIEF 278

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y+  VN  + +  +A+F   + ++K +P  +  L   E+ N
Sbjct: 279 VECIIHRETEKAINLINKLYNFSVNLEIFIESVADFIAYLNKVKMLPNYS--LPIYESFN 336

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      ++S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 337 DRTKNILDKISLPHLSILWQIYNKGVGEIKISYNGLTETEMLVIKSIYSTSLP 389


>gi|66045069|ref|YP_234910.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255776|gb|AAY36872.1| DNA-directed DNA polymerase [Pseudomonas syringae pv. syringae
           B728a]
          Length = 736

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|325918000|ref|ZP_08180164.1| DNA polymerase III, subunit gamma/tau [Xanthomonas vesicatoria ATCC
           35937]
 gi|325535764|gb|EGD07596.1| DNA polymerase III, subunit gamma/tau [Xanthomonas vesicatoria ATCC
           35937]
          Length = 399

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 205/345 (59%), Gaps = 9/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LTNA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALTNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EDIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +LQ  ++  +   + S +L  LAE  H V   + +P +A        +  
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDWSGVLEALAEALHRVQVQQLVPSVAFV-----GDGI 308

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               ++  +    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 DPTPFAAHLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|71734194|ref|YP_274019.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554747|gb|AAZ33958.1| DNA polymerase III, subunits gamma and tau [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 737

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|289662384|ref|ZP_06483965.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. vasculorum NCPPB702]
          Length = 365

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 206/345 (59%), Gaps = 9/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GQCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +LQ  ++  +   + S +L  LAE  H V   + +P +A        +  
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDWSGVLEALAEALHRVQVQQLVPSVAFV-----GDGI 308

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 DPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|289626398|ref|ZP_06459352.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330866322|gb|EGH01031.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 741

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|114563577|ref|YP_751090.1| DNA polymerase III, subunits gamma and tau [Shewanella
           frigidimarina NCIMB 400]
 gi|114334870|gb|ABI72252.1| DNA polymerase III, subunits gamma and tau [Shewanella
           frigidimarina NCIMB 400]
          Length = 939

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 217/362 (59%), Gaps = 11/362 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  MVGQSHVLMALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCETGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GECSSCIEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+  K+P+TVLSRC +F+L  +S  ++ +    ++ +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPHKLPVTVLSRCLQFNLKSLSQDEISKQLEYVITQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ +A++++A+A++GS RD LSL DQAIA  + +++ + V+ ML   D   ++ L 
Sbjct: 194 EKLPFESQALSLLAKAANGSMRDALSLTDQAIAFGSGQVMLTQVQTMLGSIDEQHVLALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D+  ++Q  +     G +   +L  L E  H +T  ++ P  A   L+SE    
Sbjct: 254 KALCDADVGPLMQTVAKVLAFGADAEEVLRSLLELLHQITLTQFAPAAAQQSLFSE---- 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           + + ++++++   +  ++QM+L G  ++     P   +EM L+R   AV     +++ R+
Sbjct: 310 QIVAFAQQLAPEQVQLYYQMLLNGRKDLPFAPDPKSGLEMALLR---AVAFTPEKQVKRW 366

Query: 361 IV 362
           + 
Sbjct: 367 VT 368


>gi|330981944|gb|EGH80047.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 736

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EM+L+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMILLRM 355


>gi|226954137|ref|ZP_03824601.1| DNA polymerase III subunit Tau [Acinetobacter sp. ATCC 27244]
 gi|226835178|gb|EEH67561.1| DNA polymerase III subunit Tau [Acinetobacter sp. ATCC 27244]
          Length = 661

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ E  T IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVVSRCLQFTLRPLAVDEITEHLTAILAK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EHIDADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKDMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++A  L YSE  N 
Sbjct: 253 LAIHQNQQAQVSQLLMQFRQQALDVSLVLDQLVSTLHELAMLQYLPDLA--LKYSEEINQ 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  ++ VS   L  ++Q+  KG ++++      +  EM ++R+
Sbjct: 311 KILHLARLVSAQDLQLYYQIACKGRADLQLAVTQEQGFEMCVLRM 355


>gi|289667731|ref|ZP_06488806.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 355

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 137/345 (39%), Positives = 206/345 (59%), Gaps = 9/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GQCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +LQ  ++  +   + S +L  LAE  H V   + +P +A        +  
Sbjct: 254 QSLADGDGARLLQVVAALAEFSPDWSGVLEALAEALHRVQVQQLVPSVAFV-----GDGI 308

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 DPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|15893259|ref|NP_360973.1| DNA polymerase III subunits gamma and tau [Rickettsia conorii str.
           Malish 7]
 gi|15620479|gb|AAL03874.1| DNA polymerase III gamma and tau chains [Rickettsia conorii str.
           Malish 7]
          Length = 509

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 207 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y S VN  + +   ++F   + ++K +P  +  L   E+ N
Sbjct: 267 VECIIYRETEKAINLINKLYGSSVNLEIFIESASDFIAYLNKVKMLPNYS--LPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 325 DRTKNILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 377


>gi|260551269|ref|ZP_05825471.1| DNA polymerase III [Acinetobacter sp. RUH2624]
 gi|260405726|gb|EEW99216.1| DNA polymerase III [Acinetobacter sp. RUH2624]
          Length = 703

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 139/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTATPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     I    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSIHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCILRL 355


>gi|294838670|ref|ZP_06783353.1| DNA polymerase III, tau and gamma subunits [Acinetobacter sp.
           6013113]
          Length = 420

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 219/360 (60%), Gaps = 13/360 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL  A +  +P EI
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRLL-AFRPLAPNEI 366


>gi|320323485|gb|EFW79570.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329472|gb|EFW85464.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 737

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQAHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYVPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   VL+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 TALLEGDARGVLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|189423436|ref|YP_001950613.1| DNA polymerase III subunits gamma and tau [Geobacter lovleyi SZ]
 gi|189419695|gb|ACD94093.1| DNA polymerase III, subunits gamma and tau [Geobacter lovleyi SZ]
          Length = 551

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/347 (39%), Positives = 208/347 (59%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ + +TL NA  +GR+A +++ +G RG+GKT+TARI+A++LN +       T+E  
Sbjct: 18  LTGQEHVSRTLQNAIDTGRVAHAFLFTGARGVGKTSTARILAKALNCEQGV----TLEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               HC+ I  G+  DV E+D AS+T +DDVRE+ D   Y P  +R+++YI+DEV MLST
Sbjct: 74  NVCPHCREITDGSSTDVFEIDGASNTGVDDVRELRDNSRYLPSHSRYKIYIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  R+ +  ++    +I  +
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKLPITILSRCQRFDFKRVPLIKIVGRLREIADQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +  A+A+IAR  DGS RD ++  DQ +A C + +    V  ++ + DR  + +L 
Sbjct: 194 EGIVINDAALALIARKGDGSMRDSITCFDQVLAFCGNTVAVEDVATLVGVVDRRLLAELS 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDL-AEFTHLVTRIKYIPEMADTLLYSEAEN 299
             +  GD    L+        G N      +L + F +L+  I+ +P+  + L  +EAE 
Sbjct: 254 SAVFAGDTQGALEGVRRVDAFGYNVRQFTQELISHFRNLLV-IRSVPKPGEILDLAEAEL 312

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
               Q + E S   + R   +++K  SE+   S P   +EMVL+++A
Sbjct: 313 EELRQQAGEQSAADIQRRLTLLVKAESEMAHASFPRLLLEMVLLKMA 359


>gi|301347172|ref|ZP_07227913.1| DNA polymerase III, tau and gamma subunits [Acinetobacter baumannii
           AB056]
 gi|301511423|ref|ZP_07236660.1| DNA polymerase III, tau and gamma subunits [Acinetobacter baumannii
           AB058]
 gi|301594146|ref|ZP_07239154.1| DNA polymerase III, tau and gamma subunits [Acinetobacter baumannii
           AB059]
          Length = 417

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/360 (39%), Positives = 219/360 (60%), Gaps = 13/360 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEI 357
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL  A +  +P EI
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRLL-AFRPLAPNEI 366


>gi|313497891|gb|ADR59257.1| DnaX [Pseudomonas putida BIRD-1]
          Length = 689

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEEDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGSLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+   +  + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRNLAEQGPDWSGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  +  +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALASALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|260554689|ref|ZP_05826910.1| DNA polymerase III [Acinetobacter baumannii ATCC 19606]
 gi|260411231|gb|EEX04528.1| DNA polymerase III [Acinetobacter baumannii ATCC 19606]
          Length = 702

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|254521543|ref|ZP_05133598.1| DNA polymerase III, tau and gamma subunit [Stenotrophomonas sp.
           SKA14]
 gi|219719134|gb|EED37659.1| DNA polymerase III, tau and gamma subunit [Stenotrophomonas sp.
           SKA14]
          Length = 683

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 206/351 (58%), Gaps = 22/351 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 24  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 79

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +++VY++DEV MLS 
Sbjct: 80  GQCAACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKYKVYLVDEVHMLSK 139

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 140 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 199

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +A+A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 200 EDIEADDSAIVQLAKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVAAML 259

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L +GD      ++  L EFS  +      S +L  LAE  H +   + +P  A     
Sbjct: 260 DALAEGDGPRLLQVVAALAEFSPDW------SGVLEALAEGLHRIQVQQLVPGAA----- 308

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             AE   A  +++ +    +  ++QM L G  ++     P    EM ++R+
Sbjct: 309 -VAEGLDATAFAERLRPEVVQLWYQMALNGRRDLPLAPSPRAGFEMAVLRM 358


>gi|312962441|ref|ZP_07776932.1| DNA polymerase III, gamma and tau subunits [Pseudomonas fluorescens
           WH6]
 gi|311283368|gb|EFQ61958.1| DNA polymerase III, gamma and tau subunits [Pseudomonas fluorescens
           WH6]
          Length = 684

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GD   +L+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 HALIEGDAKALLEAVRHLSEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|294859646|ref|ZP_06797415.1| DNA polymerase III, tau and gamma subunits [Acinetobacter sp.
           6013150]
          Length = 682

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|215483116|ref|YP_002325323.1| DNA polymerase III, subunits gamma and tau [Acinetobacter baumannii
           AB307-0294]
 gi|213988763|gb|ACJ59062.1| DNA polymerase III, subunits gamma and tau [Acinetobacter baumannii
           AB307-0294]
          Length = 700

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|213158428|ref|YP_002319726.1| DNA polymerase III subunit tau [Acinetobacter baumannii AB0057]
 gi|213057588|gb|ACJ42490.1| DNA polymerase III subunit tau [Acinetobacter baumannii AB0057]
          Length = 686

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|169795628|ref|YP_001713421.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter baumannii AYE]
 gi|169148555|emb|CAM86421.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter baumannii AYE]
          Length = 710

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|323518491|gb|ADX92872.1| DNA polymerase III, gamma/tau subunit [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 692

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|322507665|gb|ADX03119.1| DNA polymerase III, tau and gamma subunits [Acinetobacter baumannii
           1656-2]
          Length = 710

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|294650252|ref|ZP_06727622.1| DNA polymerase III, tau and gamma subunits [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292823856|gb|EFF82689.1| DNA polymerase III, tau and gamma subunits [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 682

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ E  T IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVVSRCLQFTLRPLAVDEITEHLTAILVK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EHIDADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKDMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++A  L YSE  N 
Sbjct: 253 LAIHQNQQAQVSQLLMQFRQQALDVSLVLDQLVSTLHELAMLQYLPDLA--LKYSEEINQ 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  ++ VS   L  ++Q+  KG ++++      +  EM ++R+
Sbjct: 311 KILHLARLVSAQDLQLYYQIACKGRADLQLAVTQEQGFEMCVLRM 355


>gi|184158568|ref|YP_001846907.1| DNA polymerase III subunit gamma/tau [Acinetobacter baumannii
           ACICU]
 gi|294841838|ref|ZP_06786521.1| DNA polymerase III, tau and gamma subunits [Acinetobacter sp.
           6014059]
 gi|183210162|gb|ACC57560.1| DNA polymerase III, gamma/tau subunit [Acinetobacter baumannii
           ACICU]
          Length = 680

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/348 (39%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            NA+ LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INAKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|26990960|ref|NP_746385.1| DNA polymerase III subunits gamma and tau [Pseudomonas putida
           KT2440]
 gi|24985983|gb|AAN69849.1|AE016623_11 DNA polymerase III, gamma and tau subunits [Pseudomonas putida
           KT2440]
          Length = 691

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEEDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGSLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+   +  + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRNLAEQGPDWSGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  +  +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALASALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|148546837|ref|YP_001266939.1| DNA polymerase III subunits gamma and tau [Pseudomonas putida F1]
 gi|148510895|gb|ABQ77755.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Pseudomonas putida F1]
          Length = 692

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEEDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGSLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+   +  + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRNLAEQGPDWSGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  +  +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALASALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|21230460|ref|NP_636377.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769546|ref|YP_244308.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|21112024|gb|AAM40301.1| DNA polymerase III tau and gamma subunits [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66574878|gb|AAY50288.1| DNA polymerase III tau and gamma subunits [Xanthomonas campestris
           pv. campestris str. 8004]
          Length = 653

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EEIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H +   + +P +A     
Sbjct: 254 QALSDGDGAQLLKVVAALAEFSPDW------SGVLEALAEALHRIQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTGFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|34581073|ref|ZP_00142553.1| DNA polymerase III gamma and tau chains [Rickettsia sibirica 246]
 gi|28262458|gb|EAA25962.1| DNA polymerase III gamma and tau chains [Rickettsia sibirica 246]
          Length = 509

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 207 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y S VN  + +   ++F   + ++K +P  +  L   E+ N
Sbjct: 267 VECIIYRETEKAINLINKLYGSSVNLEMFIESASDFIAYLNKVKMLPNYS--LPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 325 DRTKNILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 377


>gi|190573045|ref|YP_001970890.1| DNA polymerase III subunits gamma and tau [Stenotrophomonas
           maltophilia K279a]
 gi|190010967|emb|CAQ44576.1| putative DNA polymerase III subunit Tau [Stenotrophomonas
           maltophilia K279a]
          Length = 677

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 205/351 (58%), Gaps = 22/351 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +++VY++DEV MLS 
Sbjct: 74  GQCAACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +A+A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EEIEADGSAIVQLAKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVAAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H +   + +P  A     
Sbjct: 254 DALADGDGPRLLQVVAALAEFSPDW------SGVLEALAEGLHRIQVQQLVPGAA----- 302

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             AE   A  +++ +    +  ++QM L G  ++     P    EM ++R+
Sbjct: 303 -VAEGLDAAAFAERLRPEVVQLWYQMALNGRRDLPMAPSPRAGFEMAVLRM 352


>gi|77458032|ref|YP_347537.1| DNA polymerase III subunits gamma and tau [Pseudomonas fluorescens
           Pf0-1]
 gi|77382035|gb|ABA73548.1| DNA polymerase III subunit Tau [Pseudomonas fluorescens Pf0-1]
          Length = 696

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSSPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GD   +L+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 HALIEGDAKALLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|188992754|ref|YP_001904764.1| DNA polymerase III subunits gamma and tau [Xanthomonas campestris
           pv. campestris str. B100]
 gi|167734514|emb|CAP52724.1| DNA polymerase III tau and gamma subunits [Xanthomonas campestris
           pv. campestris]
          Length = 752

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 117 LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 172

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 173 GTCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 232

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 233 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 292

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE DP A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 293 EEIESDPSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 352

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H +   + +P +A     
Sbjct: 353 QALSDGDGAQLLKVVAALAEFSPDW------SGVLEALAEALHRIQVQQLVPSVAFV--- 403

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 404 --GDGIDPTGFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 452


>gi|239948372|ref|ZP_04700125.1| DNA polymerase III, subunits gamma and tau [Rickettsia endosymbiont
           of Ixodes scapularis]
 gi|239922648|gb|EER22672.1| DNA polymerase III, subunits gamma and tau [Rickettsia endosymbiont
           of Ixodes scapularis]
          Length = 509

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 217/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEE 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKKEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA    A+ ++ I    +  ML L D + I++ 
Sbjct: 207 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSAKSDNIISPQVINQMLGLVDSSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y   VN  + +  +A+F   + ++K +P  +  L   E+ N
Sbjct: 267 VECIIHRETEKAINLINKLYGFSVNLEIFIESVADFIAYLNKVKMLPNYS--LPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            +      + S+  LS  WQ+  KG+ EI+     +   EM++I+  +++ LP
Sbjct: 325 DKTKSILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSMSLP 377


>gi|238651109|ref|YP_002916967.1| DNA polymerase III subunits gamma and tau [Rickettsia peacockii
           str. Rustic]
 gi|238625207|gb|ACR47913.1| DNA polymerase III subunits gamma and tau [Rickettsia peacockii
           str. Rustic]
          Length = 509

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 216/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+   Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLTGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEQ 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 207 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y S VN  + +   ++F   + ++K +P  +  L   E+ N
Sbjct: 267 VECIIHRETEKAINLINKLYGSSVNLEIFIESASDFIAYLNKVKMLPNYS--LPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 325 DRTKNILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 377


>gi|294141554|ref|YP_003557532.1| DNA polymerase III subunits gamma and tau [Shewanella violacea
           DSS12]
 gi|293328023|dbj|BAJ02754.1| DNA polymerase III, gamma and tau subunits [Shewanella violacea
           DSS12]
          Length = 943

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 135/369 (36%), Positives = 214/369 (57%), Gaps = 11/369 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLLALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGITASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCVEIAEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++    + +L +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEISSQLSYVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+  A+ ++A+A++GS RD LSL DQAIA     +  + V+ ML   D   ++ L 
Sbjct: 194 EQLTFEQPALTLLAKAANGSMRDALSLTDQAIAFGAGSVHLTQVQTMLGSIDEQHVITLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GDI ++++        G +P  +L  L E  H +T  ++ P  A   +YSE   A
Sbjct: 254 NALVQGDIESLMRVIGQVLSFGADPQEVLRSLLELLHQITLSQFAPAAAQLSIYSEQIKA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
            A Q S E     +  ++Q++L G  ++     P   +EM L+R   AV       + R+
Sbjct: 314 FAQQLSPEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLR---AVSFVPETPVTRW 366

Query: 361 IVEEKKKKT 369
           +V++    T
Sbjct: 367 MVDKPASVT 375


>gi|229591983|ref|YP_002874102.1| DNA polymerase III subunits gamma and tau [Pseudomonas fluorescens
           SBW25]
 gi|229363849|emb|CAY51308.1| DNA polymerase III subunit Tau [Pseudomonas fluorescens SBW25]
          Length = 688

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCKEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLSHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GD   +L+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 HALIEGDAKALLEAVRHLSEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|104780939|ref|YP_607437.1| DNA polymerase III subunits gamma and tau [Pseudomonas entomophila
           L48]
 gi|95109926|emb|CAK14631.1| DNA polymerase III, tau and gamma subunits [Pseudomonas entomophila
           L48]
          Length = 684

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 74  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G + + +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRDLAEQGPDWNGVLSEMLNVLHRVAIAQALPEAVDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|78224612|ref|YP_386359.1| DNA polymerase III subunits gamma/tau [Geobacter metallireducens
           GS-15]
 gi|78195867|gb|ABB33634.1| DNA polymerase III, tau subunit [Geobacter metallireducens GS-15]
          Length = 582

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 137/346 (39%), Positives = 203/346 (58%), Gaps = 4/346 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ + +TL NA  SGRIA +++ +G RG+GKT++ARI+A++L  +      P     
Sbjct: 18  LTGQEHVSQTLQNAIDSGRIAHAFLFTGARGVGKTSSARILAKALTCEQGMSPEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G  VDV+E+D AS+T +DD+RE+ + + Y P   R++++I+DEV MLST
Sbjct: 74  NVCPACTEITAGTAVDVLEIDGASNTGVDDIRELRENVKYLPSRLRYKIFIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  RI +G ++     I+ +
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKVPITILSRCQRFDFRRIPLGKVVGRLRHIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I     ++ M+AR  DGS RD LS+LDQ +A C D++    V  +L + DR  ++D  
Sbjct: 194 EGIAISDASLTMVARKGDGSMRDSLSVLDQVLAFCGDQVRDEEVVSLLGVVDRRLLLDAT 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D   VL   +   + G N      +L +    +  +K + +  D L  SEAE A
Sbjct: 254 AAVFGRDTRTVLDIVARVDEFGYNMRQFCGELIDHLRNLLILKAVGDGTDLLDLSEAELA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
              Q ++ V +  L R   ++L+   E+   S P   +EM L+++A
Sbjct: 314 TLRQQAESVPLDDLQRHLTVLLRADGELGHTSFPRLVLEMALVKMA 359


>gi|24373576|ref|NP_717619.1| DNA polymerase III, gamma and tau subunits [Shewanella oneidensis
           MR-1]
 gi|24347898|gb|AAN55063.1|AE015643_10 DNA polymerase III, gamma and tau subunits [Shewanella oneidensis
           MR-1]
          Length = 1002

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 215/367 (58%), Gaps = 11/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCETGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQQEIGTQLQHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A++++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQLPFEHEALGLLAKSANGSMRDALSLTDQAIAFGGGTVMLNQVQSMLGSIDEQHVLGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGALMQSCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYS----A 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 310 QIQAFAEQLAPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKSVKRW 366

Query: 361 IVEEKKK 367
            V++  K
Sbjct: 367 QVDDAVK 373


>gi|157965023|ref|YP_001499847.1| DNA polymerase III subunits gamma and tau [Rickettsia massiliae
           MTU5]
 gi|157844799|gb|ABV85300.1| DNA polymerase III gamma and tau chains [Rickettsia massiliae MTU5]
          Length = 516

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 216/353 (61%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 34  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEE 93

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 94  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 153

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FI ATTE++KIP T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 154 FNALLKTLEEPPPHIIFILATTEVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQEN 213

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAIARC--NDKIVTSSV-RLMLALADRNRIMDL 239
           ++ D EA+ +IA  S+GSARD +S+LDQA +    +D I++  V   ML L D + I++ 
Sbjct: 214 LKTDIEALRIIAYKSEGSARDAVSILDQAASMSVKSDNIISPQVINQMLGLVDSSVIIEF 273

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              +I  +    +   +  Y S VN  + +   ++F   + ++K +P  +  L   E+ N
Sbjct: 274 VECIIHRETEKAINLINKLYGSSVNLEIFIESASDFIAYLNKVKMLPNYS--LPIYESFN 331

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R      + S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 332 DRTKSILDKTSLPHLSILWQIYNKGVGEIKISYNQLTETEMLVIKSIYSTSLP 384


>gi|120598523|ref|YP_963097.1| DNA polymerase III subunits gamma and tau [Shewanella sp. W3-18-1]
 gi|120558616|gb|ABM24543.1| DNA polymerase III, subunits gamma and tau [Shewanella sp. W3-18-1]
          Length = 984

 Score =  255 bits (651), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 212/363 (58%), Gaps = 11/363 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 45  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 101 GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 161 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQDEIGTQLNHILTQ 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 221 EQLPFEVEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLTQVQTMLGSIDEQHVIALL 280

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 281 KALTDADITVLMQTSAQVLAYGADAQEVLRSLLELLHQITLTQFAPACAQQSLYS----A 336

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 337 QIRAFAEQLTPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 393

Query: 361 IVE 363
            VE
Sbjct: 394 QVE 396


>gi|296775809|gb|ADH43064.1| DNA polymerase III, gamma/tau subunits [uncultured SAR11 cluster
           alpha proteobacterium H17925_48B19]
          Length = 514

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/347 (38%), Positives = 208/347 (59%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + +T+ N+  S +   +++ +G RG+GKTT ARI+A+SLN +    ++   +  
Sbjct: 20  LIGQEIIAETIKNSIISDKSPNAFLFTGIRGVGKTTFARIVAKSLNCEHGIENMCKKK-- 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               +C AI   NH+DV+E+DAAS T +DDVRE+I+   Y P +A+++++I+DEV MLS 
Sbjct: 78  --CSNCDAITNSNHIDVLEMDAASKTGVDDVRELIEFSRYGPTTAKYKIFIIDEVHMLSK 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP ++KFIFATTEI+KIP+TV+SRCQRFDL R+   +L      I  +
Sbjct: 136 QAFNALLKTLEEPPKYLKFIFATTEIKKIPVTVISRCQRFDLSRVKSEELFNYIKMIKDK 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQA-IARCNDKIVT-SSVRLMLALADRNRIMD 238
           E  +   EA+ +I + S+GS RD LSLLD+  +A  ND+ +     + +    D++ +++
Sbjct: 196 EGGKVSDEALKLIVKISEGSVRDALSLLDRGLVANQNDEELNLDKAQSIYGYFDKSSLIE 255

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L   L  GD   V + +   YDSG++P + L+D  E  + +  I +I    +    ++ +
Sbjct: 256 LIKNLFSGDEKKVFELYRKIYDSGIDPKIFLNDFLEVLYYLKNINFIKLDGNNFSLNDQD 315

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
                  S+ +    +  FWQ  L  I EI   S P  +VEM L RL
Sbjct: 316 FNNLSTISENLDSKDIILFWQFTLDTIEEINIVSNPNLSVEMFLFRL 362


>gi|163750244|ref|ZP_02157486.1| DNA polymerase III, gamma and tau subunits [Shewanella benthica
           KT99]
 gi|161330100|gb|EDQ01084.1| DNA polymerase III, gamma and tau subunits [Shewanella benthica
           KT99]
          Length = 882

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 139/367 (37%), Positives = 215/367 (58%), Gaps = 11/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLLALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGITASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GQCSSCVEIAEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++    + +L +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEISAQLSYVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD  A+ ++A+A++GS RD LSL DQAIA     +  + V+ ML   D   ++ LF
Sbjct: 194 EQLTFDHAALTLLAKAANGSMRDALSLTDQAIAFGAGTVQLTQVQTMLGSIDEKHVLSLF 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GDI N+++        G +P  +L  L E  H +T  ++ P  A   +YSE   A
Sbjct: 254 NALVQGDIENLMRMIGQILSFGADPEEVLRSLLELLHQITLSQFAPAAAQLSIYSEQIKA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
            A Q S E     +  ++Q++L G  ++     P   +EM L+R   AV       + R+
Sbjct: 314 FAEQLSPEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLR---AVSFVPETPVTRW 366

Query: 361 IVEEKKK 367
           +V++  K
Sbjct: 367 VVDKPAK 373


>gi|152978645|ref|YP_001344274.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           succinogenes 130Z]
 gi|150840368|gb|ABR74339.1| DNA polymerase III, subunits gamma and tau [Actinobacillus
           succinogenes 130Z]
          Length = 699

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 206/344 (59%), Gaps = 11/344 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ ++  L N  K  R+  +Y+ SGTRG+GKT+ AR++A+ LN     I   T E  
Sbjct: 18  VIGQEHILTALANGLKENRLHHAYLFSGTRGVGKTSIARLLAKGLNC----IHGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI  GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GECEHCKAIENGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +S   + +    IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLKALSQQQIAQHLANILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+  IA+A+ GS RD LSL DQAIA  N  I    V +ML L D N+ +++ 
Sbjct: 194 EKIPFEPTALGKIAKAAQGSVRDSLSLTDQAIAMSNADIRVDVVNIMLGLLDDNQPIEIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   ++Q   +  D+G +   +L ++ E  H +  ++ +P   D       E +
Sbjct: 254 YALHQGNGEKLMQGIQAVADNGADWDELLIEVGEALHQIAMLQLLPNRID-------EES 306

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           +    +K +S   +  F+Q++  G  E+          EM L+R
Sbjct: 307 QLGFLAKHISPENIQFFYQIVTMGRKELAFAPNRRIGAEMTLLR 350


>gi|117920889|ref|YP_870081.1| DNA polymerase III subunits gamma and tau [Shewanella sp. ANA-3]
 gi|117613221|gb|ABK48675.1| DNA polymerase III, subunits gamma and tau [Shewanella sp. ANA-3]
          Length = 1040

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 214/367 (58%), Gaps = 11/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEKGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 134 SSFNALLKTLEEPPKHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQQEIGTQLQHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQLPFEHEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLNQVQSMLGSIDEQHVLRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGVLMQSCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYS----A 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 310 QIQAFAEQLAPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 366

Query: 361 IVEEKKK 367
            VE+  K
Sbjct: 367 QVEDAAK 373


>gi|330808463|ref|YP_004352925.1| DNA-directed DNA polymerase (DNA polymerase III, tau subunit)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327376571|gb|AEA67921.1| DNA-directed DNA polymerase (DNA polymerase III, tau subunit)
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 691

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVYDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+GD   +L+      + G + + +L ++    H V   + +P+  D       +  
Sbjct: 254 HALIEGDAKALLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPDGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|262370428|ref|ZP_06063754.1| DNA polymerase III [Acinetobacter johnsonii SH046]
 gi|262314770|gb|EEY95811.1| DNA polymerase III [Acinetobacter johnsonii SH046]
          Length = 698

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/348 (38%), Positives = 213/348 (61%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCPTCTAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ E    IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITEHLGNILNK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I+ + +A+  IA ++ GS RD LSL DQAIA     I    V+ ML L DR  I DL 
Sbjct: 193 ENIQAEQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAIQHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYL---IKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             +    K  +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+  +L YS  
Sbjct: 253 LAIHQNQKQRVSELLMQFRQQ---ALDVSLVLDQLISTLHELALLQYLPEL--SLKYSAE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            N + +Q S++++   L  ++Q+  KG +E++      +  EM ++R+
Sbjct: 308 INKKIMQLSQQIAAQDLQLYYQIACKGRAELQLAVTQEQGFEMSVLRM 355


>gi|114047820|ref|YP_738370.1| DNA polymerase III subunits gamma and tau [Shewanella sp. MR-7]
 gi|113889262|gb|ABI43313.1| DNA polymerase III, subunits gamma and tau [Shewanella sp. MR-7]
          Length = 1045

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 214/367 (58%), Gaps = 11/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEKGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQQEIGTQLQHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQLPFEHEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLNQVQSMLGSIDEQHVLRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGVLMQSCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYS----A 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 310 QIQAFAEQLAPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 366

Query: 361 IVEEKKK 367
            VE+  K
Sbjct: 367 QVEDAAK 373


>gi|113970589|ref|YP_734382.1| DNA polymerase III subunits gamma and tau [Shewanella sp. MR-4]
 gi|113885273|gb|ABI39325.1| DNA polymerase III, subunits gamma and tau [Shewanella sp. MR-4]
          Length = 1071

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 214/367 (58%), Gaps = 11/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEKGVTASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQQEIGTQLQHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQLPFEHEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLNQVQSMLGSIDEQHVLRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGVLMQSCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYS----A 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 310 QIQAFAEQLAPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 366

Query: 361 IVEEKKK 367
            VE+  K
Sbjct: 367 QVEDAAK 373


>gi|146282183|ref|YP_001172336.1| DNA polymerase III subunits gamma and tau [Pseudomonas stutzeri
           A1501]
 gi|145570388|gb|ABP79494.1| DNA polymerase subunits gamma and tau [Pseudomonas stutzeri A1501]
          Length = 687

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 33  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGVSSTPC---- 88

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 89  GQCSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPSRGRYKVYLIDEVHMLSS 148

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 149 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGV 208

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 209 ENVPFEEDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 268

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G + + +L ++    H V   + +PE  D     + +  
Sbjct: 269 QALLEGDARALLEAVRHLAEQGPDWAGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRD 325

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 326 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 370


>gi|327480432|gb|AEA83742.1| DNA polymerase III subunits gamma and tau [Pseudomonas stutzeri DSM
           4166]
          Length = 672

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 74  GQCSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPSRGRYKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEEDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G + + +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRHLAEQGPDWAGVLAEMLNVLHRVAIAQALPEAVDN---GQGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 355


>gi|51474033|ref|YP_067791.1| DNA polymerase III subunits gamma and tau [Rickettsia typhi str.
           Wilmington]
 gi|51460345|gb|AAU04308.1| DNA nucleotidyltransferase (DNA-directed) [Rickettsia typhi str.
           Wilmington]
          Length = 400

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 221/356 (62%), Gaps = 10/356 (2%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+   Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 26  GQEVLVKILSYTILNDRLVGGYLLTGIRGVGKTTSARIIAKAVNCSALITENMTIKTCEK 85

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TSIDD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 86  CTNCVSFNNHNHPDIIEIDAASKTSIDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 145

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++K+P T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 146 FNALLKTLEEPPPHVIFIFATTEVQKVPSTIISRCQRYDLRRLSFEEIFKLLKYITKQEN 205

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQA--IARCNDKIVTSS-VRLMLALADRNRIMDL 239
           +  D EA+ +IA  S+GSARD +S+LDQA  ++  +D I++S  +  ML L D + I++ 
Sbjct: 206 LIADIEALRIIAHKSEGSARDAVSILDQAASMSAKSDNIISSQIINQMLGLVDASFILEF 265

Query: 240 FGYLIKGDI---INVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
              +I  +    IN++ +    Y   VN    +  +A+F   + ++K +P    +L   E
Sbjct: 266 IEKIISKETEKAINLINKL--YYRFSVNLETFIQSVADFIAYLNKVKILPNY--SLPIYE 321

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
           + N R      ++S+  LS  WQ+  KG++EI+     +   EM++I+  ++  LP
Sbjct: 322 SFNYRTKSILAKISLAHLSILWQIYNKGVTEIKISYNQLIETEMLVIKSIYSTSLP 377


>gi|51474034|ref|YP_067790.1| DNA polymerase III subunits gamma and tau [Rickettsia typhi str.
           Wilmington]
 gi|51460346|gb|AAU04309.1| DNA nucleotidyltransferase (DNA-directed) [Rickettsia typhi str.
           Wilmington]
          Length = 507

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/356 (38%), Positives = 221/356 (62%), Gaps = 10/356 (2%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+   Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 26  GQEVLVKILSYTILNDRLVGGYLLTGIRGVGKTTSARIIAKAVNCSALITENMTIKTCEK 85

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TSIDD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 86  CTNCVSFNNHNHPDIIEIDAASKTSIDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 145

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++K+P T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 146 FNALLKTLEEPPPHVIFIFATTEVQKVPSTIISRCQRYDLRRLSFEEIFKLLKYITKQEN 205

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQA--IARCNDKIVTSS-VRLMLALADRNRIMDL 239
           +  D EA+ +IA  S+GSARD +S+LDQA  ++  +D I++S  +  ML L D + I++ 
Sbjct: 206 LIADIEALRIIAHKSEGSARDAVSILDQAASMSAKSDNIISSQIINQMLGLVDASFILEF 265

Query: 240 FGYLIKGDI---INVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
              +I  +    IN++ +    Y   VN    +  +A+F   + ++K +P  +  L   E
Sbjct: 266 IEKIISKETEKAINLINKL--YYRFSVNLETFIQSVADFIAYLNKVKILPNYS--LPIYE 321

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
           + N R      ++S+  LS  WQ+  KG++EI+     +   EM++I+  ++  LP
Sbjct: 322 SFNYRTKSILAKISLAHLSILWQIYNKGVTEIKISYNQLIETEMLVIKSIYSTSLP 377


>gi|116049476|ref|YP_791721.1| DNA polymerase III subunits gamma and tau [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115584697|gb|ABJ10712.1| DNA polymerase subunits gamma and tau [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 701

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRHLAEQGPDWGGVLAEILNVLHRVAIAQALPEAIDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 355


>gi|239501566|ref|ZP_04660876.1| DNA polymerase III subunit tau [Acinetobacter baumannii AB900]
          Length = 698

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 212/348 (60%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGVILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIAADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+PE+   L YSE 
Sbjct: 253 LAVHQNQREKVSQLLLQFRYQ---ALDVSLVLDQLISTLHELALLQYLPELG--LKYSEE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            N + LQ SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INTKILQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|146293398|ref|YP_001183822.1| DNA polymerase III subunits gamma and tau [Shewanella putrefaciens
           CN-32]
 gi|145565088|gb|ABP76023.1| DNA polymerase III, subunits gamma and tau [Shewanella putrefaciens
           CN-32]
          Length = 957

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 211/363 (58%), Gaps = 11/363 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQQEIGTQLNHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQFPFEVEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLTQVQTMLGSIDEQHVIALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADITVLMQTSAQVLAYGADAQEVLRSLLELLHQITLTQFAPACAQQSLYS----A 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 310 QIRAFAEQLTPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 366

Query: 361 IVE 363
            VE
Sbjct: 367 QVE 369


>gi|107100963|ref|ZP_01364881.1| hypothetical protein PaerPA_01001993 [Pseudomonas aeruginosa PACS2]
          Length = 677

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 1   MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPC---- 56

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 57  GECSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 116

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 117 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 176

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 177 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 236

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 237 QALLEGDARALLEAVRHLAEQGPDWGGVLAEILNVLHRVAIAQALPEAIDN---GQGDRE 293

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 294 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 338


>gi|302878404|ref|YP_003846968.1| DNA polymerase III, subunits gamma and tau [Gallionella
           capsiferriformans ES-2]
 gi|302581193|gb|ADL55204.1| DNA polymerase III, subunits gamma and tau [Gallionella
           capsiferriformans ES-2]
          Length = 571

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 203/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ +++ L NA    R+  +Y+ +GTRG+GKTT ARI A+SLN  T     P     
Sbjct: 19  LAGQEHVVRALGNALSQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCLTGITATPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++ELDAAS+T +D++RE+++   Y P SARF+VYI+DEV MLS 
Sbjct: 75  GVCSACTEIDSGRFVDLIELDAASNTQVDNMRELLESALYAPTSARFKVYIIDEVHMLSK 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++    ++     +L E
Sbjct: 135 SAFNAMLKTLEEPPAHVKFILATTDPQKIPVTVLSRCLQFNLKQLPPALIVAHLQHVLTE 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IEF+P A+ ++ARA+ GS RD LSL DQAIA  + K+  S++R ML   D+  + +L 
Sbjct: 195 EHIEFEPAALNLVARAAQGSMRDALSLTDQAIAFSSGKLEESAMRSMLGAIDQGYLFELL 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + +  ++L    S     +     L +LA   H +   + +P+    +   + E  
Sbjct: 255 HALHRQNGADLLGVAESMATRSIAFDAALQELASLLHRIALAQTVPQ---AIAEDDPERG 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L+ +   +   +  F+Q+ + G +EIE          M L+R+
Sbjct: 312 RVLELAANFTPEEVQLFYQIAIHGRAEIELAPDEYAGFSMTLLRM 356


>gi|70729286|ref|YP_259023.1| DNA polymerase III subunits gamma and tau [Pseudomonas fluorescens
           Pf-5]
 gi|68343585|gb|AAY91191.1| DNA polymerase III, gamma and tau subunits [Pseudomonas fluorescens
           Pf-5]
          Length = 692

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GTCSVCCEIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLSHVLGV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+ 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVYDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI GD   +L+      + G + + +L ++    H V   + +PE  D       +  
Sbjct: 254 HALINGDAKALLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 355


>gi|319426701|gb|ADV54775.1| DNA polymerase III, subunits gamma and tau [Shewanella putrefaciens
           200]
          Length = 984

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/363 (36%), Positives = 212/363 (58%), Gaps = 11/363 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 45  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 101 GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 161 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQDEIGTQLNHILTQ 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 221 EQLPFEIEALTLLAKAANGSMRDALSLTDQAIAFGGGTVMLTQVQTMLGSIDEQHVIALL 280

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++Q  +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 281 KALTDADIKVLMQTSAQVLAYGADAQEVLRSLLELLHQITLTQFAPACAQQSLYS----A 336

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
           +   ++++++   +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 337 QIRAFAEQLTPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLR---AVAFVPEKPVKRW 393

Query: 361 IVE 363
            VE
Sbjct: 394 QVE 396


>gi|15596729|ref|NP_250223.1| DNA polymerase III subunits gamma and tau [Pseudomonas aeruginosa
           PAO1]
 gi|9947490|gb|AAG04921.1|AE004581_8 DNA polymerase subunits gamma and tau [Pseudomonas aeruginosa PAO1]
          Length = 681

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRHLAEQGPDWGGVLAEILNVLHRVAIAQALPEAIDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 355


>gi|152988097|ref|YP_001349155.1| DNA polymerase III subunits gamma and tau [Pseudomonas aeruginosa
           PA7]
 gi|150963255|gb|ABR85280.1| DNA polymerase III subunit tau [Pseudomonas aeruginosa PA7]
          Length = 681

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLDGDARALLEAVRHLAEQGPDWGGVLAEMLNVLHRVAIAQALPEAIDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 355


>gi|296390101|ref|ZP_06879576.1| DNA polymerase III subunits gamma and tau [Pseudomonas aeruginosa
           PAb1]
          Length = 453

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P  E  
Sbjct: 1   MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPCGECS 60

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 61  ----VCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 116

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 117 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 176

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 177 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 236

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 237 QALLEGDARALLEAVRHLAEQGPDWGGVLAEILNVLHRVAIAQALPEAIDN---GQGDRE 293

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 294 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 338


>gi|92113582|ref|YP_573510.1| DNA polymerase III subunits gamma and tau [Chromohalobacter
           salexigens DSM 3043]
 gi|91796672|gb|ABE58811.1| DNA polymerase III, gamma subunit [Chromohalobacter salexigens DSM
           3043]
          Length = 723

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + + L NA   GR+  +Y+ +GTRG+GKTT ARI+A+ LN +     VP  E E
Sbjct: 18  LVGQEHVSRALVNALDQGRLHHAYLFTGTRGVGKTTLARILAKCLNCRQGVTSVPCGECE 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLST
Sbjct: 78  T----CREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPTQGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F L  +    ++   + ILQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFTLKNMPPERVVGHLSHILQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+ +D +A+ ++ +A+DGS RD +SL DQAIA    ++  + V  ML   D   ++ L 
Sbjct: 194 ESVAYDEQALWLLGKAADGSMRDAMSLTDQAIAFGQGEVRHADVAAMLGTLDHRHLLALA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D   VLQE +S  + G +   IL DLA   H +   + +P   D L     +  
Sbjct: 254 EALAEVDAARVLQEVASLAEQGPDFGGILDDLAGIFHRLAIAQMVP---DALDNGHGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  +   +   +  ++Q+ L+G  ++E    P  A+EM L+R+
Sbjct: 311 TLLPLAARFTAEDVQLYYQIALQGRGDMESAPDPRTALEMTLLRM 355


>gi|58580687|ref|YP_199703.1| DNA polymerase III subunits gamma and tau [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84622621|ref|YP_449993.1| DNA polymerase III subunits gamma and tau [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188578335|ref|YP_001915264.1| DNA polymerase III subunits gamma and tau [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|58425281|gb|AAW74318.1| DNA polymerase III tau and gamma subunits [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84366561|dbj|BAE67719.1| DNA polymerase III tau and gamma subunits [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188522787|gb|ACD60732.1| DNA polymerase III subunit gamma/tau [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 698

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 205/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GQCPACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +++A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIESDLSAIVQLSKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD      ++  L EFS  +      S +L  LAE  H V   + +P +A     
Sbjct: 254 QSLADGDGARLMQVVAALAEFSPDW------SGVLEALAEALHRVQVQQLVPSVAFV--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +      ++ ++    +  ++QM L G  ++     P    EM ++R+
Sbjct: 305 --GDGIDPTPFAAQLRPEVVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 353


>gi|89094005|ref|ZP_01166949.1| DNA polymerase subunits gamma and tau [Oceanospirillum sp. MED92]
 gi|89081679|gb|EAR60907.1| DNA polymerase subunits gamma and tau [Oceanospirillum sp. MED92]
          Length = 632

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 208/351 (59%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ ++K L NA    R+  +Y+ +GTRG+GKT+ AR+ A+SLN +T     P     
Sbjct: 18  MVGQEHVLKALVNALDDDRLHHAYLFTGTRGVGKTSIARLFAKSLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE+++ + Y P   R++VY++DEV MLST
Sbjct: 74  GVCSACKEIAEGRFVDLIEVDAASRTKVEDTRELMENVQYAPTHGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+PIT+LSRC +F+L  +    ++   T +L +
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPITILSRCLQFNLKNLIPERIVNHLTHVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+ ++AR++DGS RD +SL DQAIA    +I  + VR ML   D+  +  + 
Sbjct: 194 EQISFEEPALWLLARSADGSMRDAMSLTDQAIAFGAGQIAETDVRAMLGTIDQRLVYQML 253

Query: 241 GYLIKGDIINVLQ------EFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  GD   ++Q      +FS  Y++      +L DL    H +   + +P+  D    
Sbjct: 254 YSLAAGDANALMQAVTDLAQFSPDYNT------VLGDLVSVLHRIAVAQVLPDAVDN--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           S  +  +  + + ++S   +  ++Q+ L G  ++     P E +EMVL+R+
Sbjct: 305 SMGDQIQITELAGQLSAEDVQLYYQIALMGRKDLPFVPDPREGLEMVLLRM 355


>gi|218892512|ref|YP_002441379.1| DNA polymerase III subunits gamma and tau [Pseudomonas aeruginosa
           LESB58]
 gi|218772738|emb|CAW28523.1| DNA polymerase subunits gamma and tau [Pseudomonas aeruginosa
           LESB58]
          Length = 699

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLS+
Sbjct: 74  GECSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYSPTRGRYKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  T +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKNMPPERVVEHLTHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 194 ENVPFEDDALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGTLDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G +   +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRHLAEQGPDWGGVLAEILNVLHRVAIAQALPEAIDN---GQGDRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++     P    EMVL+R+
Sbjct: 311 RVLALAQALPAEDVQFYYQMGLIGRRDLPLAPDPRSGFEMVLLRM 355


>gi|86160055|ref|YP_466840.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|85776566|gb|ABC83403.1| DNA polymerase III, tau subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 606

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/343 (37%), Positives = 204/343 (59%), Gaps = 6/343 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M GQ+ +++TL+NA K+G++A +++ +G RG+GKTTTAR++A++LN +      PT E  
Sbjct: 18  MSGQEHVVRTLSNALKTGQLAHAFLFTGPRGVGKTTTARLVAKALNCEQG----PTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VDVVE+DAAS+  +D+VR+I++ + Y+P   RF+V+++DEV MLS 
Sbjct: 74  GVCTPCVEIAEGRAVDVVEIDAASNNGVDNVRDIVEAVKYRPARDRFKVFVVDEVHMLSQ 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKF+ ATT++ K+P T+LSRCQRFD  R+++  + +   K+  E
Sbjct: 134 GAFNALLKTLEEPPPHVKFVLATTDVHKVPETILSRCQRFDFRRLTLQQIADQLAKVAAE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +   P A+A++AR ++G  RD LSLLDQ  A C D     +V   L   D   +  + 
Sbjct: 194 EGMRLSPAALALVARQAEGGMRDALSLLDQVRAACGDAPGDDAVAEALGAVDAAAVSRIA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   +L+E  + +D G+    +  +L      V   + +P+    L   +AE A
Sbjct: 254 AALVGRDGAALLREIEALHDRGLEVKRLAEELVRHLRNVVVARLVPQAPIDL--PDAELA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLI 343
                +       L+R + +  + + +++   +P  A+E+ L+
Sbjct: 312 EVRAQAAAADAAQLTRLFDLAQRAVVDVKLAEQPRYALEVALL 354


>gi|119469545|ref|ZP_01612449.1| putative DnaX, DNA polymerase III, gamma/tau subunits
           [Alteromonadales bacterium TW-7]
 gi|119447080|gb|EAW28350.1| putative DnaX, DNA polymerase III, gamma/tau subunits
           [Alteromonadales bacterium TW-7]
          Length = 831

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 204/346 (58%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L NA    R+  +Y+ +GTRG+GKTT ARI A+SLN        P     
Sbjct: 18  LVGQSHVKQALVNALTQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCDEGISASPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS T ++D REI+D + Y P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCTDIEAGRYIDLLEIDAASRTKVEDTREILDNVQYAPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L+ +S  ++      +L +
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLNALSQSEIKTQLQHVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD +A+++IA+A+DGS RD LSL DQAIA+ N  I   +V+ ML L D +    L 
Sbjct: 194 EQLRFDNDALSVIAKAADGSMRDALSLTDQAIAQTNGDINNQAVQAMLGLMDTHYSQSLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   ++ E ++      N   +L DL   THL    + +P+ A      +  NA
Sbjct: 254 AALLSQDGAALMSEIANVASKNPNYIALLDDLISLTHLTQLTQLVPQAAGL----DETNA 309

Query: 301 RALQYSKE-VSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             +++  E  S   +  ++Q++L G  +++    P    EM+L+RL
Sbjct: 310 DYIKHVAEHTSAQQVQVYYQLLLNGKKDLQWAPEPRLGFEMILLRL 355


>gi|311694776|gb|ADP97649.1| DNA polymerase III subunits gamma and tau [marine bacterium HP15]
          Length = 650

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/345 (40%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L +A +S R+  +Y+ +GTRG+GKTT  R++AR LN +T     P     
Sbjct: 18  MVGQEHVLQALIHALESQRLHHAYLFTGTRGVGKTTIGRLLARCLNCETGVTPNPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    CQ I  G  VD++E+DAAS T +DD+RE+ D + Y P   R++VY++DEV ML+ 
Sbjct: 74  GECSSCQEIQEGRFVDLIEIDAASRTGVDDMRELTDNVQYAPTRGRYKVYLIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN  LKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R++   +      +L  
Sbjct: 134 QSFNAFLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRMTPEHIAGHLRHVLGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+ ++ARA+DGS RD LSL DQAIA  N K+  S V  ML   D+  I  + 
Sbjct: 194 EEIPFEEPALWLLARAADGSMRDALSLTDQAIAFGNQKLSASDVSNMLGTIDQRDIERIV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L E S   D   + SVIL DL    H VT  + +P  AD  L  +AE  
Sbjct: 254 NALVEGDGPALLAEISRISDFAPDYSVILADLLSLFHRVTMEQVVPGSADNAL-GDAEQV 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +AL  ++++S      F+Q  L G  ++          EM L+R+
Sbjct: 313 QAL--ARKLSAEDAQLFYQSALIGRKDLTITPDARMGFEMTLLRM 355


>gi|30248450|ref|NP_840520.1| dnaX; DNA polymerase III (subunits tau and gamma) protein
           [Nitrosomonas europaea ATCC 19718]
 gi|30138336|emb|CAD84344.1| dnaX; DNA polymerase III (subunits tau and gamma) protein
           [Nitrosomonas europaea ATCC 19718]
          Length = 525

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 210/351 (59%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L N+ +  R+  +Y+ +GTRG+GKTT ARI+A++LN +      P     
Sbjct: 19  LVGQEHVVRALINSMEQNRLHHAYLFTGTRGVGKTTVARILAKALNCEQGVTAAPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C AI +GN +D++ELDAAS+T +D +RE++D   Y P++AR++VY++DEV MLS 
Sbjct: 75  GKCAACMAIDQGNFIDLIELDAASNTQVDAMRELLDNAQYAPVAARYKVYLIDEVHMLSR 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L +I    ++E  T+IL  
Sbjct: 135 SAFNAMLKTLEEPPEHVKFILATTDPQKIPVTVLSRCLQFNLKQIPPSLIVERLTEILSM 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D   + ++A+A+ GS RD LSLLDQAIA  N  +  S  R ML + D++ I  L 
Sbjct: 195 EGIPADAAGLRLLAQAAKGSLRDALSLLDQAIAFGNSVVNESDTRAMLGVLDQDHIFALL 254

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L + +      I + L+  S  +D        L DLA   H +   + IP+M D    
Sbjct: 255 EALAEQNGAAIFAIADQLEAASVSFDQA------LQDLAALLHRLATAQVIPQMLDE--- 305

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           ++ +  R L  +K  S   +  F+Q++L G +++           M L+R+
Sbjct: 306 TQPDGDRLLALTKRFSPEDIQLFYQIVLHGRTDLAHAPDEYSGFTMTLMRM 356


>gi|194364635|ref|YP_002027245.1| DNA polymerase III subunits gamma and tau [Stenotrophomonas
           maltophilia R551-3]
 gi|194347439|gb|ACF50562.1| DNA polymerase III, subunits gamma and tau [Stenotrophomonas
           maltophilia R551-3]
          Length = 681

 Score =  253 bits (646), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 206/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA  SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +++VY++DEV MLS 
Sbjct: 74  GQCAACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    T+IL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEDQIQGQMTRILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +A+A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EEIEADGSALVQLAKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVAAML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L +GD      ++  L EFS  +      S +L  LAE  H +   + +P        
Sbjct: 254 DALAEGDGPRLLQVVAALAEFSPDW------SGVLEALAEGLHRIQVQQLVPGA-----A 302

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + AE   A  +++ +    +  ++QM L G  ++     P    EM ++R+
Sbjct: 303 AAAEGLDATVFAERLRPEVVQLWYQMALNGRRDLPLAPSPRAGFEMAVLRM 353


>gi|157804256|ref|YP_001492805.1| DNA polymerase III subunits gamma and tau [Rickettsia canadensis
           str. McKiel]
 gi|157785519|gb|ABV74020.1| DNA polymerase III subunits gamma and tau [Rickettsia canadensis
           str. McKiel]
          Length = 544

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 140/391 (35%), Positives = 225/391 (57%), Gaps = 46/391 (11%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLN---------------- 46
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N                
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKTVNCSALITEDTVGNSVKL 86

Query: 47  ----------------------YKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAAS 84
                                 +K+    + T E      +C +    NH D++E+DAAS
Sbjct: 87  KYNEQGAKPIGNRRVTSNNVGKFKSIDYTIRTCEE---CTNCISFNNHNHPDIIEIDAAS 143

Query: 85  HTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATT 144
            TS+DD+R II+   YKP+  + +++I+DEV MLS  AFN LLKTLEEPPPH+ FIFATT
Sbjct: 144 KTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGAFNALLKTLEEPPPHIIFIFATT 203

Query: 145 EIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDG 204
           E++KIP T++SRCQR+DL R+S  ++ +L   I ++E+++ D EA+ +I+  S+GSARD 
Sbjct: 204 EVQKIPATIISRCQRYDLRRLSFEEIFKLLEYITKQENLKADIEALRIISFKSEGSARDA 263

Query: 205 LSLLDQA--IARCNDKIVTSSV-RLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDS 261
           +S+LDQA  ++  +D I++S V   ML L D + I++ F Y+I+ +    +   +  Y  
Sbjct: 264 VSILDQAASMSAKSDNIISSQVINQMLGLVDTSVIIEFFEYIIRRETEKAINLINKLYSF 323

Query: 262 GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMI 321
            VN  + +  +A+F   + ++K +P     L   E+ N R      E+S+ +LS  WQ+ 
Sbjct: 324 SVNLEIFIESVADFIAYLNKVKMLPNYR--LPIYESFNDRIKNILSEISLPYLSILWQIY 381

Query: 322 LKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            KG+ EI+     +   EM++I+  ++  LP
Sbjct: 382 NKGVVEIKISYNQLTETEMLVIKSIYSRSLP 412


>gi|226944093|ref|YP_002799166.1| DNA polymerase III subunits gamma and tau [Azotobacter vinelandii
           DJ]
 gi|226719020|gb|ACO78191.1| DNA-directed DNA polymerase III, gamma and tau subunits
           [Azotobacter vinelandii DJ]
          Length = 694

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 18  MVGQTHVLKALINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGISSSPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS+
Sbjct: 74  GQCSVCREIDEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPTRGRFKVYLIDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    ++E  + +L  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFALKSMPPERVVEHLSHVLAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+ +A+ ++ RA+DGS RD +SL DQAIA    +++ + VR ML   D  ++  + 
Sbjct: 194 EGIPFETDALWLLGRAADGSMRDAMSLTDQAIAFGEGRVLAADVRAMLGALDHGQVYGVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++GD   +L+      + G + S +L ++    H V   + +PE  D     + +  
Sbjct: 254 QALLEGDARALLEAVRQLAEQGPDWSAVLSEMLGVLHRVAIAQVLPEAVDN---GQGDRD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L  ++ +    +  ++QM L G  ++          EMVL+R+
Sbjct: 311 RVLALAQTLPAEDVQFYYQMGLIGRRDLPLAPDSRGGFEMVLLRM 355


>gi|262375322|ref|ZP_06068555.1| DNA polymerase III [Acinetobacter lwoffii SH145]
 gi|262309576|gb|EEY90706.1| DNA polymerase III [Acinetobacter lwoffii SH145]
          Length = 710

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 137/348 (39%), Positives = 211/348 (60%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + LT+A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALTSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGITSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCTAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ E    IL +
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITEHLGNILSK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ESI+ D +A+  IA ++ GS RD LSL DQAIA     I    V+ ML L DR  I DL 
Sbjct: 193 ESIQSDQDAIWQIAESAQGSLRDALSLTDQAIAYGQGVIQHQDVKDMLGLIDRTIIYDLI 252

Query: 241 GYL---IKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             +    K  +  +L +F  Q    ++ S++L  L    H +  ++Y+P++  +L YS  
Sbjct: 253 LAIHQNQKAHVSQLLLQFRQQ---ALDVSLVLDQLISTLHELALLQYLPDL--SLKYSAE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            N + +Q S  +S   L  ++Q+  KG ++++      +  EM ++RL
Sbjct: 308 INQKIMQLSGLISAQDLQLYYQIAYKGRADLQLAVTQEQGFEMTVLRL 355


>gi|221135204|ref|ZP_03561507.1| DNA polymerase III subunits gamma and tau [Glaciecola sp. HTCC2999]
          Length = 834

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 136/346 (39%), Positives = 214/346 (61%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  ++NA  + R+  +Y+ +GTRG+GKTT ARI A+SLN  T     P     
Sbjct: 18  LVGQEHVVTAISNALDNNRLHHAYLFTGTRGVGKTTIARIFAKSLNCDTGLSANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I +G  VD++E+DAAS T +DD RE++D + Y+P    ++VY++DEV MLS 
Sbjct: 74  GECGTCRDIEQGRFVDLLEIDAASRTKVDDTRELLDNVQYRPTQGDYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F+L  +S   + +  + +L +
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFNLKALSREQIQQQLSHVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+A +ARA++GS RD LSL DQAIA+ N++I T  V  ML L D+N+I+ + 
Sbjct: 194 EHINHEPAALAQLARAANGSMRDALSLTDQAIAQGNNQISTVVVSDMLGLMDKNQILKIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +I+GD I V ++  S   +  N + +L +L    H +   + +PE+       E  +A
Sbjct: 254 HSMIEGDKIAVFEQVESLAQTSPNYAHVLDELMSLLHQIAMTQVVPEVCKL----ETISA 309

Query: 301 RAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           RA+ + +  +S   +   +QM L G  ++          EMVL+R+
Sbjct: 310 RAIYKLAGSISKEHVQLLYQMALNGKQDLPHSMDGRSGFEMVLLRM 355


>gi|119505876|ref|ZP_01627941.1| DNA polymerase III subunits gamma and tau [marine gamma
           proteobacterium HTCC2080]
 gi|119458304|gb|EAW39414.1| DNA polymerase III subunits gamma and tau [marine gamma
           proteobacterium HTCC2080]
          Length = 568

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 208/349 (59%), Gaps = 15/349 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +        V  E
Sbjct: 18  MVGQQHVLRALVNALDNDRLHHAYLFTGTRGVGKTTVARILAKCLNCEVG------VGSE 71

Query: 61  GFGE--HCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             GE   C+ I  G  VD++E+DAAS T ++D RE++D + Y P  ARF++Y++DEV ML
Sbjct: 72  PCGECGSCREIAEGRSVDLIEVDAASRTKVEDTRELLDNVQYAPSRARFKIYLIDEVHML 131

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  +FN LLKTLEEPPPH KF+ ATT+ +K+P T+LSRC +F+L  +    ++E   KIL
Sbjct: 132 SNHSFNALLKTLEEPPPHAKFLLATTDPQKLPATILSRCLQFNLKNMLPEQVVEHLEKIL 191

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
            EE++EF+  A+ ++ RA+ GS RD LSL DQAIA  + ++  + VR ML   DR R+++
Sbjct: 192 AEEAVEFESPALTLLGRAAAGSMRDALSLTDQAIAYGSGQLQEADVRDMLGTVDRGRVLE 251

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE--MADTLLYSE 296
           L   + +GD   +L    S  +   + +  L ++    H +T  + +P     DTL    
Sbjct: 252 LMTRVAEGDAAKILACVDSIAEHAPDYASTLEEVISLLHQLTLAQMVPGSLTGDTL---- 307

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            E  +  + +  +S+     F+Q  + G  ++     P  A+EM L+R+
Sbjct: 308 -EENKIRELAATLSLDETQLFYQFAVNGRRDLPVAPDPRIALEMTLLRM 355


>gi|238759223|ref|ZP_04620390.1| DNA polymerase III subunit gamma [Yersinia aldovae ATCC 35236]
 gi|238702510|gb|EEP95060.1| DNA polymerase III subunit gamma [Yersinia aldovae ATCC 35236]
          Length = 655

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 133/344 (38%), Positives = 200/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+LSGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLLSGTRGVGKTTIARLLAKGLNCETGITAAPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCANCREIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +  L  KILQ 
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKAIDVEQIRALLEKILQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA    +I TS+V  ML   D  + + + 
Sbjct: 194 EQITSDARALQLLARAADGSMRDALSLADQAIAMGQGQITTSTVSQMLGSLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       G++   +L +     H +  ++ +P M D   +  A   
Sbjct: 254 EALVSADGAKVMAQVEQAASRGIDWENLLVETLSLLHRIAMVQLLPSMLDN--HYAAIEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPVDIQLYYQTLLMGRKELAYAPDRRMGVEMTLLR 355


>gi|315126896|ref|YP_004068899.1| DnaX, DNA polymerase III, gamma/tau subunits [Pseudoalteromonas sp.
           SM9913]
 gi|315015410|gb|ADT68748.1| putative DnaX, DNA polymerase III, gamma/tau subunits
           [Pseudoalteromonas sp. SM9913]
          Length = 777

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 207/347 (59%), Gaps = 11/347 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L NA    R+  +Y+ +GTRG+GKTT ARI A+SLN        P     
Sbjct: 18  LVGQSHVKQALVNALNQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCDEGISATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS T ++D REI+D + Y P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCVDIEAGRYIDLLEIDAASRTKVEDTREILDNVQYAPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L+ +S  ++ +    +L +
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLNALSQAEIKQQLEHVLTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD +A+++IA+A+DGS RD LSL DQAIA+ N  I   +V+ ML L D +    L 
Sbjct: 194 EQLNFDNDALSIIAKAADGSMRDALSLTDQAIAQTNGDINNQAVQAMLGLMDTHYSQSLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMA--DTLLYSEAE 298
             L+  D   ++ E +       N   +L DL   TH++   + +PE A  D+      +
Sbjct: 254 AALLAQDGAALMAEVAQVASRNPNYIALLDDLIALTHIIQLSQLVPEAAALDSNNADYIK 313

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +  A  +++++ +     ++Q++L G  +++    P    EM+++RL
Sbjct: 314 HVAAHTHAQQIQV-----YYQLLLNGKKDLQWAPEPRLGFEMIMLRL 355


>gi|285017408|ref|YP_003375119.1| DNA polymerase III tau and gamma subunits protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472626|emb|CBA15131.1| probable dna polymerase III tau and gamma subunits protein
           [Xanthomonas albilineans]
          Length = 611

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 204/352 (57%), Gaps = 22/352 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LTNA  SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALTNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GKCAACLDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+    +    TKIL  
Sbjct: 134 AAFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEMQIQGQMTKILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +A+A+DGS RDGLSLLDQAIA     +    VR ML   DR ++  + 
Sbjct: 194 EQIEVDASAIVQLAKAADGSLRDGLSLLDQAIAYAGGALREDVVRTMLGTVDRTQVGAML 253

Query: 241 GYLIKGDIINVLQ------EFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMA-DTLL 293
             L+  D   +LQ      EFS  +        +L  LAE  H +   + +P  A DTL 
Sbjct: 254 DALVDADGARLLQVVAGLAEFSPDWGG------VLEALAETLHRIQVRQLVPGAALDTL- 306

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
               +       ++ +    +  ++QM L G  ++     P    EM ++R+
Sbjct: 307 ----DGLDLAPLAERLRPEIVQLWYQMALNGRRDLYLAPSPRAGFEMAVLRM 354


>gi|88607446|ref|YP_505851.1| DNA polymerase III, subunits gamma and tau [Anaplasma
           phagocytophilum HZ]
 gi|88598509|gb|ABD43979.1| DNA polymerase III, subunits gamma and tau [Anaplasma
           phagocytophilum HZ]
          Length = 456

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 209/365 (57%), Gaps = 19/365 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L N+F  G +    ++ G  G+GKTT ARI++  LN +      PT    
Sbjct: 15  LVGQDVLVRILRNSFSVGNLNTPLLMVGASGVGKTTCARIVSLCLNCENG----PTSSPC 70

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C +I   ++ DVVE+DAAS+TS+DD+R I++   Y P+S+RF+VYI+DEV MLST
Sbjct: 71  GTCATCTSIKNSHNPDVVEMDAASNTSVDDIRVILESSNYLPVSSRFKVYIIDEVHMLST 130

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLE P  H KFI ATTE+RK+P+TV SRC R DL ++ I  L +   KI  +
Sbjct: 131 SAFNALLKTLESPAQHAKFIMATTEVRKVPVTVASRCLRLDLGKLPIKQLYDHLVKISAK 190

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  D  ++ +IA  S GS R+ L LL+QA+   N+KI    VR +L   D+  +  + 
Sbjct: 191 ENIAHDESSLMLIAENSSGSVRNSLFLLEQALIYSNNKISLQEVRELLGCVDKKILEGIV 250

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIK----YIPEMADTLLYSE 296
             +I  D+ + +  F    ++   P +I   + +  + +        +   + + L  +E
Sbjct: 251 RDIISSDVKSAIDGFRELCNAST-PVIIFEGMQKVVYGLCMYSIDKDFHHGLGEELFTAE 309

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
                     K  S  FLSR WQ++L GI EI+    P +A EM+++RL +   LPSP++
Sbjct: 310 ----------KSGSTPFLSRLWQLVLHGIQEIKSSESPEQAGEMLIVRLCYLSDLPSPQK 359

Query: 357 IARYI 361
           IA  I
Sbjct: 360 IASSI 364


>gi|157826351|ref|YP_001494071.1| DNA polymerase III subunits gamma and tau [Rickettsia akari str.
           Hartford]
 gi|157800309|gb|ABV75563.1| DNA polymerase III subunits gamma and tau [Rickettsia akari str.
           Hartford]
          Length = 509

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 215/353 (60%), Gaps = 5/353 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+A  Y+L+G RG+GKTT+ARIIA+++N      +  T++    
Sbjct: 27  GQEVLVKVLSYTILNDRLAGGYLLTGIRGVGKTTSARIIAKAVNCSALITENTTIKTCEE 86

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TS+DD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 87  CTNCISFNNHNHPDIIEIDAASKTSVDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 146

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPH+ FIFATTE++KIP T++SRCQR+DL R++  ++ +L   I ++E+
Sbjct: 147 FNALLKTLEEPPPHIIFIFATTEVQKIPATIISRCQRYDLRRLNFEEIFKLLEYIAKQEN 206

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           ++ D E++ +IA  S+GSARD +S+LDQA    A+ ++ I    +  +L L D + I++ 
Sbjct: 207 LKTDIESLRIIAYKSEGSARDAVSILDQAASMSAKSDNIISPQVINQILGLVDTSVIIEF 266

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             Y+I  +    +   +  Y   VN  + +  +A+F   + + K +     +L   E+ N
Sbjct: 267 VEYIIHRETEKAINLINKLYGFSVNLEIFIESVADFIAYLNKAKMLHNY--SLPIYESFN 324

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
            R       +S+  LS  WQ+  KG+ EI+     +   EM++I+  ++  LP
Sbjct: 325 DRTNSILDTISLPHLSILWQIYNKGVVEIKSSYNQLTETEMLVIKSIYSTSLP 377


>gi|299769631|ref|YP_003731657.1| DNA polymerase III, tau and gamma subunits [Acinetobacter sp. DR1]
 gi|298699719|gb|ADI90284.1| DNA polymerase III, tau and gamma subunits [Acinetobacter sp. DR1]
          Length = 717

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/348 (38%), Positives = 212/348 (60%), Gaps = 12/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++      IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITRHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQINADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             + +     +  +L +F  Q    ++ S++L  L    H +  ++Y+P++  +L YS+ 
Sbjct: 253 LAIHQNQREKVSQLLLQFRHQ---ALDVSLVLDQLISTLHELAILQYLPDL--SLKYSDE 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            N + +Q SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 308 INRKIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|300113235|ref|YP_003759810.1| DNA polymerase III gamma and tau subunit [Nitrosococcus watsonii
           C-113]
 gi|299539172|gb|ADJ27489.1| DNA polymerase III, subunits gamma and tau [Nitrosococcus watsonii
           C-113]
          Length = 529

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 209/345 (60%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LTN    GR+  +++ +GTRG+GKTT ARI+A+SLN K      P     
Sbjct: 18  VVGQEQVVRALTNGLDKGRLHHAFLFTGTRGVGKTTLARILAKSLNCKEGVRSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++CQAI  GN VD++E+DAAS T +DD RE+++ ++Y P    ++VY++DEV M ST
Sbjct: 74  GKCQNCQAIDGGNFVDLIEVDAASRTGVDDTRELLENVHYAPSRGHYKVYLIDEVHMFST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPH+KF+ ATT+ +K+P+TVLSRC +F+L RI+   + E   +ILQ 
Sbjct: 134 SSFNALLKTLEEPPPHIKFLLATTDPKKLPVTVLSRCLQFNLRRIASKVIAEHLARILQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +  A+ +IARA++GS RD LSLLDQAI     +++ + V  ML   ++  +  L 
Sbjct: 194 EKIPSESHALTLIARAAEGSVRDALSLLDQAINYGGGQVIVADVYAMLGSIEQGELFILL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ GD   ++++        V+ S +L DL      +   +  P+  D +   E  + 
Sbjct: 254 DALLAGDGQGLIEKVREICAYSVDVSSMLADLLHLLQRLALYQLAPDTIDDIDERETFSN 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            A + + E     +  F+Q+ L G  ++     P  A EM+L+R+
Sbjct: 314 LATRITAEE----VQLFYQIGLIGSRDLTYAPDPHTAFEMILLRM 354


>gi|325122590|gb|ADY82113.1| DNA polymerase III, tau and gamma subunits (DNA elongation factor
           III) [Acinetobacter calcoaceticus PHEA-2]
          Length = 685

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++  +L YS+  N 
Sbjct: 253 LAIHQNQREKVSQLLLQFRHQALDVSLVLDQLISTLHELAILQYLPDL--SLKYSDEINR 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + +Q SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 311 KIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|293609325|ref|ZP_06691627.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827777|gb|EFF86140.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 721

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGAILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQITADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSVHHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++  +L YS+  N 
Sbjct: 253 LAIHQNQREKVSQLLLQFRHQALDVSLVLDQLISTLHELAILQYLPDL--SLKYSDEINR 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + +Q SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 311 KIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|307256293|ref|ZP_07538076.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306865119|gb|EFM97019.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 465

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESAAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|307258490|ref|ZP_07540227.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867394|gb|EFM99245.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 466

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESAAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|262279434|ref|ZP_06057219.1| DNA polymerase III [Acinetobacter calcoaceticus RUH2202]
 gi|262259785|gb|EEY78518.1| DNA polymerase III [Acinetobacter calcoaceticus RUH2202]
          Length = 689

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 209/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L++A + GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 17  LVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGVTSTPC---- 72

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+A+  G  +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 73  EVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFKVYLIDEVHMLST 132

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+FATT+ +K+PITV+SRC +F L  +++ ++ +    IL++
Sbjct: 133 HSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVDEITKHLGTILEK 192

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D +A+  IA ++ GS RD LSL DQAIA     +    V+ ML L DR  I DL 
Sbjct: 193 EQIVSDQDAIWQIAESAQGSLRDALSLTDQAIAYGQGAVQHQDVKEMLGLIDRTIIYDLI 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +     V Q         ++ S++L  L    H +  ++Y+P++  +L YS+  N 
Sbjct: 253 LAIHQNQREKVSQLLLQFRHQALDVSLVLDQLISTLHELAILQYLPDL--SLKYSDEINR 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + +Q SK +S   L  ++Q+  KG S+++      +  EM ++RL
Sbjct: 311 KIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRL 355


>gi|303252503|ref|ZP_07338666.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302648471|gb|EFL78664.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 679

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 9   VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 64

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 65  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 124

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 125 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 184

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 185 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQKMLGLIDDHQPIELV 244

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 245 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 296

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EEI R
Sbjct: 297 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEEINR 355

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 356 HPVMEAAKAT 365


>gi|165975723|ref|YP_001651316.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|307245079|ref|ZP_07527172.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307254034|ref|ZP_07535881.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|165875824|gb|ABY68872.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|306853968|gb|EFM86180.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306862959|gb|EFM94906.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
          Length = 688

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESAAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|303249577|ref|ZP_07335784.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307251796|ref|ZP_07533698.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651651|gb|EFL81800.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306860703|gb|EFM92714.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 685

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EEI R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEEINR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|118594959|ref|ZP_01552306.1| DNA-directed DNA polymerase [Methylophilales bacterium HTCC2181]
 gi|118440737|gb|EAV47364.1| DNA-directed DNA polymerase [Methylophilales bacterium HTCC2181]
          Length = 544

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 214/352 (60%), Gaps = 22/352 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+  ++ + NA    R+  +Y+ +GTRGIGKTT ARI+A+SLN +      P +   
Sbjct: 18  LIGQESAVQAIANALDQNRLHHAYLFNGTRGIGKTTIARILAKSLNCEQGISSKPCLTCS 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                CQ I  G +VD++ELDAAS+T +D++ ++++   Y P S RF+VYI+DEV MLS 
Sbjct: 78  A----CQEIDVGRYVDLIELDAASNTGVDNMIDLLENAQYAPSSGRFKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATTE +K+PITVLSRC +F+L +++  ++    T IL E
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTEPQKVPITVLSRCLQFNLKQMTTENIASHLTSILTE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +  A+ +IA+A++GS RD LS+LDQAIA  ++KI T  V  ML   + + + D+ 
Sbjct: 194 EKIGSESGAIQIIAKAANGSMRDALSILDQAIAYSSEKISTEKVTQMLGTIEDDILFDII 253

Query: 241 GYLI----KG--DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
            +LI    KG  DI   ++E ++ +D  +N       LA+  H +   K IP+      Y
Sbjct: 254 KHLIDKNGKGLTDIAKAMEEKNTSFDDALN------GLAKLVHELAVCKIIPDQ-----Y 302

Query: 295 SEAENARAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +E+       +++K+++   L  F+Q+ + G  ++     P+    M L+R+
Sbjct: 303 AESSKKNLYEEFAKKLTGETLQLFYQISINGRKDLYLAPDPITGFTMTLLRM 354


>gi|15604695|ref|NP_221213.1| DNA polymerase III subunits gamma and tau [Rickettsia prowazekii
           str. Madrid E]
 gi|3861390|emb|CAA15289.1| DNA POLYMERASE III SUBUNITS GAMMA AND TAU (dnaX) [Rickettsia
           prowazekii]
 gi|292572530|gb|ADE30445.1| DNA polymerase III gamma and tau chains [Rickettsia prowazekii
           Rp22]
          Length = 541

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 135/356 (37%), Positives = 216/356 (60%), Gaps = 10/356 (2%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
           GQ+ ++K L+    + R+   Y+L+G RGIGKTT+ARIIA+++N      +   ++    
Sbjct: 60  GQEVLVKILSYTILNDRLVGGYLLTGIRGIGKTTSARIIAKAVNCSALITENTAIKTCEK 119

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAA 122
             +C +    NH D++E+DAAS TSIDD+R II+   YKP+  + +++I+DEV MLS  A
Sbjct: 120 CTNCVSFNNHNHPDIIEIDAASKTSIDDIRRIIESAEYKPLQGKHKIFIIDEVHMLSKGA 179

Query: 123 FNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEES 182
           FN LLKTLEEPPPHV FIFATTE++K+P T++SRCQR+DL R+S  ++ +L   I ++E+
Sbjct: 180 FNALLKTLEEPPPHVIFIFATTEVQKVPSTIISRCQRYDLRRLSFEEIFKLLQYITKQEN 239

Query: 183 IEFDPEAVAMIARASDGSARDGLSLLDQAI---ARCNDKIVTSSVRLMLALADRNRIMDL 239
           +  D EA+ +IA  S+GSARD +S+LDQA    A+  + I    +  ML L D + I++ 
Sbjct: 240 LIADVEALRIIAHKSEGSARDAVSILDQAASMSAKSGNIISPQIINQMLGLVDTSFILEF 299

Query: 240 FGYLIKGDI---INVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSE 296
              +I  +    IN++ +    Y   +N    +  +A+F   + ++K +P  +  L   E
Sbjct: 300 IENIISRETEKAINLINKL--YYGFSINLETFIKSVADFIAYLNKVKILPNYS--LPIYE 355

Query: 297 AENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLP 352
           + N R      ++S+  LS  WQ+  KG++EI+     +   EM++I+  ++  LP
Sbjct: 356 SFNYRTKSILDKISLPHLSILWQIYNKGVTEIKISYNQLIETEMLVIKSIYSTSLP 411


>gi|52424926|ref|YP_088063.1| DNA polymerase III subunits gamma and tau [Mannheimia
           succiniciproducens MBEL55E]
 gi|52306978|gb|AAU37478.1| DnaX protein [Mannheimia succiniciproducens MBEL55E]
          Length = 693

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 207/353 (58%), Gaps = 29/353 (8%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L+N  +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     +D  T E  
Sbjct: 18  VVGQEHILAALSNGLRENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----MDGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   HC+AI  GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GKCAHCKAIEEGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F+L  +    +      IL+E
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCMQFNLKALDQKQISHHLQHILKE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    VR+ML L D N+ +++ 
Sbjct: 194 EEIPYEMTALDKLAKAARGSIRDSLSLTDQAIAMSNGNISRDVVRVMLGLLDDNQPIEIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+  N+++   +  D G N   +L ++ E  H +   + +P  ++          
Sbjct: 254 YALQQGNGENLMKVIQAVADKGGNWDELLIEVGETLHQIAMQQLLPSTSN---------- 303

Query: 301 RALQYSKEVSITFLSR---------FWQMILKGISEIEGFSRPMEAVEMVLIR 344
                  E  I FL++         F+Q+++ G  E+     P   VEM L+R
Sbjct: 304 ------DETQIGFLAKHIAPEDVQLFYQIVVNGRKELAFAPNPRIGVEMTLLR 350


>gi|307247251|ref|ZP_07529300.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306856224|gb|EFM88378.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 688

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQKMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EEI R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEEINR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|39995205|ref|NP_951156.1| DNA polymerase III subunits gamma and tau [Geobacter sulfurreducens
           PCA]
 gi|39981967|gb|AAR33429.1| DNA polymerase III, gamma and tau subunits [Geobacter
           sulfurreducens PCA]
 gi|298504210|gb|ADI82933.1| DNA polymerase III, gamma and tau subunits [Geobacter
           sulfurreducens KN400]
          Length = 579

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 133/346 (38%), Positives = 202/346 (58%), Gaps = 4/346 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ + +TL NA  SGRIA +++ +G RG+GKT++ARI+A++LN +      P     
Sbjct: 18  LTGQEHVSRTLQNAIDSGRIAHAFLFTGARGVGKTSSARILAKALNCEQGMSPEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G  VDV+E+D AS+T +DD+RE+ + + Y P   R++++I+DEV MLST
Sbjct: 74  NVCPACTEITAGTSVDVLEIDGASNTGVDDIRELRENVKYLPSRLRYKIFIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHVKFIFATTE  K+PIT+LSRCQRFD  RI +  ++     I+  
Sbjct: 134 NAFNALLKTLEEPPPHVKFIFATTEPHKLPITILSRCQRFDFRRIPLAKVVARLRYIVDR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I    E++A++AR  DGS RD LS+LDQ +A C + +    V  +L + DR  +++  
Sbjct: 194 EGISISDESLAVVARKGDGSMRDSLSVLDQVLAFCGETVNDDDVVSLLGVVDRRLLLEAS 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D  +VL   +   + G N      +L +    +T ++ + +  D L  SEAE  
Sbjct: 254 AAVLGRDTRSVLGVVARVDEFGYNMRQFCGELIDHFRNLTIMRAVGDAGDLLDLSEAELQ 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
              + +    +  L R   ++L+   E+     P   +EM L+R+A
Sbjct: 314 SVREQASSALLEDLQRHMTILLRADGELAHSGYPRLVLEMALVRMA 359


>gi|71275385|ref|ZP_00651671.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71898557|ref|ZP_00680728.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|170730362|ref|YP_001775795.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa M12]
 gi|71163685|gb|EAO13401.1| DNA-directed DNA polymerase [Xylella fastidiosa Dixon]
 gi|71731681|gb|EAO33741.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|167965155|gb|ACA12165.1| DNA-directed DNA polymerase [Xylella fastidiosa M12]
          Length = 601

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 205/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA +SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALESGRLHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GRCTACLDIDVGRYIDLLEIDAASNTGVDDVREMIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F+L R+    +     KIL  
Sbjct: 134 AAFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEEQIQRQIAKILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+  +++A+DGS RDGLSLLDQAIA     +   +VR ML   DR ++  + 
Sbjct: 194 EQITADDAAIIELSKAADGSLRDGLSLLDQAIAYAGGTLREGAVRDMLGTVDRTQVEVML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             LI GD      +I  L EFS  +        +L  LAE  H +   + +P +   +  
Sbjct: 254 AALIAGDGDRLLRVIATLAEFSPDWGG------VLEALAEALHRIQVQQLVPSV---VFA 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            +  N   L    +  +  L  ++QM + G  ++     P    EM ++R+
Sbjct: 305 GDGLNVALLAEQTQPEVVQL--WYQMAINGRHDLHLAPSPRVGFEMAVLRM 353


>gi|307249479|ref|ZP_07531467.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306858472|gb|EFM90540.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 466

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|32035419|ref|ZP_00135390.1| COG2812: DNA polymerase III, gamma/tau subunits [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207753|ref|YP_001052978.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae L20]
 gi|126096545|gb|ABN73373.1| DNA polymerase III subunit gamma/tau [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 688

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|307262856|ref|ZP_07544480.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306871761|gb|EFN03481.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 466

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|77360144|ref|YP_339719.1| DnaX, DNA polymerase III, gamma/tau subunits [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76875055|emb|CAI86276.1| putative DnaX, DNA polymerase III, gamma/tau subunits
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 842

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L NA    R+  +Y+ +GTRG+GKTT ARI A+SLN        P     
Sbjct: 18  LVGQSHVKQALVNALTQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCDEGISANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G ++D++E+DAAS T ++D REI+D + Y P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCKDIEAGRYIDLLEIDAASRTKVEDTREILDNVQYAPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L+ +S  ++      +L  
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLNALSQSEIKTQLEHVLTH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD +A+ +IA+A+DGS RD LSL DQAIA+ N  I   +V+ ML L D +    L 
Sbjct: 194 EKLNFDDDALRIIAKAADGSMRDALSLTDQAIAQTNGDINNQAVQTMLGLMDTHYSQSLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   +++E ++      N   +L DL   THL    + +PE A      E    
Sbjct: 254 AALLAQDGAALMKEVANVASRNPNYVALLDDLIALTHLTQLSQLVPEAA---ALDETNAD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
                ++  +   +  ++Q++L G  +++    P    EM+++RL
Sbjct: 311 YITHVAQNTNPQQIQIYYQLLLNGKKDLQWAPEPRLGFEMIMLRL 355


>gi|190149536|ref|YP_001968061.1| DNA polymerase III subunit gamma/tau [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|189914667|gb|ACE60919.1| DNA polymerase III subunit gamma/tau [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 688

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQQMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|71900519|ref|ZP_00682648.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
 gi|71729695|gb|EAO31797.1| DNA-directed DNA polymerase [Xylella fastidiosa Ann-1]
          Length = 541

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 205/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA +SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALESGRLHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GRCTACLDIDVGRYIDLLEIDAASNTGVDDVREMIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F+L R+    +     KIL  
Sbjct: 134 AAFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEEQIQRQIAKILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+  +++A+DGS RDGLSLLDQAIA     +   +VR ML   DR ++  + 
Sbjct: 194 EQITADDAAIIELSKAADGSLRDGLSLLDQAIAYAGGTLREGAVRDMLGTVDRTQVEVML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             LI GD      +I  L EFS  +        +L  LAE  H +   + +P +   +  
Sbjct: 254 AALIAGDGDRLLRVIATLAEFSPDWGG------VLEALAEALHRIQVQQLVPSV---VFA 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            +  N   L    +  +  L  ++QM + G  ++     P    EM ++R+
Sbjct: 305 GDGLNVALLAEQTQPEVVQL--WYQMAINGRHDLHLAPSPRVGFEMAVLRM 353


>gi|307260724|ref|ZP_07542413.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306869563|gb|EFN01351.1| DNA polymerase III subunits gamma and tau [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 466

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQAQIANHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I ++  A+  +A+A+ GS RD LSL DQAIA  N  I    V+ ML L D ++ ++L 
Sbjct: 194 ENIPYESVAIEKLAKAAQGSIRDSLSLTDQAIAVSNANISLPIVQKMLGLIDDHQPIELV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    +    S  + G++ S +L D+A+  H +  ++        LL +  +  
Sbjct: 254 TALAQADGEKAMAVIQSVAEKGIDWSQLLSDIAQTLHQIAMLQ--------LLKNNGQEQ 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIAR 359
             L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE+ R
Sbjct: 306 TQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRTEELNR 364

Query: 360 YIVEEKKKKT 369
           + V E  K T
Sbjct: 365 HPVMEAAKAT 374


>gi|28198956|ref|NP_779270.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa
           Temecula1]
 gi|182681665|ref|YP_001829825.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa M23]
 gi|28057054|gb|AAO28919.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa
           Temecula1]
 gi|182631775|gb|ACB92551.1| DNA polymerase III, subunits gamma and tau [Xylella fastidiosa M23]
 gi|307580101|gb|ADN64070.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 543

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 205/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA +SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALESGRLHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GRCTACLDIDVGRYIDLLEIDAASNTGVDDVREMIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F+L R+    +     KIL  
Sbjct: 134 AAFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEEQIQRQIAKILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+  +++A+DGS RDGLSLLDQAIA     +   +VR ML   DR ++  + 
Sbjct: 194 EQITADDTAIIELSKAADGSLRDGLSLLDQAIAYAGGTLREGAVRDMLGTVDRTQVEVML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             LI GD      +I  L EFS  +        +L  LAE  H +   + +P +   +  
Sbjct: 254 AALIAGDGDRLLRVIATLAEFSPDWGG------VLEALAEALHRIQVQQLVPSV---VFA 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            +  N   L    +  +  L  ++QM + G  ++     P    EM ++R+
Sbjct: 305 GDGLNVALLAEQTQPEVVQL--WYQMAINGRHDLHLAPSPRVGFEMAVLRM 353


>gi|238788050|ref|ZP_04631846.1| DNA polymerase III subunit gamma [Yersinia frederiksenii ATCC
           33641]
 gi|238723998|gb|EEQ15642.1| DNA polymerase III subunit gamma [Yersinia frederiksenii ATCC
           33641]
          Length = 655

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +  L  KILQ 
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRALLEKILQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA  +  + T++V  ML   D  + + + 
Sbjct: 194 EQISSDARALQLLARAADGSMRDALSLTDQAIAMGDGSVTTTTVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       G++   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQLEQAASRGIDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM  +R
Sbjct: 312 RLRELARTLPPTDIQLYYQTLLVGRKELAFAPDRRMGVEMTFLR 355


>gi|15838406|ref|NP_299094.1| DNA polymerase III subunits gamma and tau [Xylella fastidiosa 9a5c]
 gi|9106885|gb|AAF84614.1|AE004002_4 DNA polymerase III subunit [Xylella fastidiosa 9a5c]
          Length = 608

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 205/351 (58%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L+NA +SGR+  +++ +GTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  LVGQEHVVRALSNALESGRLHHAFLFTGTRGVGKTTIARIFAKSLNCEQGTSADPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +F+VY++DEV MLS 
Sbjct: 74  GRCTACLDIDVGRYIDLLEIDAASNTGVDDVREMIENAQYMPSRGKFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F+L R+    +     KIL  
Sbjct: 134 AAFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEEQIQRQIAKILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+  +++A+DGS RDGLSLLDQAIA     +   +VR ML   DR ++  + 
Sbjct: 194 EQITADDAAIIELSKAADGSLRDGLSLLDQAIAYAGGVLREGAVRDMLGTVDRTQVEVML 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             LI GD      +I  L EFS  +        +L  LAE  H +   + +P +   +  
Sbjct: 254 AALIAGDGDRLLRVIATLAEFSPDWGG------VLEALAEALHRIQVQQLVPSV---VFA 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            +  N   L    +  +  L  ++QM + G  ++     P    EM ++R+
Sbjct: 305 GDGLNVALLAEQTQPEVVQL--WYQMAINGRHDLHLAPSPRVGFEMAVLRM 353


>gi|295676458|ref|YP_003604982.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp.
           CCGE1002]
 gi|295436301|gb|ADG15471.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp.
           CCGE1002]
          Length = 838

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 207/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  + +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 ENVPHEAQALRLLARAADGSMRDALSLTDQAIAYSANQVSEDAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   VL          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAQGDGAAVLAVADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +++  +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFADALSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|126667422|ref|ZP_01738394.1| DNA polymerase III subunits gamma and tau [Marinobacter sp. ELB17]
 gi|126628178|gb|EAZ98803.1| DNA polymerase III subunits gamma and tau [Marinobacter sp. ELB17]
          Length = 622

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 138/346 (39%), Positives = 202/346 (58%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L +A +S R+  +Y+ +GTRG+GKTT  R++AR LN +T     P     
Sbjct: 18  MVGQEHVLQALIHALESQRLHHAYLFTGTRGVGKTTIGRLLARCLNCETGITAKPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T +DD+RE+ D + Y P   RF+VY++DEV ML+ 
Sbjct: 74  GVCGSCREIQEGRFVDLIEIDAASRTGVDDMRELTDNVQYSPTRGRFKVYLIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN  LKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R++   +      +L  
Sbjct: 134 QSFNAFLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRMTPEHIAGHLNHVLTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+ ++ARA+DGS RD LSL DQAIA  N ++  S V  ML   ++  I  L 
Sbjct: 194 EKIPFEEPALWLLARAADGSMRDALSLTDQAIAFGNQQLAASDVSSMLGTINQRDIESLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G L+  D   +L E     D   +  VIL DL    H VT  + +P  AD  L     +A
Sbjct: 254 GTLVARDGPALLTEIGRIADFAPDYGVILADLLSLFHRVTMEQVVPGSADNALG----DA 309

Query: 301 RALQ-YSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R +Q  +K++S      F+Q+ L G  ++          EM L+R+
Sbjct: 310 RQIQALAKKLSAEDAQLFYQVALMGRKDLAITPDARMGFEMTLLRM 355


>gi|109899204|ref|YP_662459.1| DNA polymerase III, subunits gamma and tau [Pseudoalteromonas
           atlantica T6c]
 gi|109701485|gb|ABG41405.1| DNA polymerase III, tau subunit / DNA polymerase III, gamma subunit
           [Pseudoalteromonas atlantica T6c]
          Length = 914

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/346 (37%), Positives = 208/346 (60%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  ++NA  + R+  +Y+ +GTRG+GKTT ARI ++SLN +      P     
Sbjct: 18  LVGQEHVVAAISNALDNDRLHHAYLFTGTRGVGKTTIARIFSKSLNCELGMGSKPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +GN VD++E+DAAS T ++D RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GKCSTCVEIEQGNFVDLLEIDAASRTKVEDTRELLDNVQYRPSRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+PIT+LSRC +F+L  +S   + +    +  +
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPITILSRCLQFNLKALSRAQIAQQLQHVFAQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++  PEA+A IARA+ GS RD LSL DQAIA+ N  +  S V  ML L D+ +++ L 
Sbjct: 194 EQLQNAPEALAQIARAAQGSMRDALSLSDQAIAQGNGNVSLSIVTDMLGLMDKTQVLKLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++     +V +      +  V+ S +L++L    H V   +++P+        E  +A
Sbjct: 254 NAVLNKQNESVFELVDFMSEQAVDYSQVLNELMSLLHQVALTQFVPDACKL----ETISA 309

Query: 301 RAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           RA+ Q +K      +   +Q+ L+G  ++   +     +EM L+R+
Sbjct: 310 RAIYQLAKNALPEHIQLLYQIALQGKRDMPFAADARTGLEMTLLRM 355


>gi|254490491|ref|ZP_05103677.1| DNA polymerase III, subunits gamma and tau, putative [Methylophaga
           thiooxidans DMS010]
 gi|224464235|gb|EEF80498.1| DNA polymerase III, subunits gamma and tau, putative [Methylophaga
           thiooxydans DMS010]
          Length = 569

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/358 (36%), Positives = 212/358 (59%), Gaps = 9/358 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L N     R+  +++ SGTRG+GKTT ARI A+SLN +      P     
Sbjct: 18  VVGQQHVLRALINGLDQNRLHHAFLFSGTRGVGKTTLARIFAKSLNCEQGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C  +  G  VD++E+DAAS T +DD RE++D + Y P   R++VY++DEV MLST
Sbjct: 74  GVCQSCTEVDSGRFVDLIEVDAASRTKVDDTRELLDNVQYAPSQGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+FATT+ +K+P+T+LSRC +F+L R+ +  + +    +L++
Sbjct: 134 SSFNALLKTLEEPPPHVKFLFATTDPQKLPVTILSRCLQFNLRRLELTQISDHLRYLLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I+ +PEA+  +ARA+DGS RD LSLLDQAIA    ++ + SV  ML    +++++ + 
Sbjct: 194 ETIKAEPEALEQLARAADGSMRDALSLLDQAIAFGGGEVTSESVFQMLGSISQDQLILIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+K D   +L + +     G +  V+   L      +  ++ +P++      S     
Sbjct: 254 DALLKQDGKALLAQSAELAALGRDFHVVFDFLLSALQQIATLQLVPDLEPVEANSPQLTE 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
            A Q+  E     +   +Q+ L G  ++   + P    +M L+R+  + Q  +P E+ 
Sbjct: 314 LAAQFDPET----IQLLYQIALHGKRDLSWAADPKSGFDMTLMRML-SFQPTTPPEVG 366


>gi|167587030|ref|ZP_02379418.1| DNA polymerase III subunits gamma and tau [Burkholderia ubonensis
           Bu]
          Length = 371

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAGDGTEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAP---GSVLEEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 311 DLRRFAQTLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|253996278|ref|YP_003048342.1| DNA polymerase III subunits gamma and tau [Methylotenera mobilis
           JLW8]
 gi|253982957|gb|ACT47815.1| DNA polymerase III, subunits gamma and tau [Methylotenera mobilis
           JLW8]
          Length = 564

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ LTNA +  R+  +Y+ +GTRG+GKTT ARI+A+SLN +T     P     
Sbjct: 18  LVGQDHVVRALTNALEQNRLHHAYLFTGTRGVGKTTLARILAKSLNCETGITAKPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS+T +D +R+++D   Y P + RF+VYI+DEV MLS 
Sbjct: 74  GVCNACTEIDKGRFVDLIEVDAASNTQVDAMRDLLDNAQYAPTAGRFKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +K+P+TVLSRC +F+L +++   +      IL +
Sbjct: 134 SAFNAMLKTLEEPPAHVKFILATTDPQKVPVTVLSRCLQFNLRQMAGTSITSHLQNILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+P A+ +I+RA+ GS RD LSL DQAIA     +  S VR ML   D++ +  L 
Sbjct: 194 ENIAFEPTALHLISRAAAGSMRDALSLTDQAIAYGGQTVHESEVRAMLGAIDQSYLYQLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D  +++ +  +  +  ++     +DLA+  H +   + +PE   ++ +   E  
Sbjct: 254 DALLVNDGNSLINQAKAMEERSISFDAAFNDLAQLLHQIAVAQTVPE---SVAHDLPERE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  ++ +    L  ++Q+ L G  +I           M L+R+
Sbjct: 311 ALLSLAQRIPAETLQLYYQIALLGRRDIGLAPDEFAGFTMSLLRM 355


>gi|94264278|ref|ZP_01288072.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1]
 gi|93455323|gb|EAT05530.1| DNA-directed DNA polymerase [delta proteobacterium MLMS-1]
          Length = 706

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/360 (37%), Positives = 209/360 (58%), Gaps = 4/360 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+P+++TL NA +  R+A + + +G RG+GKTT AR++A++LN +      P     
Sbjct: 18  VVGQRPVVRTLQNALRLQRVAHAMLFAGVRGVGKTTLARLMAKALNCQEPE---PASRPC 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              + CQ I  G  VD+ E+D AS+  I ++RE+ + I + P+SA +++ I+DEV ML+T
Sbjct: 75  NQCKSCQEINAGAAVDLHEIDGASNRGIQEIRELKENIRFLPVSASYKIVIIDEVHMLTT 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HV F+FATTE+ KIPIT+LSRCQR++L R++  +L+  F ++   
Sbjct: 135 EAFNALLKTLEEPPAHVYFMFATTELHKIPITILSRCQRYELTRVAYDELLAFFRQVAAR 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +     A+AMI+R +DGS RDGLSLLDQ  +  +  I    VR +L L DR     L 
Sbjct: 195 EEVTISEAALAMISREADGSVRDGLSLLDQVFSFADGGIDDDDVRQLLGLVDRRVFAQLA 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G++   L+ F     +G+N      DL ++   +   +        L   E E  
Sbjct: 255 RALLAGELGRALEIFDRGQRAGMNLKRFAADLLDYFRNLVVCRATAGARQLLELGEQELV 314

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQL-PSPEEIAR 359
              + +   S   L   + ++LKGI E++  SRP   +EM ++R   A Q+ P+ E + R
Sbjct: 315 ELEEIAAAHSPETLLYCFNLLLKGIEEMQYASRPKLVLEMTMVRAVEAGQIVPTAEALGR 374


>gi|319787610|ref|YP_004147085.1| DNA polymerase III subunits gamma/tau [Pseudoxanthomonas suwonensis
           11-1]
 gi|317466122|gb|ADV27854.1| DNA polymerase III, subunits gamma and tau [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 673

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 202/351 (57%), Gaps = 21/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L NA  +GR+  +++ +GTRG+GKTT ARI A+SLN +       + E  
Sbjct: 18  LVGQEHVVRALGNALDTGRVHHAFLFTGTRGVGKTTIARIFAKSLNCEKGT----SAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS+T +DDVRE+I+   Y P   +++VY++DEV MLS 
Sbjct: 74  GQCAACMDIDAGRYIDLLEIDAASNTGVDDVREVIENAQYMPSRGQYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R+  G +    TKIL  
Sbjct: 134 AAFNALLKTLEEPPGHVKFLLATTDPQKLPVTVLSRCLQFNLKRLDEGQIEGQMTKILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A+  +ARA+DGS RDGLSLLDQAIA     +    V+ ML   DR ++  L 
Sbjct: 194 EGIEADASAIRQLARAADGSLRDGLSLLDQAIAYAGGALREDVVQTMLGSVDRTQVAALL 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L  G+       I  L  F+  + +      +L  LAE  H +   + +P        
Sbjct: 254 DALADGNGEALLGTIETLAGFAPDWGN------VLEALAEALHRIQVRQLVPGA-----R 302

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            E E      Y+  V    +  ++QM + G  +++    P    EM ++R+
Sbjct: 303 REDEGIDVDAYAGRVRPEVVQIWYQMAINGRRDLDLAPAPRVGFEMSMLRM 353


>gi|186475716|ref|YP_001857186.1| DNA polymerase III subunits gamma and tau [Burkholderia phymatum
           STM815]
 gi|184192175|gb|ACC70140.1| DNA polymerase III, subunits gamma and tau [Burkholderia phymatum
           STM815]
          Length = 793

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  + +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 ENIAHEAQALRLLARAADGSMRDALSLTDQAIAYSANQVTEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G    VL          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALVAGGGAAVLSVADEMALRSLSFSTALQDLASLLHKIAWAQFAPS---SVLEEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +++  +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFADALSPEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|149375203|ref|ZP_01892975.1| DNA polymerase III subunits gamma and tau [Marinobacter algicola
           DG893]
 gi|149360567|gb|EDM49019.1| DNA polymerase III subunits gamma and tau [Marinobacter algicola
           DG893]
          Length = 654

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L +A  + R+  +Y+ +GTRG+GKTT  R++AR LN +T     P     
Sbjct: 30  MVGQEHVLQALIHALDNQRLHHAYLFTGTRGVGKTTIGRLLARCLNCETGVTATPC---- 85

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    CQ I  G  VD++E+DAAS T +DD+RE+ D + Y P   RF+VY++DEV ML+ 
Sbjct: 86  GTCSSCQEIQEGRFVDLIEIDAASRTGVDDMRELTDNVQYSPTRGRFKVYLIDEVHMLTN 145

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN  LKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R++   +      +L +
Sbjct: 146 QSFNAFLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRMTPEHIAGHLRYVLTQ 205

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+ ++ARA+DGS RD LSL DQAIA  N  +  S V  ML   D++ I +L 
Sbjct: 206 EGIPFEEPALWLLARAADGSMRDALSLTDQAIAFGNQTLSGSDVSNMLGTIDQSDIENLV 265

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++ D   +L E +   D   + SVIL DL    H VT  + +P   D  L    + A
Sbjct: 266 NALVEDDGPALLSEINRISDFAPDYSVILADLLSLFHRVTMEQVVPGSVDNAL---GDAA 322

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +    ++ +S      F+Q  L G  ++          EM L+R+
Sbjct: 323 QVESLARRLSAEDAQLFYQAALMGRKDLAVTPDARMGFEMTLLRM 367


>gi|308048898|ref|YP_003912464.1| DNA polymerase III, subunits gamma and tau [Ferrimonas balearica
           DSM 9799]
 gi|307631088|gb|ADN75390.1| DNA polymerase III, subunits gamma and tau [Ferrimonas balearica
           DSM 9799]
          Length = 830

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 217/366 (59%), Gaps = 21/366 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K LT+A +  R+  +Y+ +GTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLKALTHALEQNRLHHAYLFTGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   HC+ I  G  VD++E+DAAS T +DD REI+D + Y+P+  RF+VY++DEV MLS 
Sbjct: 74  GQCSHCREISEGRFVDLLEIDAASRTKVDDTREILDNVQYQPVRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+TVLSRC +F+L  + +  +     K+L+ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTVLSRCLQFNLKSVPLARISAHLAKVLEA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           + + F+P A+ ++A+A+DGS RDG+SL DQAIA    ++  +SV+ ML   D    + L 
Sbjct: 194 DQVPFEPAALELLAKAADGSVRDGMSLTDQAIAHGGGQLALASVQAMLGTLDSGYALRLV 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L +G       +++ ++ F+  +D       +L  +A   H V   ++    AD    
Sbjct: 254 QGLAQGQPDALMTVLDEVEAFAPDHDD------LLKQMAALLHQVALCQFNLRAAD---L 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPS 353
            E  N   L  ++ +    +  ++QM+ +G  ++     P    EMVL+R LA A   P+
Sbjct: 305 GEQGN-EVLALAQTLDREQVQLWYQMLTQGRQDLALAPDPRSGFEMVLLRALAFAPLNPA 363

Query: 354 PEEIAR 359
           P   AR
Sbjct: 364 PPMAAR 369


>gi|239996413|ref|ZP_04716937.1| DNA polymerase III subunits gamma and tau [Alteromonas macleodii
           ATCC 27126]
          Length = 557

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 218/352 (61%), Gaps = 21/352 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  ++NA  + R+  +Y+ +GTRG+GKTT ARI ++SLN +      P     
Sbjct: 18  LVGQEHVVSAISNALDNDRLHHAYLFTGTRGVGKTTIARIFSKSLNCEEGQGANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I +GN+VD++E+DAAS T ++D RE++D + YKP   R++VY++DEV MLS 
Sbjct: 74  GQCNTCKDIEQGNYVDLLEIDAASRTKVEDTRELLDNVQYKPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+PIT+LSRC +F+L  +S   ++     IL+ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPITILSRCLQFNLKAMSREQIVGQLQHILEH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+P+A+A++ARA+ GS RD LSL DQAIA+  ++++ S V  ML L D+N+++ + 
Sbjct: 194 EQLPFEPQALALLARAAQGSMRDALSLTDQAIAQGGNQVLASVVTDMLGLMDKNQLLKVV 253

Query: 241 GYLIKGDIINVLQ------EFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             ++     +VLQ      E +  YD+      +  +LA   H +   +++PE       
Sbjct: 254 HAVVSKSPADVLQLVNDIAEQAPDYDN------VHSELASLLHQIALTQWVPEACKL--- 304

Query: 295 SEAENARAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            E  +A+A+ Q +K +    +   +Q+ L+G  ++   +    A EM L+R+
Sbjct: 305 -ETTSAKAIFQLAKTIPAEQVQLLYQIALQGRKDLPFSADGKSAFEMTLMRM 355


>gi|330889897|gb|EGH22558.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 711

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 129/335 (38%), Positives = 198/335 (59%), Gaps = 7/335 (2%)

Query: 11  LTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAII 70
           L NA  S R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     G    C+ I 
Sbjct: 2   LINALDSQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC----GTCSVCKEID 57

Query: 71  RGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTL 130
            G  VD++E+DA S T ++D RE++D + Y P   RF+VY++DEV MLS+ +FN LLKTL
Sbjct: 58  EGRFVDLIEIDAPSRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLSSHSFNALLKTL 117

Query: 131 EEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAV 190
           EEPPP+VKFI ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  E++ F+ +A+
Sbjct: 118 EEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGVENVPFEDDAL 177

Query: 191 AMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIIN 250
            ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++ D+   L++GD   
Sbjct: 178 WLLGRAADGSMRDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVLTALLEGDARG 237

Query: 251 VLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVS 310
           VL+      + G + + +L ++    H V   + +PE  D       +  R L  ++ + 
Sbjct: 238 VLEAVRHLAEQGPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRDRVLALAQALP 294

Query: 311 ITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +  ++QM L G  ++     P    EMVL+R+
Sbjct: 295 AEDVQFYYQMGLIGRRDLPLAPDPRGGFEMVLLRM 329


>gi|251772822|gb|EES53382.1| DNA polymerase III, subunits gamma and tau [Leptospirillum
           ferrodiazotrophum]
          Length = 576

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/372 (36%), Positives = 209/372 (56%), Gaps = 28/372 (7%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ ++++LT    SG + Q+Y+ SG RG+GKTT ARI+A+++N ++     P +E  
Sbjct: 19  LIGQEAVVRSLTRGLSSGVMTQAYLFSGERGVGKTTVARILAKAINCQSGPTATPCLECS 78

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G   DV E+D ASHT +DDVR + + + Y P+++R R+ I+DEV MLST
Sbjct: 79  S----CLEIAEGRSPDVTEMDGASHTGVDDVRTLRESLVYAPLTSRSRIVIIDEVHMLST 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPPPHV FI ATTE  KIP TVLSRCQ F    +++  + +    + + 
Sbjct: 135 SAFNALLKTLEEPPPHVVFILATTEAHKIPDTVLSRCQHFRFRLLTVSQISDRILHVCRS 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  +P    M+ARA++GS RD LSLLDQ +    + +  + V  +L + D      + 
Sbjct: 195 ENISLNPTVTGMVARAAEGSLRDALSLLDQLLRTGGESLTPADVADLLGVTDHALEEKML 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSV-----------ILHDLAEFTHLVTRI-KYIPEM 288
             ++ GD+   L+   +  D+GV+P             ILH   + T L + I  +IP  
Sbjct: 255 AAILLGDLSATLRTARTALDTGVDPRAQVRSLARRFRDILHSTLDGTSLDSPIYGWIP-- 312

Query: 289 ADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHA 348
                    E+ +AL      +I FL +   +++KG  ++    +P    E++L RL H 
Sbjct: 313 ---------ESVQALPLDPPPNIFFLEQALSVLVKGEDDLRRSPQPAITFELLLARLCHL 363

Query: 349 VQ-LPSPEEIAR 359
            + LP PE +A+
Sbjct: 364 REVLPLPEILAK 375


>gi|222053486|ref|YP_002535848.1| DNA polymerase III, subunits gamma and tau [Geobacter sp. FRC-32]
 gi|221562775|gb|ACM18747.1| DNA polymerase III, subunits gamma and tau [Geobacter sp. FRC-32]
          Length = 576

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 205/347 (59%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + +TL NA  +GRIA +++ +G RG+GKT++ARI+A++LN +       T E  
Sbjct: 18  LIGQEHVSRTLQNAIDTGRIAHAFLFTGARGVGKTSSARILAKALNCEHGL----TTEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  GN VDV E+D AS+T +DD+RE+ D + Y P  +R++++I+DEV ML+ 
Sbjct: 74  NSCPSCSEITDGNSVDVFEIDGASNTGVDDIRELRDNVKYLPSKSRYKIFIIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFIFATTE  K+PIT+LSRCQRFD  RI +  +++    I+ +
Sbjct: 134 NAFNALLKTLEEPPAHVKFIFATTEPHKLPITILSRCQRFDFKRIPLQKIVDRLRYIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +    +A+A++AR  DGS RD LS LDQ +A C + +    V  +L + DR  +++  
Sbjct: 194 EKVSISSDALAIVARKGDGSMRDSLSTLDQVLAFCGENVADDDVASLLGVVDRRLLLEAS 253

Query: 241 GYLIKGDIINVLQEFSSQYDS-GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             +   D  +VL E   Q DS G +      +L +    +  ++ I   +D L  SE E 
Sbjct: 254 QAVFSRDNKSVL-EIVKQVDSFGYSMRQFCQELIDHFRNLAILRAIDNASDILDLSETEC 312

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
           +     +  V+   L R   ++LK  +E+   +     +EM L+++A
Sbjct: 313 SELKNLAATVATADLQRHLTILLKAENEMAHSNFARLVLEMALLKMA 359


>gi|260913638|ref|ZP_05920114.1| DNA polymerase III subunit gamma/tau [Pasteurella dagmatis ATCC
           43325]
 gi|260632177|gb|EEX50352.1| DNA polymerase III subunit gamma/tau [Pasteurella dagmatis ATCC
           43325]
          Length = 741

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 210/345 (60%), Gaps = 12/345 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L+N  K  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     ++  T E  
Sbjct: 18  VVGQSHILIALSNGLKENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VNGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI  G  +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GECEHCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPVQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    + +    IL++
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLKALEQTQIAQHLEFILKQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ESI FD  A+  +A+A+ GS RD LSL DQAIA  N  I  + V  ML L D N+ +D+ 
Sbjct: 194 ESIPFDFLALEKLAKAAQGSIRDSLSLADQAIAMSNGNITLNVVNEMLGLLDDNQAIDIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+  N+++   +  + G +  + L D+AE  H +   + +P+  D L     + +
Sbjct: 254 YTLQQGNGENMMKIIQAIAEKGSDWDLFLRDIAEKLHQIAVKQLLPK--DRL-----DES 306

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
             L + +  ++   L  F+Q+I+ G  E+     P   VEM L+R
Sbjct: 307 NQLDFLATLITPDDLQFFYQVIVAGRKELAFSPTPRIGVEMTLLR 351


>gi|148266337|ref|YP_001233043.1| DNA polymerase III, subunits gamma and tau [Geobacter
           uraniireducens Rf4]
 gi|146399837|gb|ABQ28470.1| DNA polymerase III, tau subunit [Geobacter uraniireducens Rf4]
          Length = 579

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 203/347 (58%), Gaps = 6/347 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + +TL NA  +GR+A +++ +G RG+GKT++ARI+A++LN +       T E  
Sbjct: 18  LIGQEHVSRTLQNAIDTGRVAHAFLFTGARGVGKTSSARILAKALNCEQGL----TTEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  GN VDV E+D AS+T +DD+RE+ D + Y P  +R++++I+DEV ML+ 
Sbjct: 74  NTCPSCTEITDGNSVDVFEIDGASNTGVDDIRELRDNVKYLPSRSRYKIFIIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFIFATTE  K+PIT+LSRCQRFD  RI++  +++    I+ +
Sbjct: 134 NAFNALLKTLEEPPAHVKFIFATTEPHKVPITILSRCQRFDFKRIALQKIVDRLRYIVDQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +    +A+A++AR  DGS RD LS LDQ +A C   +    V  +L + DR  +++  
Sbjct: 194 EQVSVSDKALAVVARKGDGSMRDSLSTLDQVLAFCGQTVTDEDVAGLLGVVDRRLLLEAS 253

Query: 241 GYLIKGDIINVLQEFSSQYDS-GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
             +   D    L E   + DS G N      +L +    +T ++ + + AD L  SE E 
Sbjct: 254 QSIFARDSRAAL-EIVKRVDSFGYNMRQFCQELIDHFRNITILRTVVDAADILDLSEGEI 312

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
           A     +       L R   ++LK   E+   + P   +EM L+++A
Sbjct: 313 AELKTQASATPPADLQRHLSILLKAEGEMAHSTFPRLVLEMALLKMA 359


>gi|126174787|ref|YP_001050936.1| DNA polymerase III subunits gamma and tau [Shewanella baltica
           OS155]
 gi|125997992|gb|ABN62067.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS155]
          Length = 1147

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 45  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 101 GACGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++ G++      IL +
Sbjct: 161 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQGEIGTQLNHILTQ 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   FD EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 221 EQFPFDAEAIKLLAKAANGSMRDALSLTDQAIAFGGGNVMLTQVQTMLGSIDEQHVVALL 280

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++   +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 281 KALTDADIGVLMHTCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYSAQIRA 340

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q + E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 341 FAEQLTPEQ----VQLYYQILLTGRKDLPHAPDPKSGLEMALLR 380


>gi|312882074|ref|ZP_07741824.1| DNA polymerase III subunits gamma and tau [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309370210|gb|EFP97712.1| DNA polymerase III subunits gamma and tau [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 671

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L NA    R+  +Y+LSGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQRHVLTALENALAQNRLHHAYLLSGTRGVGKTTIGRLFAKGLNCETGITAQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    CQ I +G  VD++E+DAAS T ++D R+++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GQCSTCQEIDQGRFVDLLEIDAASRTKVEDTRDLLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKFI ATT+ +K+P+T+LSRC +FDL  I   ++ +  T IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFILATTDPQKLPVTILSRCLQFDLKPIESEEIQQQLTYILGQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +E +  A++++A A+DGS RD LSL DQAIA  N +++T SV  ML   D +  + L 
Sbjct: 194 EQVESETRALSLLAHAADGSMRDALSLTDQAIALGNGRVMTDSVTYMLGTLDTDHALRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +   S    +GV+   +L  LA   H +   + +PE  D   +++AE  
Sbjct: 254 AAIGTQQPQEAMDCVSFLAKNGVDWDGLLDQLATQLHRIAMCQVLPESLDP-QHADAEKV 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R  Q S+ +    +  ++QM LKG  ++         VEMV++R+
Sbjct: 313 R--QLSQALDPQDVQLYYQMALKGRRDLPLAPSQRIEVEMVVLRM 355


>gi|296101605|ref|YP_003611751.1| DNA polymerase III subunits gamma and tau [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295056064|gb|ADF60802.1| DNA polymerase III subunits gamma and tau [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 637

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 210/361 (58%), Gaps = 8/361 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 14  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 69

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 70  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 129

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 130 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRTQLEHILDE 189

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  +P A+ ++ARA+DGS RD LSL DQAIA  + K+ T +V  ML   D ++ + L 
Sbjct: 190 ENIVHEPRALQLLARAADGSLRDALSLTDQAIASGDGKLSTEAVSTMLGTLDDDQALSLI 249

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
              I  +   V+   ++    GV    +L ++    H V  ++  P      + +  +  
Sbjct: 250 EATIAANGERVMSLVNAAAARGVEWEALLVEMLSLLHRVAMLQLSPSAMGADMAAIEQRM 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE-EIA 358
           R L  ++ V    +  ++Q +L G  E+     P   VEM L+R LA   ++P PE E+ 
Sbjct: 310 REL--ARTVPPADVQLYYQTLLIGRKELPFAPDPRMGVEMTLLRALAFHPRMPLPEPEVP 367

Query: 359 R 359
           R
Sbjct: 368 R 368


>gi|304409215|ref|ZP_07390836.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS183]
 gi|307303218|ref|ZP_07582973.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           BA175]
 gi|304353036|gb|EFM17433.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS183]
 gi|306913578|gb|EFN44000.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           BA175]
          Length = 1125

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++ G++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQGEIGTQLNHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   FD EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQFPFDAEALKLLAKAANGSMRDALSLTDQAIAFGGGNVMLTQVQTMLGSIDEQHVVALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++   +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGVLMHTCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYSAQIRA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q + E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 314 FAEQLTPEQ----VQLYYQILLTGRKDLPHAPDPKSGLEMALLR 353


>gi|241760334|ref|ZP_04758429.1| DNA polymerase III subunit tau [Neisseria flavescens SK114]
 gi|241319212|gb|EER55690.1| DNA polymerase III subunit tau [Neisseria flavescens SK114]
          Length = 666

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 206/351 (58%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAVHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GQCESCTQIDSGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+PITVLSRC +F L  ++   + E    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPITVLSRCLQFVLRNMTTQQVAEHLAHVLDR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ + P+A+ ++ RA+ GS RD LSLLDQAIA  + K+    VR M+   D+  + +L 
Sbjct: 194 ENVPYQPQALQLLGRAAAGSMRDALSLLDQAIAMGSGKVAEQDVRQMIGAVDKQYLFELL 253

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             +I  +   ++   QE S++   +DS          LAE   L+ R+  I  +   L  
Sbjct: 254 EGIINQNGEALLEKAQEMSARAIGFDSA---------LAELAMLLQRLALIQTIPSALAN 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            + E    L+ S+ +S   +  ++Q  + G  ++           M L+R+
Sbjct: 305 DDPERETLLRLSQALSGEQIQLYYQCAIHGKQDLPLAPDEYAGFVMTLLRM 355


>gi|160875802|ref|YP_001555118.1| DNA polymerase III subunits gamma and tau [Shewanella baltica
           OS195]
 gi|160861324|gb|ABX49858.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS195]
 gi|315267992|gb|ADT94845.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS678]
          Length = 1137

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 45  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 101 GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++ G++      IL +
Sbjct: 161 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQGEIGTQLNHILTQ 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   FD EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 221 EQFPFDAEAIKLLAKAANGSMRDALSLTDQAIAFGGGNVMLTQVQTMLGSIDEQHVVALL 280

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++   +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 281 KALTDADIGVLMHTCAQVLAYGADAQEVLRSLLELLHQITLTQFAPVCAQQSLYSAQIRA 340

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q + E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 341 FAEQLTPEQ----VQLYYQILLTGRKDLPHAPDPKSGLEMALLR 380


>gi|332035238|gb|EGI71745.1| DNA polymerase III subunits gamma and tau [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 841

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 199/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L NA    R+  +Y+ +GTRG+GKTT ARI A+SLN        P     
Sbjct: 18  LVGQSHVKQALVNALTQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCDEGISANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G ++D++E+DAAS T ++D REI+D + Y P   R++VY++DEV MLS 
Sbjct: 74  GQCSSCLDIEAGRYIDLLEIDAASRTKVEDTREILDNVQYAPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L+ +S  ++      +L  
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLNALSQSEIKTQLEHVLTR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD +A+++I++A+DGS RD LSL DQAIA+ N  I   +V+ ML L D +    L 
Sbjct: 194 EQLSFDTDALSIISKAADGSMRDALSLTDQAIAQTNGDINNQAVQTMLGLMDTHYSQSLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D   ++ E +       N   +L DL   THL    + +PE A     +    A
Sbjct: 254 AAILAQDGSALMDEIAQVASRNPNYVALLDDLIALTHLTQLTQLVPEAAGLDEKNVDYIA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              Q++    I     ++Q++L G  +++    P    EM+++RL
Sbjct: 314 HVAQHTSPQQIQI---YYQLLLNGKKDLQWAPEPRLGFEMIMLRL 355


>gi|217972946|ref|YP_002357697.1| DNA polymerase III subunits gamma and tau [Shewanella baltica
           OS223]
 gi|217498081|gb|ACK46274.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS223]
          Length = 1115

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++ G++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQGEIGTQLNHILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   FD EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 194 EQFPFDAEALKLLAKAANGSMRDALSLTDQAIAFGGGNVMLTQVQTMLGSIDEQHVVALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++   +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 254 KALTDADIGVLMHTCAQVLAYGADAQEVLRSLLELLHQITLTQFAPAAAQQSLYSAQIRA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q + E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 314 FAEQLTPEQ----VQLYYQILLTGRKDLPHAPDPKSGLEMALLR 353


>gi|257465337|ref|ZP_05629708.1| DNA polymerase III subunits gamma and tau [Actinobacillus minor
           202]
 gi|257450997|gb|EEV25040.1| DNA polymerase III subunits gamma and tau [Actinobacillus minor
           202]
          Length = 694

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 206/345 (59%), Gaps = 13/345 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      IL+E
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQTQIAHHLEFILKE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++  A+  +A+A++GS RD LSL DQAIA  N  I  S+V  ML L D ++ ++L 
Sbjct: 194 EQIPYETAAIEKLAKAAEGSIRDSLSLTDQAIAVSNANITLSAVSQMLGLIDDHQPLELI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   V+    +  + GV+ + +L+D+AE  H +  ++        L+ S  +  
Sbjct: 254 MALANADGEKVMAVIQNVAEKGVDWNQLLNDVAEVLHQIAMLQ--------LVKSAEQEE 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A+ + +K+++   +  F+Q+IL G  E+         VEM  +R
Sbjct: 306 SAIHFLAKQMAPEDIQFFYQVILMGKKELPLAPEQRSGVEMTFLR 350


>gi|187923816|ref|YP_001895458.1| DNA polymerase III subunits gamma and tau [Burkholderia
           phytofirmans PsJN]
 gi|187715010|gb|ACD16234.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           phytofirmans PsJN]
          Length = 893

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPAHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +D +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYDAQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   VL          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALADGDGAAVLSVADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFAEALSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|148655673|ref|YP_001275878.1| DNA polymerase III subunits gamma and tau [Roseiflexus sp. RS-1]
 gi|148567783|gb|ABQ89928.1| DNA polymerase III, subunits gamma and tau [Roseiflexus sp. RS-1]
          Length = 599

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 125/286 (43%), Positives = 178/286 (62%), Gaps = 12/286 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ +++TL NA   GR+A +Y+ +G RG+GKTT AR++A+++N      + P     
Sbjct: 18  LIGQEHVVRTLRNAIAEGRVAHAYLFTGPRGVGKTTVARLLAKAVNCTAPPAERPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C+AI  G+ VDV+E+DAASHTS++D REII+++ ++P  AR +VYI+DEV MLST
Sbjct: 74  GVCESCRAIAEGHAVDVIEMDAASHTSVEDAREIIERVQFRPAVARTKVYIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPPH  FI ATTE+ K+P T+LSRCQRF  +R ++  +      I  +
Sbjct: 134 AAFNALLKTLEEPPPHALFILATTEVHKVPATILSRCQRFVFNRHTVASIAAHLRSIAAQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +      IARA+ GS RD LS+LDQ +A     I    VR +L   +   +  L 
Sbjct: 194 EGVTLEAGVAEAIARAATGSMRDALSVLDQLMAYGGGTISLEQVRNLLGAGEMQEVTALA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTH-LVTRIKYI 285
             LI GD+   LQ  ++   +G        DL +FT  LV R++ +
Sbjct: 254 DALIAGDLPGALQVIANVAAAGA-------DLRQFTRDLVERLRAV 292


>gi|225075134|ref|ZP_03718333.1| hypothetical protein NEIFLAOT_00134 [Neisseria flavescens
           NRL30031/H210]
 gi|224953618|gb|EEG34827.1| hypothetical protein NEIFLAOT_00134 [Neisseria flavescens
           NRL30031/H210]
          Length = 666

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 206/351 (58%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAVHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GQCESCTQIDSGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+PITVLSRC +F L  ++   + E    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPITVLSRCLQFVLRNMTTQQVAEHLAHVLDR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ + P+A+ ++ RA+ GS RD LSLLDQAIA  + K+    VR M+   D+  + +L 
Sbjct: 194 ENVPYQPQALQLLGRAAAGSMRDALSLLDQAIAMGSGKVAEQDVRQMIGAVDKQYLFELL 253

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             +I  +   ++   QE S++   +DS          LAE   L+ R+  I  +   L  
Sbjct: 254 EGIINQNGEALLEKAQEMSARAIGFDSA---------LAELAMLLQRLALIQTIPSALAN 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            + E    L+ S+ +S   +  ++Q  + G  ++           M L+R+
Sbjct: 305 DDPERETLLRLSQALSGEQIQLYYQCAIHGKQDLPLAPDEYAGFVMTLLRM 355


>gi|94500851|ref|ZP_01307377.1| DNA polymerase III subunits gamma and tau [Oceanobacter sp. RED65]
 gi|94426970|gb|EAT11952.1| DNA polymerase III subunits gamma and tau [Oceanobacter sp. RED65]
          Length = 658

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L NA  + R+  +Y+ +GTRG+GKTT ARI+A+ LN +      P     
Sbjct: 18  LVGQEHVMRALINALDNQRLHHAYLFTGTRGVGKTTIARILAKCLNCEQGISSEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + CQ I +G  VD++E+DAAS T ++D REI+D + Y P   R++VY++DEV MLS 
Sbjct: 74  GTCQSCQEISQGRFVDLIEVDAASRTKVEDTREILDNVQYAPTRGRYKVYLIDEVHMLSN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+ ATT+ +K+P T+LSRC +F L  ++   ++     +L +
Sbjct: 134 SSFNALLKTLEEPPPHVKFLLATTDPQKLPATILSRCLQFSLKNMTPERIVGYLQNVLAQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+EF+   + ++ RA++GS RD LSL DQAI+     I    V  ML   DR R+  L 
Sbjct: 194 ESVEFEEPGLWLLGRAAEGSMRDALSLTDQAISFGQGVIKEQDVAAMLGTVDRGRVFQLA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + D    L   +   +  V+ + +L DL    H +   + +PE  D    S+ +  
Sbjct: 254 IALAENDAAQALALVAQMAEHAVDFNNLLADLINLIHRIALAQAVPEAVDN---SQGDKE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + +  +  +S   +   +Q+ L G  ++     P   +EM L+R+
Sbjct: 311 QVMTLAGAMSPAMVQLMYQIALTGKRDLPLAPEPRAGLEMTLLRM 355


>gi|120554533|ref|YP_958884.1| DNA polymerase III, subunits gamma and tau [Marinobacter aquaeolei
           VT8]
 gi|120324382|gb|ABM18697.1| DNA polymerase III, gamma subunit [Marinobacter aquaeolei VT8]
          Length = 637

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 202/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L +A +  R+  +Y+ +GTRG+GKTT  R++AR LN +T     P     
Sbjct: 18  MVGQEHVLQALIHALEHQRLHHAYLFTGTRGVGKTTIGRLLARCLNCETGITPNPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I+    VD++E+DAAS T +DD+RE+ D + Y P   R++VY++DEV ML+ 
Sbjct: 74  GECDSCKEILENRFVDLIEIDAASRTGVDDMRELTDNVQYAPTRGRYKVYLIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN  LKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L R++   ++     +L E
Sbjct: 134 QSFNAFLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKRMTPEHIVGHLKHVLTE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+ ++ARA+DGS RD LSL DQAIA  N+ +  S V  ML   D+  I  + 
Sbjct: 194 EQIPFEDPALWLLARAADGSMRDALSLTDQAIAFGNENLAASDVSNMLGTIDQRDIQRIV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++ D   +L E +   D   +  VIL D+    H VT  + +P  AD  +    + A
Sbjct: 254 NALVERDGPGLLSEINRISDFAPDYGVILSDMLSLFHRVTMEQVVPGSADNAM---GDAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +  + ++ +S      F+Q  L G  ++          EM L+R+
Sbjct: 311 QVQELARRLSAEDAQLFYQTALIGRKDLSVTPDARMGFEMTLLRM 355


>gi|326566454|gb|EGE16604.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           BC1]
          Length = 748

 Score =  246 bits (627), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 211/345 (61%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A A+ GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASAAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|308185942|ref|YP_003930073.1| DNA polymerase III, tau and gamma subunits [Pantoea vagans C9-1]
 gi|308056452|gb|ADO08624.1| DNA polymerase III, tau and gamma subunits [Pantoea vagans C9-1]
          Length = 689

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 213/367 (58%), Gaps = 9/367 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + +    +L++
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALDVDQIRQQLEHVLKQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +  A+ ++ARA+DGS RD LSL DQAIA     + +S+V +ML   D  + + L 
Sbjct: 194 EQIESETRALQLLARAADGSMRDALSLTDQAIAMGQGAVTSSTVSVMLGTLDDEQPLGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G+   V+   S     GV    +L ++    H +  ++ +P    +L   E  NA
Sbjct: 254 EALVDGNGQQVMNLLSQAASRGVEWEALLVEMLRLLHQIAMVQLLPA---SLNDDEESNA 310

Query: 301 -RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPEEIA 358
            R  + ++ V    L  ++Q +L G  ++         VEM L+R LA   +    E IA
Sbjct: 311 IRLRELARVVPPADLQLYYQTLLMGRKDLPIAPDRRMGVEMTLLRALAFHPKAAVAEPIA 370

Query: 359 RYIVEEK 365
           R  + E+
Sbjct: 371 RPALTEQ 377


>gi|319637641|ref|ZP_07992407.1| DNA polymerase III tau and gamma chains [Neisseria mucosa C102]
 gi|317400796|gb|EFV81451.1| DNA polymerase III tau and gamma chains [Neisseria mucosa C102]
          Length = 667

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 206/351 (58%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAVHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GQCESCTQIDSGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+PITVLSRC +F L  ++   + E    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPITVLSRCLQFVLRNMTTQQVAEHLAHVLDR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ + P+A+ ++ RA+ GS RD LSLLDQAIA  + K+    VR M+   D+  + +L 
Sbjct: 194 ENVPYQPQALQLLGRAAAGSMRDALSLLDQAIAMGSGKVAEQDVRQMIGAVDKQYLFELL 253

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             +I  +   ++   QE S++   +DS          LAE   L+ R+  I  +   L  
Sbjct: 254 EGIINQNGEALLEKAQEMSARAIGFDSA---------LAELAMLLQRLALIQTIPSALAN 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            + E    L+ S+ +S   +  ++Q  + G  ++           M L+R+
Sbjct: 305 DDPERETLLRLSQALSGEQIQLYYQCAIYGKQDLPLAPDEYAGFVMTLLRM 355


>gi|326576888|gb|EGE26794.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           O35E]
          Length = 748

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 211/345 (61%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A A+ GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASAAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|183600059|ref|ZP_02961552.1| hypothetical protein PROSTU_03591 [Providencia stuartii ATCC 25827]
 gi|188022344|gb|EDU60384.1| hypothetical protein PROSTU_03591 [Providencia stuartii ATCC 25827]
          Length = 643

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 197/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKTT AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLTALANGLEHQRLHHAYLFSGTRGVGKTTIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GKCTNCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + E    IL  
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVSQISEQLEHILTA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+IE D  A  +I+RA+DGS RD LSL DQAIA    K+    V  ML   D  + + + 
Sbjct: 194 ENIEHDTRARQLISRAADGSLRDALSLTDQAIAMGQGKVTADIVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++ D I V+ E       G +   +L ++    H +  I+ +P + +T   S     
Sbjct: 254 EALVRADGIAVMSEVEHAASRGADWENLLVEILSLLHRIAMIQLLPAVKETDPSS--TEG 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  Q ++ +S   L  F+Q +L G  ++         VEM L+R
Sbjct: 312 RLRQIARMISPADLQLFYQTLLVGRRDLPYAPERRMGVEMALLR 355


>gi|307729576|ref|YP_003906800.1| DNA polymerase III subunits gamma and tau [Burkholderia sp.
           CCGE1003]
 gi|307584111|gb|ADN57509.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp.
           CCGE1003]
          Length = 954

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI +++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFSKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + ++ +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYEAQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   VL          ++ S  L DLA   H V   ++ P    ++L    E  
Sbjct: 254 DALAQGDGAAVLAIADEMALRSLSFSTALQDLASLLHRVAWAQFAPS---SVLDEWPEAG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +++  +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFADTLSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|283834204|ref|ZP_06353945.1| DNA polymerase III subunit tau [Citrobacter youngae ATCC 29220]
 gi|291070357|gb|EFE08466.1| DNA polymerase III subunit tau [Citrobacter youngae ATCC 29220]
          Length = 641

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 213/361 (59%), Gaps = 8/361 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL+E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILKE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAADGSLRDALSLTDQAIASGDGQVSTDAVSTMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D   V+   +     G+    +L +++   H +  ++ +P    + + +  +  
Sbjct: 254 EAVVAADGERVMTLVNDAAARGIEWEALLVEMSALLHRIAMVQLLPAALGSDMAAVEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE-EIA 358
           R L  ++ V  T +  ++Q +L G  E+         VEM L+R LA   ++P PE E+ 
Sbjct: 314 REL--ARIVPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVP 371

Query: 359 R 359
           R
Sbjct: 372 R 372


>gi|209519558|ref|ZP_03268351.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp. H160]
 gi|209500037|gb|EEA00100.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp. H160]
          Length = 375

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 207/345 (60%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPQHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVTHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  + +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 ENVPHEAQALRLLARAADGSMRDALSLTDQAIAYSANQVSEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   VL          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAQGDGTAVLAVADEMALRSLSFSTALQDLAGLLHRIAWAQFAP---SSVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFAETLSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|189184647|ref|YP_001938432.1| DNA polymerase III subunits gamma and tau [Orientia tsutsugamushi
           str. Ikeda]
 gi|189181418|dbj|BAG41198.1| DNA polymerase III gamma and tau chains [Orientia tsutsugamushi
           str. Ikeda]
          Length = 559

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 138/377 (36%), Positives = 219/377 (58%), Gaps = 18/377 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + K LT +  +G ++Q+Y+LSG RG+GKTT ARIIA ++N     +   T+   
Sbjct: 23  LIGQEVLTKVLTYSMITGCLSQAYLLSGIRGVGKTTAARIIATTINCLQPLVTSKTIFAC 82

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C AI   +H D+ E+DAAS T +DDVR IID   YKP+ ++++++I+DEV MLS 
Sbjct: 83  TKCNSCIAIENNSHPDINEIDAASRTGVDDVRTIIDDSEYKPLISKYKIFIIDEVHMLSK 142

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLK LEEPP H  FIFATTEI KIP+TV+SRCQ+FDL R+ + +++++ + I+ +
Sbjct: 143 NAFNALLKLLEEPPSHTIFIFATTEINKIPLTVISRCQKFDLRRLDVNNIVQILSNIIAK 202

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSS----------VRLMLAL 230
           E++    E +  IA  +DGSARD +SLL+QA A   +   T+S          V  M  +
Sbjct: 203 ENVSATKEILEFIAVKADGSARDAISLLEQAKALAQNIADTASSEAVVISLNTVEQMCGV 262

Query: 231 ADRNRIMDLFGYLIKGDI---INVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE 287
            D  +  DL   + + +    IN++ +    Y SG +  V   ++ +    + ++K I  
Sbjct: 263 LDLGKSTDLLSAIAEKNAEKGINIVTDL---YISGTDFVVCSQNILDLIGYLIKVKTIDG 319

Query: 288 MADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAH 347
             +++  S   N R    S ++S++ L+  WQ+  K I E++    P    E+V+I+  +
Sbjct: 320 YTESIYAS--HNNRLNSLSMKLSLSRLTVLWQIFSKSIQELKISHNPRLCFEVVVIKAIY 377

Query: 348 AVQLPSPEEIARYIVEE 364
           +  LP+P +  R +  E
Sbjct: 378 SFSLPTPIDALRQLKSE 394


>gi|261822478|ref|YP_003260584.1| DNA polymerase III subunits gamma/tau [Pectobacterium wasabiae
           WPP163]
 gi|261606491|gb|ACX88977.1| DNA polymerase III, subunits gamma and tau [Pectobacterium wasabiae
           WPP163]
          Length = 690

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +      P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     ++LQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAHLEQVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA+DGS RD LSL DQAIA    ++ T+SV  ML   D  + + L 
Sbjct: 194 ENLANEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTTASVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-EMADTLLYSEAEN 299
             L KGD   V+         GV+   +L +     H +  ++ +P  + D   Y+  E 
Sbjct: 254 EALAKGDGAQVMSLLDQVAARGVDWESLLVETQTLLHRIAMVQLLPAALGDD--YAAVE- 310

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           AR  + ++ +    +  ++Q IL G  E+         VEM L+R
Sbjct: 311 ARMRELARALPPADVQLYYQTILIGRKELPFAPDRRMGVEMTLLR 355


>gi|326570261|gb|EGE20306.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           BC8]
          Length = 748

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 211/345 (61%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A A+ GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASAAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 EIVYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|291613732|ref|YP_003523889.1| DNA polymerase III, subunits gamma and tau [Sideroxydans
           lithotrophicus ES-1]
 gi|291583844|gb|ADE11502.1| DNA polymerase III, subunits gamma and tau [Sideroxydans
           lithotrophicus ES-1]
          Length = 537

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 202/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ +++ LTNA    R+  +Y+ +GTRG+GKTT ARI A+SLN +T     P     
Sbjct: 19  LAGQEHVVQALTNALTQNRLHHAYLFTGTRGVGKTTIARIFAKSLNCETGVTATPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++ELDAAS+T +D++RE+++   Y P S RF+VYI+DEV MLS 
Sbjct: 75  GVCGACTEIDSGRFVDLIELDAASNTQVDNMRELLESALYAPTSGRFKVYIIDEVHMLSK 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++    ++     +L +
Sbjct: 135 SAFNAMLKTLEEPPSHVKFILATTDPQKIPVTVLSRCLQFNLKQLPPALILTHLQYVLGQ 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+  A+ ++ARA+ GS RD LSLLDQAIA  + K+  + VR ML   D+  + DL 
Sbjct: 195 ENIPFEIGALNLVARAAQGSMRDALSLLDQAIAYSSGKVDEALVRTMLGAIDQGYLFDLL 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L+         +     L DLA   H +   + IP   + +   E E A
Sbjct: 255 QMLRVEDGAGLLRIADDMAMRSLAFEAALQDLATLLHRIALAQTIP---NAIAEDEPERA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R  + +++ +   +   +Q+ + G +EI+          M L+R+
Sbjct: 312 RLFELAQQFTPEEIQLNYQIAIHGRNEIDLAPDEYAGFTMTLLRM 356


>gi|170692333|ref|ZP_02883496.1| DNA polymerase III, subunits gamma and tau [Burkholderia graminis
           C4D1M]
 gi|170142763|gb|EDT10928.1| DNA polymerase III, subunits gamma and tau [Burkholderia graminis
           C4D1M]
          Length = 996

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI +++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFSKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + ++ +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYEAQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   VL          ++ S  L DLA   H +   ++ P    ++L    E  
Sbjct: 254 DALAQGDGATVLTIADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFAETLSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|294788405|ref|ZP_06753648.1| DNA polymerase III, subunits gamma and tau [Simonsiella muelleri
           ATCC 29453]
 gi|294483836|gb|EFG31520.1| DNA polymerase III, subunits gamma and tau [Simonsiella muelleri
           ATCC 29453]
          Length = 654

 Score =  245 bits (625), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 203/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 19  LVGQQHVVKALQNALDKGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I  G  VD++E+DAAS+T ID++RE+++   Y P   +++VYI+DEV MLS 
Sbjct: 75  GVCQSCRDIDAGRFVDLLEIDAASNTGIDNIREVLENAQYAPTVGKYKVYIIDEVHMLSK 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+PITVLSRC +F L  ++   +    T +L+ 
Sbjct: 135 SAFNAMLKTLEEPPEHVKFILATTDPHKVPITVLSRCLQFVLRNLTPQQVTAHLTHVLKT 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++P A+A++  A+ GS RD LSLLDQAIA  +  +    VR M+   D+  + +L 
Sbjct: 195 EQIVYEPNALALLGYAAQGSMRDALSLLDQAIAMGSGSVQERDVREMIGAVDKRYLYELL 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
            +L++ D  N++++      + +    +L+DLA     +  IK +P    T    + E  
Sbjct: 255 TFLMEQDGENLIKKAQEMASNAIGFDGVLNDLAMLLQRLALIKTVPTAIST---DDPEYE 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             LQ +   S   +  ++Q  + G  ++           M L+R+
Sbjct: 312 YLLQLANYFSDEQIQLYYQCAIHGKQDLSLAPDEYAGFVMTLLRM 356


>gi|326563685|gb|EGE13937.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           103P14B1]
 gi|326573294|gb|EGE23262.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           101P30B1]
 gi|326575807|gb|EGE25730.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           CO72]
          Length = 748

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 210/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLFDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A  + GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASTAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|296113237|ref|YP_003627175.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           RH4]
 gi|295920931|gb|ADG61282.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           RH4]
          Length = 748

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 211/345 (61%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A A+ GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASAAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    +   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGVRLASTPMQALEMGILRL 358


>gi|322513952|ref|ZP_08067027.1| DNA polymerase III, gamma/tau subunit DnaX [Actinobacillus ureae
           ATCC 25976]
 gi|322120178|gb|EFX92136.1| DNA polymerase III, gamma/tau subunit DnaX [Actinobacillus ureae
           ATCC 25976]
          Length = 467

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 216/368 (58%), Gaps = 20/368 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLH---RISIGDLIELFTKI 177
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L    ++ I + +E    I
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQVQIANHLEF---I 190

Query: 178 LQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIM 237
           LQ+E+I ++  A+  +A+A+ GS RD LSL DQAI   N  I    V+ ML L D ++ +
Sbjct: 191 LQQENIPYESAAMEKLAKAAQGSIRDSLSLTDQAIVVSNANISLPIVQQMLGLIDDHQPI 250

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           +L   L + D    +    S  + GV+ S +L D+A+  H +  ++        LL +  
Sbjct: 251 ELVTALAQADGEKAMSVIQSVAEKGVDWSQLLSDVAQTLHQIAMLQ--------LLKNSG 302

Query: 298 ENARALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
           +    L + +K+++   +  F+Q++L G  E+E        VEM ++R A A      EE
Sbjct: 303 QEQTQLHFLAKQIAPEDVQFFYQLMLNGKKELEFAPEQRAGVEMTILR-ALAFHPKRVEE 361

Query: 357 IARYIVEE 364
           I R  V E
Sbjct: 362 INRQPVRE 369


>gi|325522361|gb|EGD00963.1| DNA polymerase III subunits gamma and tau [Burkholderia sp. TJI49]
          Length = 381

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 210/348 (60%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|331005832|ref|ZP_08329187.1| DNA polymerase III subunits gamma and tau [gamma proteobacterium
           IMCC1989]
 gi|330420352|gb|EGG94663.1| DNA polymerase III subunits gamma and tau [gamma proteobacterium
           IMCC1989]
          Length = 740

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L NA    R+  +Y+ +GTRG+GKTT ARI+A+ LN +     VP  E  
Sbjct: 18  MVGQEHVLQALINALDHDRLHHAYLFTGTRGVGKTTIARILAKCLNCEVGVSSVPCNECS 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G  VD++E+DAAS T ++D RE+++ + Y P   R++VY++DEV MLS 
Sbjct: 78  S----CIEINEGRFVDLIEVDAASRTKVEDTRELLENVQYAPTRGRYKVYLIDEVHMLSN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F+L  ++   ++     +L++
Sbjct: 134 SSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFNLKNMNPEKIVSHLQFVLEK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+   +  +AR++DGS RD LSL DQ+IA  + KI    VR ML   D++ + D+ 
Sbjct: 194 EMVPFEDAGLWQLARSADGSMRDALSLTDQSIAFGDGKITDVDVRTMLGTIDQSLVYDVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI  DI  +L   ++  +   + S  L +L    H +   + +PE  D    S+ +  
Sbjct: 254 KGLIAEDIKQLLSAVANLSEHSPDYSAALAELIATLHRIAIAQALPEAVDN---SQGDRQ 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +  ++++ ++   +  ++Q  L G  ++     P    EMVL+R+
Sbjct: 311 QIYEFAQAITAEDIQLYYQTALLGRRDLPLVPDPRSGFEMVLLRM 355


>gi|170733187|ref|YP_001765134.1| DNA polymerase III subunits gamma and tau [Burkholderia cenocepacia
           MC0-3]
 gi|169816429|gb|ACA91012.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           cenocepacia MC0-3]
          Length = 793

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+  ++ L 
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  G+   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAGNGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 311 DLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|326565235|gb|EGE15420.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           12P80B1]
          Length = 748

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 210/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLFDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A  + GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASTAKGSVRDALSLTDQAIAFGGGRIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|77166051|ref|YP_344576.1| DNA-directed DNA polymerase [Nitrosococcus oceani ATCC 19707]
 gi|254436358|ref|ZP_05049864.1| DNA polymerase III, subunits gamma and tau, putative [Nitrosococcus
           oceani AFC27]
 gi|76884365|gb|ABA59046.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Nitrosococcus oceani ATCC 19707]
 gi|207088048|gb|EDZ65321.1| DNA polymerase III, subunits gamma and tau, putative [Nitrosococcus
           oceani AFC27]
          Length = 529

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 136/369 (36%), Positives = 214/369 (57%), Gaps = 19/369 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LTN    GR+  +++ +GTRG+GKTT ARI+A+SLN K      P     
Sbjct: 18  VVGQEHVVRALTNGLDKGRLHHAFLFTGTRGVGKTTLARILAKSLNCKEGVRSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++CQAI  GN VD++E+DAAS T +DD RE+++ ++Y P    ++VY++DEV M ST
Sbjct: 74  GKCQNCQAIDGGNFVDLIEVDAASRTGVDDTRELLENVHYAPSRGHYKVYLIDEVHMFST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPH+KF+ ATTE +K+P+TVLSRC +F+L RI+   + E    IL+ 
Sbjct: 134 SSFNALLKTLEEPPPHIKFLLATTEPKKLPVTVLSRCLQFNLRRITPKAIAEHLNSILEA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +  A+ +IARA++GS RD LSLLDQAI     +++ + VR ML   ++  +  L 
Sbjct: 194 EEIPSESYALTLIARAAEGSVRDALSLLDQAINYGRGQVMVADVRTMLGSIEQGDLFILL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G+   ++++        V+ S IL DL      +   +  P+  D +      ++
Sbjct: 254 DALLAGNGQGLIEKVREICAYSVDISSILADLLHLLQRLALYQLAPDTVDDIDERGIFSS 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL-----------AHAV 349
            A + + E     +  F+Q+ L G  ++        A EM+L+R+             A+
Sbjct: 314 LAARTTPEE----VQLFYQIGLIGSRDLTYAPDHHTAFEMILLRMLCFRPADGASSCQAL 369

Query: 350 QLPSPEEIA 358
             P PE+  
Sbjct: 370 TNPKPEKTG 378


>gi|167623521|ref|YP_001673815.1| DNA polymerase III subunits gamma and tau [Shewanella halifaxensis
           HAW-EB4]
 gi|167353543|gb|ABZ76156.1| DNA polymerase III, subunits gamma and tau [Shewanella halifaxensis
           HAW-EB4]
          Length = 930

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 214/365 (58%), Gaps = 11/365 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ SGTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  MVGQSHVLHALTNALTQQRLHHAYLFSGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T +DD RE++D + Y+P   R++VY++DEV MLS 
Sbjct: 74  GKCSACVEIAEGRFVDLIEVDAASRTKVDDTRELLDNVQYRPSRGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  ++  ++    + IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTQDEIATQISHILSQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+  A+ ++A+A++GS RD LSL DQAIA    ++    V+ ML   D   ++ L 
Sbjct: 194 EQLSFEDAALTLLAKAANGSMRDALSLTDQAIAFGAGQVKLEQVQTMLGSIDEKHVLALL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L K DI++++Q  +     G +P  +L  L E  H +T  ++ P  A   LYSE  +A
Sbjct: 254 EALAKADIMDLMQVTAKVLSFGADPEEVLRSLLELLHQITLTQFAPAAAQMSLYSEQISA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
            A Q S E     +  ++Q++L G  ++     P   +EM L+R   AV     + + R+
Sbjct: 314 FAQQLSAEQ----VQLYYQLLLTGRKDLPHAPDPKSGLEMALLR---AVTFVPEKPVTRW 366

Query: 361 IVEEK 365
            VE K
Sbjct: 367 AVETK 371


>gi|90020982|ref|YP_526809.1| DNA polymerase III subunits gamma and tau [Saccharophagus degradans
           2-40]
 gi|89950582|gb|ABD80597.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Saccharophagus degradans 2-40]
          Length = 690

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/347 (37%), Positives = 203/347 (58%), Gaps = 11/347 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           MIGQ+ +++ L NA   GR+  +Y+ +GTRG+GKT+ ARI+A+ LN +T       V  E
Sbjct: 18  MIGQEHVLRALINALDHGRLHHAYLFTGTRGVGKTSIARILAKCLNCETG------VSSE 71

Query: 61  GFGE--HCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQML 118
             GE   C  I  G  VD++E+DAAS T ++D RE++D + Y P   R+++Y++DEV ML
Sbjct: 72  PCGECSACVEISEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPTRGRYKIYLIDEVHML 131

Query: 119 STAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKIL 178
           S  +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L  +S   ++   + IL
Sbjct: 132 SNHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLKNMSPERIVGHLSHIL 191

Query: 179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMD 238
           ++E I F+  A+  +AR++DGS RD LSL DQ+I+    K+    V  ML   D   + +
Sbjct: 192 EKEVIPFEESALWQLARSADGSMRDALSLTDQSISFGGGKVSEDEVASMLGTIDHKLVQN 251

Query: 239 LFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAE 298
           L G LI GD   +L   +   +   +  V L DL    H +   + +P   D L  S  +
Sbjct: 252 LVGALIAGDGSQILTSVAKFAEHAPDFDVALADLITLLHRIAIAQALP---DALDNSYGD 308

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             + L+++ +++   +  F+Q  L G  ++     P    EM L+R+
Sbjct: 309 RTQILEFASKLAPEDVQLFYQTALIGRRDLSLSPDPRSGFEMTLLRM 355


>gi|325274405|ref|ZP_08140492.1| DNA polymerase III subunits gamma and tau [Pseudomonas sp. TJI-51]
 gi|324100440|gb|EGB98199.1| DNA polymerase III subunits gamma and tau [Pseudomonas sp. TJI-51]
          Length = 310

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 120/291 (41%), Positives = 183/291 (62%), Gaps = 4/291 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++K L NA  + R+  +Y+ +GTRG+GKTT ARIIA+ LN +T     P     
Sbjct: 1   MVGQTHVLKALINALDNQRLHHAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC---- 56

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLST
Sbjct: 57  GTCSVCREIDEGRFVDLIEIDAASRTKVEDTRELLDNVQYAPSRGRFKVYLIDEVHMLST 116

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPP+VKFI ATT+ +K+P T+LSRC +F L  +S   ++E  + +L  
Sbjct: 117 HSFNALLKTLEEPPPYVKFILATTDPQKLPATILSRCLQFSLKNMSPERVVEHLSHVLAA 176

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ F+ +A+ ++ RA+DGS RD +SL DQAIA    K++ + VR ML   D  ++  + 
Sbjct: 177 ENVPFEADALWLLGRAADGSMRDAMSLTDQAIAFGEGKVLAADVRAMLGSLDHGQVYGVL 236

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADT 291
             L++GD   +L+   +  + G + + +L ++    H V   + +PE  D 
Sbjct: 237 QALLEGDARALLEAVRNLAEQGPDWAGVLAEMLNVLHRVAIAQALPEAVDN 287


>gi|289209016|ref|YP_003461082.1| DNA polymerase III subunits gamma/tau [Thioalkalivibrio sp. K90mix]
 gi|288944647|gb|ADC72346.1| DNA polymerase III, subunits gamma and tau [Thioalkalivibrio sp.
           K90mix]
          Length = 587

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 195/345 (56%), Gaps = 5/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NA    R+  +Y+ +GTRG+GKTT ARI+AR LN +T     P  E  
Sbjct: 18  LVGQPHVVRALANALSGDRLHHAYLFAGTRGVGKTTIARILARCLNCETGITATPCGECR 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G H+D++E+DAAS T +DD RE++D + Y P + RF+VY++DEV MLS 
Sbjct: 78  ----SCVEIAEGRHLDLIEVDAASRTRVDDTRELLDNVSYAPTAGRFKVYLIDEVHMLSE 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  +    + E  T+IL+ 
Sbjct: 134 KSFNALLKTLEEPPDHVKFLLATTDPQKLPVTVLSRCLQFNLKPMPPALIAEHLTRILEA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++ +P A+  +  A++GS RD LSL DQAIA   D++  S    ML L  R R+  L 
Sbjct: 194 EGLQAEPGALLRLGEAAEGSMRDALSLTDQAIAYGGDRLTESDACDMLGLLPRTRLTGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
                GD   ++Q        G + S +L +LA   H V  ++ +          +A   
Sbjct: 254 DAAFAGDGPGLMQGLQELKGLGPDWSRLLDELAALVHRVA-VEQLVRGEGGAEDDDAAER 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            A + +  +    L   +Q+++ G  ++         VEM L+RL
Sbjct: 313 WARETAARIDAETLQLTYQILIHGARDLPWAPDAQMGVEMTLLRL 357


>gi|206560262|ref|YP_002231026.1| DNA polymerase III subunits gamma and tau [Burkholderia cenocepacia
           J2315]
 gi|198036303|emb|CAR52199.1| DNA polymerase III subunit gamma [Burkholderia cenocepacia J2315]
          Length = 787

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 206/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+  ++ L 
Sbjct: 194 ERITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  G+   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAGNGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 311 DLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|308270884|emb|CBX27494.1| hypothetical protein N47_H23160 [uncultured Desulfobacterium sp.]
          Length = 571

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 4/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQK + +TL NA  +GR+A + +LSG RG GKTT ARI+A+++N     I+ PT    
Sbjct: 30  VVGQKHVTQTLANAISTGRVAHAVLLSGPRGTGKTTVARILAKAMNC----IEGPTPSPC 85

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G+ VDV+E+D AS+  +++VR++ D I YKP  +R+++YI+DEV MLST
Sbjct: 86  NVCRSCTEITIGSCVDVLEIDGASNNGVENVRDLRDNIKYKPAYSRYKIYIIDEVHMLST 145

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPPPHV FIFATTE  KIP+T+LSRCQR D  RI + D+ +    I ++
Sbjct: 146 QAFNALLKTLEEPPPHVMFIFATTEPHKIPVTILSRCQRHDFKRIGLDDITDQMLYICKK 205

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+++   E++  IARA+ G  RD LSLLD  ++    +I   ++  ++ L DR  I  + 
Sbjct: 206 ENVDVSSESLTAIARAAGGCMRDALSLLDLVLSCSEGRINEENLSDIIGLVDRRTIFKIT 265

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  DI+ +L      Y +G N   +  ++ E    +  +K   ++   +    +E  
Sbjct: 266 DAVLSADIVALLDVLDDLYQNGHNFKELYSEITEHFRNLIVVKMGKKIDKLISLPSSEIN 325

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             ++  K++  TFL++ + ++ +  S I     P  A+E++  R+
Sbjct: 326 LMVKQVKDIPATFLNQIFDILYREESAIRFSPNPKLALEIIFFRM 370


>gi|326562873|gb|EGE13160.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           46P47B1]
 gi|326570998|gb|EGE21022.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           BC7]
          Length = 748

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 210/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A  + GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASTAKGSVRDALSLTDQAIAFGGGRIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETIYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|238783570|ref|ZP_04627591.1| DNA polymerase III subunit gamma [Yersinia bercovieri ATCC 43970]
 gi|238715448|gb|EEQ07439.1| DNA polymerase III subunit gamma [Yersinia bercovieri ATCC 43970]
          Length = 656

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 200/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N+   GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQQHVLTALANSLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GICANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +  L  KILQ 
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRALLEKILQV 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA  +  I T++V  ML   D  + + + 
Sbjct: 194 EQISSDARALQLLARAADGSMRDALSLTDQAIAMGDGSITTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQVEQGASRGVDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|221215165|ref|ZP_03588132.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           multivorans CGD1]
 gi|221165101|gb|EED97580.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           multivorans CGD1]
          Length = 498

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 210/348 (60%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAELLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|196229725|ref|ZP_03128589.1| DNA polymerase III, subunits gamma and tau [Chthoniobacter flavus
           Ellin428]
 gi|196226051|gb|EDY20557.1| DNA polymerase III, subunits gamma and tau [Chthoniobacter flavus
           Ellin428]
          Length = 598

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 177/296 (59%), Gaps = 5/296 (1%)

Query: 3   GQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGF 62
            Q  ++ TL NA    R+AQ+Y+  G RG GKT+TARI A++LN     +  PT    G 
Sbjct: 5   AQAHIVTTLKNAIAQNRLAQAYLFVGPRGTGKTSTARIFAKALNC----VHAPTTNPCGV 60

Query: 63  GEHCQAIIRGNHVDVVELDAASHTSIDDVREII-DQIYYKPISARFRVYIMDEVQMLSTA 121
            + C+ I  GN ++V+E DAAS+T +D +REII D + Y P    +++YI+DEV MLS +
Sbjct: 61  CDMCKEIAAGNSLNVLEFDAASNTQVDKIREIIIDNVKYAPTRGNYKLYIVDEVHMLSNS 120

Query: 122 AFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEE 181
           +FN LLKTLEEPPPHVKF+FATT+++K+P T++SRCQRFDL RI   ++ +    I  +E
Sbjct: 121 SFNALLKTLEEPPPHVKFVFATTDVQKVPTTIISRCQRFDLRRIPTPEIAQHLLFIAGKE 180

Query: 182 SIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFG 241
           +IE  P A   IAR ++G  RD  S+LDQ +A C DKI   +V  +     R  + +L  
Sbjct: 181 AIELTPTAAESIARGAEGGLRDAESMLDQLVAFCGDKIDEQNVLNIFGFTARQTVAELCE 240

Query: 242 YLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           +LI G     L     Q D+G + S ++ DL E    +   +  PE     L +EA
Sbjct: 241 HLINGHTGAALGAIQKQSDAGKDLSRLMADLIEHLRNLLVAQSAPETLHEDLSAEA 296


>gi|296157765|ref|ZP_06840599.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp. Ch1-1]
 gi|295892011|gb|EFG71795.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp. Ch1-1]
          Length = 966

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSAPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPAHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +D +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYDVQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   VL          ++ S  L DLA   H +   ++ P    ++L    E  
Sbjct: 254 DALADGDGAAVLSVADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFAEALSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|77917989|ref|YP_355804.1| DNA polymerase III subunits gamma/tau [Pelobacter carbinolicus DSM
           2380]
 gi|77544072|gb|ABA87634.1| DNA polymerase III, tau subunit [Pelobacter carbinolicus DSM 2380]
          Length = 582

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 205/361 (56%), Gaps = 7/361 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + +TL NA K+GR+  +++ +G RG+GKT+ ARI A++LN +      P     
Sbjct: 18  LVGQEHVSQTLGNAIKTGRVHHAFLFTGARGVGKTSAARIFAKALNCEQGLSPQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              + C+ I  G  +DV E+D AS+T +DD+RE+ + I Y P  +R++++I+DEV MLST
Sbjct: 74  NVCQSCREISAGQGLDVFEIDGASNTGVDDIRELRENIRYLPSRSRYKIFIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP H KFIFATTE  KIPIT+LSRCQRFD  +I +  ++    +I   
Sbjct: 134 NAFNALLKTLEEPPEHAKFIFATTEPHKIPITILSRCQRFDFRKIPLPLIVARLKEIAAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I     ++ ++AR  +GS RD  S  DQ IA C D +    V+ +L + DR  ++D  
Sbjct: 194 EGISISERSLGLVARRGEGSMRDAQSTFDQVIAFCGDAVGEDDVQGLLGMVDRRLLVDTL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   +L       + G +      +L E    +  +K +PE    L  +  E  
Sbjct: 254 ESLLGHDSRRLLHCVCRVDELGHSFRQFCRELVETLRSLVVLKVVPEPEALLDATPDELE 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
              + S  V +  L R   ++++  +E+ G S P  A+EM L+RLAH   LPS  ++A  
Sbjct: 314 ELRRLSATVELEDLERAVTVLVRTEAELAGSSFPRLALEMALLRLAH---LPSGRDVATL 370

Query: 361 I 361
           +
Sbjct: 371 V 371


>gi|326560228|gb|EGE10616.1| DNA polymerase III gamma and tau subunit [Moraxella catarrhalis
           7169]
          Length = 748

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 210/345 (60%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + + L+NA  +GR+  +Y+ +GTRG+GKTT ARI+A+ LN +T     P     
Sbjct: 20  LLGQSHVAQALSNAIDTGRLHHAYLFTGTRGVGKTTIARILAKCLNCETGMTSQPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C +I +G  +D++E+DAAS T ++D RE+++ + Y P+  R++VY++DEV MLST
Sbjct: 76  GVCDTCISIDQGRFLDLIEIDAASRTKVEDTRELLENVPYPPVQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+FATT+ +K+PIT++SRC +F L  +    L +   K+L  
Sbjct: 136 HSFNALLKTLEEPPDYVKFVFATTDPQKLPITIISRCLQFVLRPLPQACLSDHLAKVLDA 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F   A+  +A  + GS RD LSL DQAIA    +I T +V  ML L +R  ++++ 
Sbjct: 196 EKIPFTENALWQLASTAKGSVRDALSLTDQAIAFGGGQIQTDTVLSMLGLVNRTDVLEII 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D + + Q  ++  D  V+ + I  +L +  H +  ++ +P++   +   +A   
Sbjct: 256 ETVYHDDRMAISQLITNMRDKMVDATAIFDELIDCIHQMALMQVLPDIPLDMNDEQAHQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           + L  S  +S   L  ++++++K    I   S PM+A+EM ++RL
Sbjct: 316 KRL--SSAISSDILQLYYEILIKSRDGIRLASTPMQALEMGILRL 358


>gi|134295858|ref|YP_001119593.1| DNA polymerase III subunits gamma and tau [Burkholderia
           vietnamiensis G4]
 gi|134139015|gb|ABO54758.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           vietnamiensis G4]
          Length = 880

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+ +A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+  ++ L 
Sbjct: 194 EQISFEQQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAGDGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 311 DLRRFAQTLSPEKVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|292493699|ref|YP_003529138.1| DNA polymerase III subunits gamma and tau [Nitrosococcus halophilus
           Nc4]
 gi|291582294|gb|ADE16751.1| DNA polymerase III, subunits gamma and tau [Nitrosococcus
           halophilus Nc4]
          Length = 531

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 213/345 (61%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L N   + R+  +++ +GTRG+GKTT ARI+A+SLN +      P     
Sbjct: 18  LVGQEHVVRALINGLDNDRLHHAFLFTGTRGVGKTTLARILAKSLNCEEGVGSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++CQAI  G+ VD++E+DAAS T +DD RE+++ ++Y P   R++VY++DEV M ST
Sbjct: 74  GNCQNCQAIDAGSFVDLIEVDAASRTGVDDTRELLENVHYAPSRGRYKVYLIDEVHMFST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPH+KF+ ATT+ +K+P+TVLSRC +F+L RI+   +     KIL E
Sbjct: 134 SSFNALLKTLEEPPPHIKFLLATTDPKKLPVTVLSRCLQFNLRRITPQVIASHLDKILSE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  + +A+ +IAR ++GS RD LSLLDQAI+    ++ T+ VR ML   ++  ++ L 
Sbjct: 194 EQIPSEFQALTLIARTAEGSMRDALSLLDQAISYGGGQVTTTDVRTMLGNIEQRDLLVLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ G+   ++ +     D+ V+   IL DL      +   ++ P+  D +   EA + 
Sbjct: 254 DALLAGNGQELIGKVREICDNSVDIPSILADLLHLLQRLALYQFAPDTVDDIDEREAFHG 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            A + + E     +  F+Q+ L G  ++     P  A EM+L+R+
Sbjct: 314 LAARMTPE----DVQLFYQIGLIGSRDLAYAPDPRGAFEMILLRM 354


>gi|238754273|ref|ZP_04615630.1| DNA polymerase III subunit gamma [Yersinia ruckeri ATCC 29473]
 gi|238707520|gb|EEP99880.1| DNA polymerase III subunit gamma [Yersinia ruckeri ATCC 29473]
          Length = 648

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 199/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GKCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+LQ 
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRTQLEKVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ D  A+ ++ARA+DGS RD LSL DQA++    ++ T++V  ML   D  + + + 
Sbjct: 194 EQIDSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H V  I+ +P M D   +  A   
Sbjct: 254 EALVSADGARVMAQVEQAASRGVDWENLLVETLSLLHRVAMIQLLPSMLDN--HYVAVEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|253999384|ref|YP_003051447.1| DNA polymerase III subunits gamma and tau [Methylovorus sp. SIP3-4]
 gi|253986063|gb|ACT50920.1| DNA polymerase III, subunits gamma and tau [Methylovorus sp.
           SIP3-4]
          Length = 610

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 186/287 (64%), Gaps = 4/287 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LTNA +  R+  +Y+ +GTRG+GKTT ARI+A+SLN +T     P     
Sbjct: 18  LVGQEHVVRALTNALEQQRLHHAYLFTGTRGVGKTTLARILAKSLNCETGITAHPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I RG  VD++E+DAAS+T +D +RE++D   Y P   RF+VYI+DEV MLS 
Sbjct: 74  GVCSACVDIDRGRFVDMLEVDAASNTQVDSMRELLDNAQYAPTVGRFKVYIIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +K+P+TVLSRC +F+L ++S   +     ++L +
Sbjct: 134 SAFNAMLKTLEEPPAHVKFILATTDPQKMPVTVLSRCLQFNLRQMSTPAITSHLQEVLAK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  D  A+ +I+RA++GS RD LSLLDQAIA   +++  S VR ML   D++ +  L 
Sbjct: 194 ENIPSDSIALQLISRAANGSMRDALSLLDQAIAYGGNRVNESEVRAMLGAIDQSYLYGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE 287
             LI  D  +++ +  S  +  ++    L DLA+  H +   + +PE
Sbjct: 254 DALIAQDGPSLMAQAKSMEERSLSFDTALADLAQLLHHLAVAQTVPE 300


>gi|304395534|ref|ZP_07377417.1| DNA polymerase III, subunits gamma and tau [Pantoea sp. aB]
 gi|304356828|gb|EFM21192.1| DNA polymerase III, subunits gamma and tau [Pantoea sp. aB]
          Length = 692

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + +    +L++
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALDVDQIRQQLEHVLKQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +  A+ ++ARA+DGS RD LSL DQAIA     + +++V +ML   D  + + L 
Sbjct: 194 EQIESETRALQLLARAADGSMRDALSLTDQAIAMGQGAVTSNTVSVMLGTLDDEQPLGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ GD   V+   S     GV    +L ++    H +  ++ +P    +L   +  NA
Sbjct: 254 EALVDGDGQQVMTLLSQAASRGVEWEALLVEMLRLLHQIAMVQLLPA---SLSDDDESNA 310

Query: 301 -RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            R  + ++ V    L  ++Q +L G  ++         VEM L+R
Sbjct: 311 LRLRELARVVPPADLQLYYQTLLMGRKDLPIAPDRRMGVEMTLLR 355


>gi|85058667|ref|YP_454369.1| DNA polymerase III gamma and tau subunits [Sodalis glossinidius
           str. 'morsitans']
 gi|84779187|dbj|BAE73964.1| DNA polymerase III gamma and tau subunits [Sodalis glossinidius
           str. 'morsitans']
          Length = 734

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 202/344 (58%), Gaps = 5/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+LSGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLLSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIKQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +    + +LQ+
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRNQLSSVLQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA    ++   +V LML   +  + + L 
Sbjct: 194 EQIVTEPRALQLLARAADGSMRDALSLTDQAIAMGQGEVSAEAVSLMLGTLNTEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   ++ + +     G++   +L ++    H +   + +P+  +      A  A
Sbjct: 254 EALANADGGAMMAQLAQCAARGMDWESLLVEMLSLLHRLALCQLVPDQLNN-EDDPASVA 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R    ++ +    L  ++Q++L G  E+     P   VEM L+R
Sbjct: 313 RLRDLARRLPPADLQLYYQILLIGRKELPFAPDPRMGVEMTLLR 356


>gi|284799544|ref|ZP_06390208.1| DNA polymerase III, subunit gamma and tau [Neisseria subflava
           NJ9703]
 gi|284797352|gb|EFC52699.1| DNA polymerase III, subunit gamma and tau [Neisseria subflava
           NJ9703]
          Length = 398

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 205/351 (58%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAVHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GQCESCTQIDSGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+PITVLSRC +F L  ++   + E    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPITVLSRCLQFVLRNMTTQQVAEHLAHVLDR 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++ + P+A+ ++ RA+ GS RD LSLLDQAIA  + K+    VR M+   D+  + +L 
Sbjct: 194 ENVPYQPQALQLLGRAAAGSMRDALSLLDQAIAMGSGKVAEQDVRQMIGAVDKQYLFELL 253

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             +I  +   ++   QE S++   +DS          LAE   L+ R+  I  +   L  
Sbjct: 254 EGIINQNGEALLEKAQEMSARAIGFDSA---------LAELAMLLQRLALIQTIPSALAN 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            + E     + S+ +S   +  ++Q  + G  ++           M L+R+
Sbjct: 305 DDPERETLQRLSQALSGEQIQLYYQCAIHGKQDLPLAPDEYAGFVMTLLRM 355


>gi|167836377|ref|ZP_02463260.1| DNA polymerase III subunits gamma and tau [Burkholderia
           thailandensis MSMB43]
          Length = 376

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++S+ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFSELLSPEQVQLYYQIATLGRGELGLAPDEYAGFTMTLLRM 355


>gi|221208413|ref|ZP_03581416.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           multivorans CGD2]
 gi|221171826|gb|EEE04270.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           multivorans CGD2]
          Length = 387

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 210/348 (60%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAELLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|167562528|ref|ZP_02355444.1| DNA polymerase III subunits gamma and tau [Burkholderia
           oklahomensis EO147]
          Length = 356

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EEIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++S+ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFSELMSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|323526149|ref|YP_004228302.1| DNA polymerase III subunits gamma and tau [Burkholderia sp.
           CCGE1001]
 gi|323383151|gb|ADX55242.1| DNA polymerase III, subunits gamma and tau [Burkholderia sp.
           CCGE1001]
          Length = 944

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI +++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFSKALNCETGVSSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + ++ +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYEAQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GD   VL          ++ S  L DLA   H +   ++ P    ++L    E  
Sbjct: 254 DALAQGDGAAVLSVADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +++  +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFADMLSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|86148367|ref|ZP_01066660.1| DNA polymerase III subunits gamma and tau [Vibrio sp. MED222]
 gi|85833850|gb|EAQ52015.1| DNA polymerase III subunits gamma and tau [Vibrio sp. MED222]
          Length = 758

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 202/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQAHVLTALENALSQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECATCKEIDEGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  IS+ ++ E    IL++
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVDNIHEQLDHILEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ MIA A+DGS RD LSL DQAIA  N  +VT +V  ML   D ++ + L 
Sbjct: 194 ENVTSEPRALGMIAHAADGSMRDALSLSDQAIALGNGNVVTDTVAHMLGTLDTDQAIHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +    +  ++GV    +L  LA   H +   + +P    TL  ++ +  
Sbjct: 254 EAISSKQPQQAMACIQALAENGVEWDGLLSQLATQLHRLAMYQALP---STLDKAQPDAE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R    SK +S   +  ++Q++LKG  ++         +EMV++R+
Sbjct: 311 RLELLSKTLSPQDIQLYYQIVLKGRQDLPLSPTARVGIEMVVLRM 355


>gi|240948992|ref|ZP_04753346.1| DNA polymerase III subunits gamma and tau [Actinobacillus minor
           NM305]
 gi|240296579|gb|EER47197.1| DNA polymerase III subunits gamma and tau [Actinobacillus minor
           NM305]
          Length = 698

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 205/345 (59%), Gaps = 13/345 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  + GR+  +Y+ SGTRG+GKT+ AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLSALENGLREGRLHHAYLFSGTRGVGKTSIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G  +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      IL+ 
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALDQTQIAHHLEFILKA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++  A+  +A+A++GS RD LSL DQAIA  N  +  S+V  ML L D ++ ++L 
Sbjct: 194 EQIPYETAAIEKLAKAAEGSIRDSLSLTDQAIAVTNANVTLSAVSQMLGLIDDHQPLELI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   V+    +  + GV+ + +L+D+AE  H +  ++        L+ S  +  
Sbjct: 254 MALANADGEKVMAVIQNVAEKGVDWNQLLNDVAEVLHQIAMLQ--------LVKSAEQEE 305

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A+ + +K+++   +  F+Q+IL G  E+         VEM  +R
Sbjct: 306 SAIHFLAKQMAPEDIQFFYQVILMGKKELPLAPEQRSGVEMTFLR 350


>gi|320354016|ref|YP_004195355.1| DNA polymerase III subunits gamma and tau [Desulfobulbus
           propionicus DSM 2032]
 gi|320122518|gb|ADW18064.1| DNA polymerase III, subunits gamma and tau [Desulfobulbus
           propionicus DSM 2032]
          Length = 648

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 209/364 (57%), Gaps = 11/364 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQK +++TL NA    R+AQ+ + SG RG GKTT ARI+A++LN +      P  E  
Sbjct: 18  VVGQKAVVRTLQNALAQQRVAQALIFSGVRGTGKTTLARIMAKALNCEQG----PATEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+ I  G  +D+ E+D AS+  I ++RE+ ++I + P S+R+++ I+DEV ML+T
Sbjct: 74  NLCRSCRDIADGASIDLQEVDGASNRGIQEIRELKEKIRFMPTSSRYKIIIIDEVHMLTT 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HV F+FATTE+ K+P+T+LSRCQR++L R+   +L   FT++ ++
Sbjct: 134 EAFNALLKTLEEPPDHVYFMFATTELHKVPVTILSRCQRYELKRLGHRELAAHFTRLAEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +P AV MI R + GS RDGLSLLDQ  + C  ++    V  +L L     I DL 
Sbjct: 194 EGVRMEPAAVDMIVREAGGSVRDGLSLLDQIFSYCGQEVRAEEVVEVLGLVSHQLIADLG 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+ GD+  V       Y  G +     +DL ++   +   K        L  +E E A
Sbjct: 254 SALLNGDLGAVYVLLDQMYLHGTDIKRFSNDLLQWFRDLVVCKVSKHSGQFLEVTEDEQA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQ----LPSPEE 356
              Q +   S+  +S  + ++L+G+ ++    +P   +E+  IR   AVQ    +P  E 
Sbjct: 314 ALEQTAASYSLETISALFNLLLEGLEKVSVSQQPRLTLELTFIR---AVQFRDVVPVAEL 370

Query: 357 IARY 360
           I+R+
Sbjct: 371 ISRF 374


>gi|218708914|ref|YP_002416535.1| DNA polymerase III subunits gamma and tau [Vibrio splendidus LGP32]
 gi|218321933|emb|CAV17928.1| DNA polymerase III subunit tau [Vibrio splendidus LGP32]
          Length = 752

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 202/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQAHVLTALENALSQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECATCKEIDEGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  IS+ ++ E    IL++
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVDNIHEQLDHILEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ MIA A+DGS RD LSL DQAIA  N  +VT +V  ML   D ++ + L 
Sbjct: 194 ENVTSEPRALGMIAHAADGSMRDALSLSDQAIALGNGNVVTDTVAHMLGTLDTDQAIHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +    +  ++GV    +L  LA   H +   + +P    TL  ++ +  
Sbjct: 254 EAISSKQPQQAMACIQALAENGVEWDGLLSQLATQLHRLAMYQALP---STLDKAQPDAE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R    SK +S   +  ++Q++LKG  ++         +EMV++R+
Sbjct: 311 RLELMSKTLSPQDIQLYYQIVLKGRQDLPLSPTARVGIEMVVLRM 355


>gi|91783455|ref|YP_558661.1| DNA-directed DNA polymerase [Burkholderia xenovorans LB400]
 gi|91687409|gb|ABE30609.1| DNA-directed DNA polymerase [Burkholderia xenovorans LB400]
          Length = 957

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++     IL E
Sbjct: 134 HAFNAMLKTLEEPPAHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +D +A+ ++ARA+DGS RD LSL DQAIA   +++   +VR ML   D++ ++ L 
Sbjct: 194 EKVPYDVQALRLLARAADGSMRDALSLTDQAIAYSANQVNEEAVRGMLGALDQSYLIRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   VL          ++ S  L DLA   H +   ++ P    ++L    E  
Sbjct: 254 DALADGDGAAVLSVADEMALRSLSFSTALQDLASLLHRIAWAQFAPS---SVLDEWPEAG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  F+Q+   G SE+           M L+R+
Sbjct: 311 DLRRFAEALSAEQVQLFYQIATIGRSELGLAPDEYAGFTMTLLRM 355


>gi|127513163|ref|YP_001094360.1| DNA polymerase III, subunits gamma and tau [Shewanella loihica
           PV-4]
 gi|126638458|gb|ABO24101.1| DNA polymerase III, subunits gamma and tau [Shewanella loihica
           PV-4]
          Length = 1113

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 128/344 (37%), Positives = 202/344 (58%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  VVGQSHVLHALTNALSQNRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GQCASCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +++P+TVLSRC +F+L  +++ ++      IL +
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQRLPVTVLSRCLQFNLKSLTLDEICVQLGHILAQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +D  AV ++A+A++GS RD LSL DQAIA    ++  + V+ ML   D + ++ L 
Sbjct: 194 EQVGYDDGAVKLLAKAANGSMRDALSLTDQAIAFGAGQVRLTQVQTMLGTIDEHHVIVLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD+  +++        G +P  +L  L E  H +T  ++ P  A    Y+E   A
Sbjct: 254 KALCDGDVDLLMKVTGDVLSFGADPHEVLRSLLELLHQITLTQFAPSAAQLSQYAEQIKA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q   E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 314 FAKQLRPEQ----VQLYYQLLLNGRQDLPHAPDPKSGLEMALLR 353


>gi|237730453|ref|ZP_04560934.1| DNA polymerase III gamma and tau [Citrobacter sp. 30_2]
 gi|226905992|gb|EEH91910.1| DNA polymerase III gamma and tau [Citrobacter sp. 30_2]
          Length = 642

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 212/361 (58%), Gaps = 8/361 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL+E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILKE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAADGSLRDALSLTDQAIASGDGQVSTEAVSTMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D   V+   +     G+    +L +++   H +  ++  P    + + +  +  
Sbjct: 254 EAVVAADGERVMALVNDAAARGIEWEALLVEMSALLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE-EIA 358
           R L  ++ V  T +  ++Q +L G  E+         VEM L+R LA   ++P PE E+ 
Sbjct: 314 REL--ARIVPPTDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVP 371

Query: 359 R 359
           R
Sbjct: 372 R 372


>gi|153006600|ref|YP_001380925.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter sp.
           Fw109-5]
 gi|152030173|gb|ABS27941.1| DNA polymerase III, subunits gamma and tau [Anaeromyxobacter sp.
           Fw109-5]
          Length = 606

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 202/343 (58%), Gaps = 6/343 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M GQ+ +++TL+NA K+G++A +++ +G RG+GKTTTAR++A++LN +      PT E  
Sbjct: 18  MSGQQHVVRTLSNALKTGQLAHAFLFTGPRGVGKTTTARLVAKALNCEKG----PTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VDVVE+DAAS+  +D+VR+I++ + Y+P   R++V+++DEV MLST
Sbjct: 74  GACTPCVEIAEGRAVDVVEIDAASNNGVDNVRDIVEAVKYRPARDRYKVFVVDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKF+ ATT++ K+P T+LSRCQRFD  R+++  + +   K+ + 
Sbjct: 134 GAFNALLKTLEEPPEHVKFVLATTDVHKVPETILSRCQRFDFRRLTLQQIADQLAKVAEA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +   P A+A++AR ++G  RD LSLLDQ  A   D    ++V   L   D   I  + 
Sbjct: 194 EGMRLAPGALALVARQAEGGMRDALSLLDQVRAAAGDAPDEAAVAEALGAVDAAAISRIC 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
           G L+  +   +L E  + +  G+    +  ++      V   + +P  A  L   + E A
Sbjct: 254 GALVHREGGALLAELEALHARGLEMKRVAEEIVRHLRNVVVARLVP--ATPLDLPDGELA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLI 343
                +       L+R + +  + + +++   +P  A+E+ L+
Sbjct: 312 EVRAQAAAADPAQLTRLFDLAQRAVVQVKLSEQPRYALEVALL 354


>gi|50120115|ref|YP_049282.1| DNA polymerase III subunits gamma and tau [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610641|emb|CAG74086.1| DNA polymerase III subunit tau [Pectobacterium atrosepticum
           SCRI1043]
          Length = 691

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +      P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     ++LQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAHLEQVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA+DGS RD LSL DQAIA    ++ T+SV  ML   D  + + L 
Sbjct: 194 ENLASEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTTASVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-EMADTLLYSEAEN 299
             L KGD   V+         GV+   +L +     H +  ++ +P  + D   Y+  E 
Sbjct: 254 EALAKGDGGQVMSLLDQVAARGVDWESLLVETQTLLHRIAMVQLLPAALGDD--YAAVE- 310

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           AR  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 311 ARIRELARALPPADVQLYYQTMLIGRKELPFAPDRRMGVEMTLLR 355


>gi|297569219|ref|YP_003690563.1| DNA polymerase III, subunits gamma and tau [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925134|gb|ADH85944.1| DNA polymerase III, subunits gamma and tau [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 678

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 207/361 (57%), Gaps = 6/361 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDV-PTVEF 59
           ++GQ+P+++TL NA +  R+A + + SG RG+GKTT ARI+A++LN   A  +  P  + 
Sbjct: 18  VVGQRPVVRTLQNALRRERVAHAMLFSGVRGVGKTTLARIMAKALNCLAAEAEQRPCNQC 77

Query: 60  EGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLS 119
                 C A   G  VD+ E+D AS+  I ++RE+ + I + P++ ++++ I+DEV ML+
Sbjct: 78  A----SCLAFNAGQAVDLHEIDGASNRGIQEIRELKENIRFMPVAGKYKIVIIDEVHMLT 133

Query: 120 TAAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQ 179
           T AFN LLKTLEEPP HV F+FATTE+ KIP+T+LSRCQR +L R+   +L + F ++  
Sbjct: 134 TEAFNALLKTLEEPPAHVYFMFATTELHKIPVTILSRCQRHELTRVPFAELQDFFRRVAA 193

Query: 180 EESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDL 239
            E +E    A+ MI R +DGS RDGLSLLDQ  +    ++    VR ML L DR     L
Sbjct: 194 AEEVEIPDSALEMIVREADGSVRDGLSLLDQVFSFGGRQVADEDVRQMLGLVDRRTFEQL 253

Query: 240 FGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAEN 299
              L+  D+   L+ F   Y +G++      DL  +   +   +     A  L  ++ E 
Sbjct: 254 ARALLAPDLARCLELFDQCYRAGLDLKRFAGDLLNYFRNLVVCRNTGRAAGLLDLADQEL 313

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQL-PSPEEIA 358
           A   + +   S   L   + ++LKG+ E++  SRP   +EM  +R A A  + P+ E + 
Sbjct: 314 AALEEIAAAHSPETLLYCFNLLLKGVEEMQYASRPKLVLEMTFVRAAQAGGIVPTSEVLG 373

Query: 359 R 359
           R
Sbjct: 374 R 374


>gi|167569714|ref|ZP_02362588.1| DNA polymerase III subunits gamma and tau [Burkholderia
           oklahomensis C6786]
          Length = 553

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EEIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELMSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|238795502|ref|ZP_04639017.1| DNA polymerase III subunit gamma [Yersinia mollaretii ATCC 43969]
 gi|238720621|gb|EEQ12422.1| DNA polymerase III subunit gamma [Yersinia mollaretii ATCC 43969]
          Length = 655

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 200/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N+   GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANSLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +  L  KILQ 
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRALLEKILQL 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA+A  +  I T++V  ML   D  + + + 
Sbjct: 194 EHISSDARALQLLARAADGSMRDALSLTDQAVAMGDGSITTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQVEQAASRGVDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|221198096|ref|ZP_03571142.1| DNA polymerase III subunit tau [Burkholderia multivorans CGD2M]
 gi|221182028|gb|EEE14429.1| DNA polymerase III subunit tau [Burkholderia multivorans CGD2M]
          Length = 818

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 210/348 (60%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAELLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|260596869|ref|YP_003209440.1| DNA polymerase III subunits gamma and tau [Cronobacter turicensis
           z3032]
 gi|260216046|emb|CBA28758.1| DNA polymerase III subunit tau [Cronobacter turicensis z3032]
          Length = 667

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 204/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 40  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 95

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 96  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 155

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  +    + +    +L +
Sbjct: 156 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLRALDPDQIRQQLEHVLTQ 215

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 216 EGIAHEPRALQLLARAADGSLRDALSLTDQAIASGDGQVTTQAVGAMLGTLDDDQALSLI 275

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+Q+ +     GV    +L ++    H V  ++  P      +       
Sbjct: 276 EALVAADGERVMQQINDAAARGVEWEALLVEMLGLLHRVAMVQLSPSALGADMAPLEPRL 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    +  ++Q +L G  E+         VEM ++R LA   + P PE
Sbjct: 336 REL--ARAVPPGDIQLYYQTLLIGRKELPWAPERRMGVEMTMLRALAFHPRAPLPE 389


>gi|261855382|ref|YP_003262665.1| DNA polymerase III subunits gamma/tau [Halothiobacillus
           neapolitanus c2]
 gi|261835851|gb|ACX95618.1| DNA polymerase III, subunits gamma and tau [Halothiobacillus
           neapolitanus c2]
          Length = 591

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 198/345 (57%), Gaps = 11/345 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  +++ LTNA    R+  +Y+ +GTRG+GKTT ARI A++LN +      P     
Sbjct: 18  MVGQGHVLQALTNALDQSRLHHAYLFTGTRGVGKTTVARIFAKALNCEHGISSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD R++++ + Y P+  RF++Y++DEV M S 
Sbjct: 74  GVCSACVEIDQGRFVDLIEVDAASRTGVDDTRDLLENVAYAPVRGRFKIYLIDEVHMFSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  + +  + +    +LQ+
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLRALPLSQIQQHLADVLQK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+P A+ +IA A++GS RD LSLLDQAIA    K+ T  V  +L L+D   I D+ 
Sbjct: 194 ENIAFEPAALHLIAEAANGSMRDALSLLDQAIAFTGGKLDTVQVSQILGLSDHQIIWDMI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +     +        D  V P+++L    E  H +   ++I  M      S A N 
Sbjct: 254 DALYQQSADRLFALVDEALDRAVEPAILLAQFIESIHQLAMGQWIQSM------SAAANP 307

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +  K +    L  ++Q+   G  ++         +EM L+R+
Sbjct: 308 PPDEL-KSIDPQLLQLWYQIATTGRRDMAWSPNARIGLEMTLLRM 351


>gi|167823844|ref|ZP_02455315.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 9]
          Length = 381

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|78066597|ref|YP_369366.1| DNA polymerase III subunits gamma and tau [Burkholderia sp. 383]
 gi|77967342|gb|ABB08722.1| DNA-directed DNA polymerase [Burkholderia sp. 383]
          Length = 791

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 208/348 (59%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+  ++ L 
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGGGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E     +++  +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAGDLRRFADTLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|167738244|ref|ZP_02411018.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 14]
          Length = 380

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|167893928|ref|ZP_02481330.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 7894]
          Length = 387

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|167918645|ref|ZP_02505736.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei BCC215]
          Length = 423

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|170718500|ref|YP_001783712.1| DNA polymerase III subunits gamma/tau [Haemophilus somnus 2336]
 gi|168826629|gb|ACA32000.1| DNA polymerase III, subunits gamma and tau [Haemophilus somnus
           2336]
          Length = 667

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 213/368 (57%), Gaps = 30/368 (8%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L+N     R+  +Y+ SGTRG+GKT+ AR+ A+ LN     I   T E  
Sbjct: 18  VVGQEHILTALSNGLCENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----IRGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI  G  +D++E+DAAS T ++D RE++D + YKP   R++VY++DEV MLS 
Sbjct: 74  GECEHCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +S   + +    ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLKALSEKQIAQHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+  A+  +A A+ GS RD LSL DQAIA  N  +   +V +ML L D N+ +D+ 
Sbjct: 194 ENIPFEYPALEKLATAAQGSIRDSLSLTDQAIAMGNANVSLDTVSIMLGLLDDNQPIDIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   +++   +  + G +   +L  LAE  H +  ++ +P+             
Sbjct: 254 YALQQGNGEMLMKAIQAVAEKGADWDKLLVTLAEKLHQIAMLQLLPQ------------- 300

Query: 301 RALQYSKEVSITFLSR---------FWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQ 350
              Q ++E S+ FL++         F+Q+I+ G  E+          EM+L+R LA   +
Sbjct: 301 ---QINEENSLGFLAKHITPEDVQFFYQVIVSGRKELASAPNHRIGAEMILLRSLAFHPK 357

Query: 351 LPSPEEIA 358
             SP   A
Sbjct: 358 FISPSSAA 365


>gi|167815434|ref|ZP_02447114.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 91]
          Length = 378

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|113461343|ref|YP_719412.1| DNA polymerase III subunits gamma and tau [Haemophilus somnus
           129PT]
 gi|112823386|gb|ABI25475.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Haemophilus somnus 129PT]
          Length = 667

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 213/368 (57%), Gaps = 30/368 (8%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L+N     R+  +Y+ SGTRG+GKT+ AR+ A+ LN     I   T E  
Sbjct: 18  VVGQEHILTALSNGLCENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----IRGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI  G  +D++E+DAAS T ++D RE++D + YKP   R++VY++DEV MLS 
Sbjct: 74  GECEHCKAIEEGRFIDLIEIDAASRTKVEDTRELLDNVQYKPTQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +S   + +    ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLKALSEKQIAQHLEFILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+  A+  +A A+ GS RD LSL DQAIA  N  +   +V +ML L D N+ +D+ 
Sbjct: 194 ENIPFEYPALEKLATAAQGSIRDSLSLTDQAIAMGNANVSLDTVSIMLGLLDDNQPIDIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   +++   +  + G +   +L  LAE  H +  ++ +P+             
Sbjct: 254 YALQQGNGEMLMKAIQTVAEKGADWDKLLVTLAEKLHQIAMLQLLPQ------------- 300

Query: 301 RALQYSKEVSITFLSR---------FWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQ 350
              Q ++E S+ FL++         F+Q+I+ G  E+          EM+L+R LA   +
Sbjct: 301 ---QINEENSLGFLAKHITPEDVQFFYQVIVSGRKELASAPNHRIGAEMILLRSLAFHPK 357

Query: 351 LPSPEEIA 358
             SP   A
Sbjct: 358 FISPSSAA 365


>gi|167619803|ref|ZP_02388434.1| DNA polymerase III subunits gamma and tau [Burkholderia
           thailandensis Bt4]
          Length = 378

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|330002982|ref|ZP_08304507.1| DNA polymerase III, subunit gamma and tau [Klebsiella sp. MS 92-3]
 gi|328537093|gb|EGF63372.1| DNA polymerase III, subunit gamma and tau [Klebsiella sp. MS 92-3]
          Length = 635

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      +   A   
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMA--AVEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R  + ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|238893440|ref|YP_002918174.1| DNA polymerase III subunits gamma and tau [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238545756|dbj|BAH62107.1| DNA polymerase III subunits gamma and tau [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 635

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      +   A   
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMA--AVEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R  + ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|167910620|ref|ZP_02497711.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 112]
          Length = 409

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|152969025|ref|YP_001334134.1| DNA polymerase III subunits gamma and tau [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|150953874|gb|ABR75904.1| DNA polymerase III subunits gamma and tau [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 635

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      +   A   
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMA--AVEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R  + ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|161524619|ref|YP_001579631.1| DNA polymerase III subunits gamma and tau [Burkholderia multivorans
           ATCC 17616]
 gi|189350625|ref|YP_001946253.1| DNA polymerase III subunits gamma and tau [Burkholderia multivorans
           ATCC 17616]
 gi|160342048|gb|ABX15134.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           multivorans ATCC 17616]
 gi|189334647|dbj|BAG43717.1| DNA polymerase III gamma and tau subunit [Burkholderia multivorans
           ATCC 17616]
          Length = 821

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/348 (37%), Positives = 210/348 (60%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAELLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|307129958|ref|YP_003881974.1| DNA polymerase III/DNA elongation factor III, tau and subunit
           gammas [Dickeya dadantii 3937]
 gi|306527487|gb|ADM97417.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Dickeya dadantii 3937]
          Length = 672

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 198/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDTCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    + +   ++L++
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDAEQIRQHLQQVLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +P A+ ++ARA+DGS RD LSL DQAIA    ++  ++V  ML   D  + + L 
Sbjct: 194 EQLAAEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTAAAVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LIKGD   V+         GV+   +L +     H +  ++ +P          A   
Sbjct: 254 EALIKGDGAGVMALMGQAASRGVDWEALLVETLTLLHRIAMLQLLPSALGEEYNQVAPRL 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R L  ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 314 REL--ARVIPPAEVQLYYQTLLVGRKELPYAPDRRMGVEMTLLR 355


>gi|226197211|ref|ZP_03792788.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei Pakistan 9]
 gi|225930590|gb|EEH26600.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei Pakistan 9]
          Length = 531

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|238563644|ref|ZP_00438506.2| DNA polymerase III, subunits gamma and tau [Burkholderia mallei GB8
           horse 4]
 gi|238520253|gb|EEP83715.1| DNA polymerase III, subunits gamma and tau [Burkholderia mallei GB8
           horse 4]
          Length = 449

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|167581686|ref|ZP_02374560.1| DNA polymerase III subunits gamma and tau [Burkholderia
           thailandensis TXDOH]
          Length = 384

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|167719247|ref|ZP_02402483.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei DM98]
          Length = 376

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|332142051|ref|YP_004427789.1| DNA polymerase III subunits gamma and tau [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327552073|gb|AEA98791.1| DNA polymerase III subunits gamma and tau [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 930

 Score =  242 bits (617), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 218/352 (61%), Gaps = 21/352 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  ++NA  + R+  +Y+ +GTRG+GKTT ARI ++SLN +      P     
Sbjct: 18  LVGQEHVVSAISNALDNDRLHHAYLFTGTRGVGKTTIARIFSKSLNCEEGQGANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I +GN+VD++E+DAAS T ++D RE++D + YKP   R++VY++DEV MLS 
Sbjct: 74  GQCNTCKEIEQGNYVDLLEIDAASRTKVEDTRELLDNVQYKPTRGRYKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+PIT+LSRC +F+L  +S   ++   T ILQ+
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPITILSRCLQFNLKAMSREQIVGQLTHILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+  A+A++ARA+ GS RD LSL DQAIA+  ++++ S V  ML L D+N+++ + 
Sbjct: 194 EQLAFEAPALALLARAAQGSMRDALSLTDQAIAQGGNQVMASVVTDMLGLMDKNQLLKVI 253

Query: 241 GYLIKGDIINVLQ------EFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             ++      VLQ      E +  YD+      +  +LA   H +   +++PE       
Sbjct: 254 HAVVNKSPAEVLQLVNDIAEQAPDYDN------VHSELASLLHQIALTQWVPEACKL--- 304

Query: 295 SEAENARAL-QYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            E  +A+A+ Q +K +S   +   +Q+ L+G  ++   +    A EM L+R+
Sbjct: 305 -ETTSAKAIFQLAKTISAEQVQLLYQIALQGRKDLPFAADGKSAFEMTLMRM 355


>gi|153001132|ref|YP_001366813.1| DNA polymerase III subunits gamma and tau [Shewanella baltica
           OS185]
 gi|151365750|gb|ABS08750.1| DNA polymerase III, subunits gamma and tau [Shewanella baltica
           OS185]
          Length = 1137

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 130/344 (37%), Positives = 199/344 (57%), Gaps = 8/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 45  MVGQSHVLHALTNALSQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGVTATPC---- 100

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I +G  VD++E+DAAS T +DD RE++D + Y+P   RF+VY++DEV MLS 
Sbjct: 101 GVCGSCVEIAQGRFVDLIEVDAASRTKVDDTRELLDNVQYRPTRGRFKVYLIDEVHMLSR 160

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++  ++      IL +
Sbjct: 161 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKSLTQSEIGTQLNHILTQ 220

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E   F+ EA+ ++A+A++GS RD LSL DQAIA     ++ + V+ ML   D   ++ L 
Sbjct: 221 EQFPFEAEALKLLAKAANGSMRDALSLTDQAIAFGGGSVMLTQVQTMLGSIDEQHVVALL 280

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   DI  ++   +     G +   +L  L E  H +T  ++ P  A   LYS    A
Sbjct: 281 KALTDADIGVLMHTCAQVLAYGADAQEVLRSLLELLHQITLTQFAPVCAQQSLYSAQIRA 340

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A Q + E     +  ++Q++L G  ++     P   +EM L+R
Sbjct: 341 FAEQLTPEQ----VQLYYQILLTGRKDLPHAPDPKSGLEMALLR 380


>gi|261868269|ref|YP_003256191.1| hypothetical protein D11S_1608 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413601|gb|ACX82972.1| hypothetical protein D11S_1608 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 467

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 204/344 (59%), Gaps = 10/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     +   T E  
Sbjct: 18  VVGQQHILTALANGLRENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VSGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC AI +GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GVCEHCNAIEKGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVLGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+  K+P+T+LSRC +F L  +    + +    IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPHKLPVTILSRCMQFHLKALEQSQIADYLAYILNQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+  +A A+ GS RD LSL DQAIA  N  +  + V  ML L D ++ +++ 
Sbjct: 194 EQIPFESLALDKLANAAQGSIRDSLSLTDQAIAMSNGNVTLNIVNDMLGLLDESQAIEMI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   ++Q  ++  D   +   +L ++AE  H +   + +P+ A        E++
Sbjct: 254 YALQQGNGEKLMQAVNAVADKAGDWDELLREVAENLHKIAMQQLLPQAALD------ESS 307

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           +    +K ++   +  F+Q+++ G  E+          EMVL+R
Sbjct: 308 QIGFLAKHIAPQDVQFFYQVVVTGRKELSAAPTARMGAEMVLLR 351


>gi|95928309|ref|ZP_01311057.1| DNA polymerase III, subunits gamma and tau [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135580|gb|EAT17231.1| DNA polymerase III, subunits gamma and tau [Desulfuromonas
           acetoxidans DSM 684]
          Length = 597

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 140/373 (37%), Positives = 206/373 (55%), Gaps = 31/373 (8%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + +TL NA  SGR+  +++ +G RG+GKT+ ARI+A++LN +      P+ E  
Sbjct: 18  LVGQEHVSRTLANAIASGRVHHAFLFTGARGVGKTSAARILAKALNCENG----PSAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              +HC+ I  G+ VDV E+D AS+T +DDVRE+ + + Y P   R++++I+DEV MLS 
Sbjct: 74  NQCQHCEEISSGHSVDVFEIDGASNTGVDDVRELRETLRYMPSQCRYKIFIIDEVHMLSI 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFIFATTE  KIP+T+LSRCQRFD  +I    ++    +I+  
Sbjct: 134 NAFNALLKTLEEPPEHVKFIFATTEPHKIPVTILSRCQRFDFRKIPAPKVVAQLRRIVDA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I     A+A+IA+   GS RD LS LDQ +A C++++    V+ +L + DR  + D  
Sbjct: 194 ENITISDRALALIAQRGGGSMRDSLSTLDQVVAFCSEQVADEDVQGLLGMVDRRLLFDAL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
              ++ D   VL       D G       H   +F       + +  +   +L S  EN 
Sbjct: 254 EGCMRQDCSMVLNVVRRVDDLG-------HSFRQFCQ-----ELVETVRQAILCSLVENP 301

Query: 301 R--------ALQYSKEVSITFLSRFWQ----MILKGISEIEGFSRPMEAVEMVLIRLAHA 348
                     L   K +S       WQ    M++K  +E+   S P   VEM L+R   A
Sbjct: 302 EEDLGVFGDELHALKSLSALAGQDDWQRLLSMLIKVETELSASSFPRLLVEMTLVR---A 358

Query: 349 VQLPSPEEIARYI 361
             LP  ++IA  I
Sbjct: 359 ASLPPAKDIAGLI 371


>gi|167845385|ref|ZP_02470893.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei B7210]
          Length = 391

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 203/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+  +ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRFLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|227328730|ref|ZP_03832754.1| DNA polymerase III subunits gamma and tau [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 687

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 202/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +      P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     ++LQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAHLEQVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA+DGS RD LSL DQAIA    ++ T+SV  ML   D  + + L 
Sbjct: 194 ENLVSEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTTASVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-EMADTLLYSEAEN 299
             L KGD   V+         GV+   +L +     H +  ++ +P  + D   Y+  E 
Sbjct: 254 EALAKGDGAQVMSLLDQVAARGVDWESLLVETQTLLHRIAMVQLLPAALGDD--YAAVE- 310

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           AR    ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 311 ARMRDLARALPPAEVQLYYQTMLIGRKELPFAPDRRMGVEMTLLR 355


>gi|167902380|ref|ZP_02489585.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei NCTC 13177]
          Length = 428

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLAGLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|270263611|ref|ZP_06191880.1| DNA polymerase III subunits gamma and tau [Serratia odorifera
           4Rx13]
 gi|270042495|gb|EFA15590.1| DNA polymerase III subunits gamma and tau [Serratia odorifera
           4Rx13]
          Length = 649

 Score =  241 bits (616), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 201/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      +LQ 
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALDVDQIRNQLETVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  D  A+ ++ARA+DGS RD LSL DQAIA    ++ T++V  ML   D  + + + 
Sbjct: 194 ENITSDQRALQLLARAADGSMRDALSLTDQAIAMGQGQVTTATVSQMLGTLDDEQPLAIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ + +     GV+   +L +     H +  ++ +P + D   +  A   
Sbjct: 254 EALVSADGEKVMAQVAQAASRGVDWENLLIETLALLHRIAMVQLLPSVLDN--HYAAIEQ 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDVQLYYQTLLVGRKELAFAPDRRMGVEMTLLR 355


>gi|254448831|ref|ZP_05062287.1| DNA polymerase III subunit gamma [gamma proteobacterium HTCC5015]
 gi|198261521|gb|EDY85810.1| DNA polymerase III subunit gamma [gamma proteobacterium HTCC5015]
          Length = 556

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NA    R+  +Y+ +GTRG+GKTT ARIIA+SLN +      P  E  
Sbjct: 18  LVGQTHVLRALINALDEDRLHHAYLFTGTRGVGKTTIARIIAKSLNCEQGVSSTPCGECS 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G  VD++E+DAAS T +DD RE++D + Y P   R++VY++DEV MLST
Sbjct: 78  A----CVEIDEGRFVDLIEVDAASRTKVDDTRELLDNVQYAPTRGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPPPHVKF+ ATT+ +K+P TVLSRC +F+L ++    ++     IL  
Sbjct: 134 SSFNALLKTLEEPPPHVKFLLATTDPQKLPATVLSRCLQFNLKQMPPEAIVAHHEHILGA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE++ +A+  IARA++GS RD LSLLDQAIA  + ++ +  V  ML    R+ I  + 
Sbjct: 194 EGIEYETQALKHIARAAEGSMRDSLSLLDQAIAFGHGRVRSDDVVSMLGFISRDHIERIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   +   V+Q  +   +   +   + ++L    H +   K + E  D  L    +  
Sbjct: 254 QALAAQNSEQVMQAIAQLAEMAPDFVTVFNELIATLHQMALAKRVAEAVDDSLM---DRE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L+ +   S   +  ++QM + G  ++     P + +EM L+R+
Sbjct: 311 RLLELAAGFSEEDIQLYYQMAITGKRDLPLLPEPRQGLEMTLLRM 355


>gi|157369378|ref|YP_001477367.1| DNA polymerase III subunits gamma and tau [Serratia proteamaculans
           568]
 gi|157321142|gb|ABV40239.1| DNA polymerase III, subunits gamma and tau [Serratia proteamaculans
           568]
          Length = 650

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 200/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      +LQ 
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALDVDQIRSQLETVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA    ++ T++V  ML   D  + + + 
Sbjct: 194 EQITSDQRALQLLARAADGSMRDALSLTDQAIAMGQGQVTTATVSQMLGTLDDEQPLAIL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ + +     GV+   +L +     H +  ++ +P + D   +  A   
Sbjct: 254 EALVSADGEKVMAQVAQAASRGVDWENLLIETLALLHRIAMVQLLPSVLDN--HYAAIEQ 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDVQLYYQTLLVGRKELAFAPDRRMGVEMTLLR 355


>gi|251792166|ref|YP_003006886.1| DNA polymerase III subunits gamma and tau [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533553|gb|ACS96799.1| DNA polymerase III subunit tau [Aggregatibacter aphrophilus NJ8700]
          Length = 680

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 204/345 (59%), Gaps = 12/345 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN        P  E E
Sbjct: 18  VVGQQHVLAALANGLRENRLHHAYLFSGTRGVGKTSIARLFAKGLNCVNGVTAEPCSECE 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               HC+AI  GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 78  ----HCKAIEEGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVVGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+  K+P+T+LSRC +F L  +    +      ILQ+
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPHKLPVTILSRCMQFHLKALEPQQISAHLADILQQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+  A+  +A A+ GS RD LSL DQAIA  N  +  S V+ ML L D ++ +D+ 
Sbjct: 194 ENIPFEDLALDKLANAAQGSIRDSLSLTDQAIAMSNGNVTLSVVKEMLGLLDESQAIDII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   ++Q  ++  D   +   +L ++AE  H +   + +P+          + +
Sbjct: 254 YALQQGNGEKLMQVVNAVADKAGDWDELLREVAENLHKIAMQQLLPQ-------PNIDES 306

Query: 301 RALQY-SKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
             + + +K ++   +  F+Q+++ G  E+     P    EMVL+R
Sbjct: 307 NQIGFLAKHIAPEDVQFFYQVLVTGRKELALAPTPRMGAEMVLLR 351


>gi|288936781|ref|YP_003440840.1| DNA polymerase III subunits gamma/tau [Klebsiella variicola At-22]
 gi|288891490|gb|ADC59808.1| DNA polymerase III, subunits gamma and tau [Klebsiella variicola
           At-22]
          Length = 635

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      + +     
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMAT--VEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R  + ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLMGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|298368606|ref|ZP_06979924.1| DNA polymerase III, gamma/tau subunit [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298282609|gb|EFI24096.1| DNA polymerase III, gamma/tau subunit [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 718

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/351 (36%), Positives = 202/351 (57%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN   A    P     
Sbjct: 37  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCGHAEHGEPC---- 92

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + R++VYI+DEV MLS 
Sbjct: 93  GVCESCTQIDAGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGRYKVYIIDEVHMLSK 152

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+P+TVLSRC +F L  ++   + +    +L+ 
Sbjct: 153 SAFNAMLKTLEEPPEHVKFILATTDPHKVPVTVLSRCLQFVLRNMTTQQVADHLAHVLES 212

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++  A+ +I RA  GS RD LSLLDQAIA  +  +    VR M+   D+  + +L 
Sbjct: 213 EKIPYEATALQLIGRAGAGSMRDALSLLDQAIAMGSGSVAEQDVRQMIGAVDKQYLYELL 272

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             ++  D   ++   QE +++   +DS          L+E   L+ R+  I  +   L  
Sbjct: 273 AGIVNQDGKALLGKAQEMAARAIGFDSA---------LSELAMLLQRLALIQAVPSALAG 323

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            + E    L + + +S   +  ++Q ++ G  ++           M L+R+
Sbjct: 324 DDPERENLLNFVRALSGEQIQLYYQCVIHGKQDLSLAPDEYAGFVMTLLRM 374


>gi|206576456|ref|YP_002240028.1| DNA polymerase III, tau subunit [Klebsiella pneumoniae 342]
 gi|206565514|gb|ACI07290.1| DNA polymerase III, tau subunit [Klebsiella pneumoniae 342]
          Length = 635

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      + +     
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMAT--VEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R  + ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLMGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|300715625|ref|YP_003740428.1| DNA polymerase III subunit tau [Erwinia billingiae Eb661]
 gi|299061461|emb|CAX58575.1| DNA polymerase III subunit tau [Erwinia billingiae Eb661]
          Length = 644

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 201/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      +LQE
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRGQLQHVLQE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE +P ++ ++ARA+DGS RD LSL DQAIA    ++ T +V  ML   D  + + L 
Sbjct: 194 EKIEAEPRSLQLLARAADGSMRDALSLADQAIAMGQGQVTTVTVNAMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPE-MADTLLYSEAEN 299
             L+  +   V+   +     GV    +L ++    H V  I+ +P  + D   Y+  E 
Sbjct: 254 EALVNAEGEQVMSLLNQAASRGVEWEALLVEMLTLLHRVAMIQLLPSALGDD--YAAVEQ 311

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 -RLRELARVLPPPDVQLYYQTLLVGRKELPLAPDRRMGVEMTLLR 355


>gi|83720172|ref|YP_442740.1| DNA polymerase III subunits gamma and tau [Burkholderia
           thailandensis E264]
 gi|83653997|gb|ABC38060.1| DNA polymerase III, subunits gamma and tau, programmed
           [Burkholderia thailandensis E264]
          Length = 812

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|253687471|ref|YP_003016661.1| DNA polymerase III, subunits gamma and tau [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754049|gb|ACT12125.1| DNA polymerase III, subunits gamma and tau [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 685

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 202/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +      P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    +     ++LQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDAEQIRAHLEQVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA+DGS RD LSL DQAIA    ++ T+SV  ML   D  + + L 
Sbjct: 194 ENLVSEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTTASVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-EMADTLLYSEAEN 299
             L KGD   V+         GV+   +L +     H +  ++ +P  + D   Y+  E 
Sbjct: 254 EALAKGDGAQVMSLLDQVAARGVDWESLLVETQTLLHRIAMVQLLPAALGDD--YAAVE- 310

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           AR    ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 311 ARMRDLARALPPTDVQLYYQTMLIGRKELPFAPDRRMGVEMTLLR 355


>gi|238751045|ref|ZP_04612541.1| DNA polymerase III subunit gamma [Yersinia rohdei ATCC 43380]
 gi|238710735|gb|EEQ02957.1| DNA polymerase III subunit gamma [Yersinia rohdei ATCC 43380]
          Length = 651

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 199/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GICANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +     KIL  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEIIRAQLEKILLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA  +  + T++V  ML   D  + + + 
Sbjct: 194 EHISSDARALQLLARAADGSMRDALSLADQAIAMGDGHVTTATVSHMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQIEQAASRGVDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q++L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQILLVGRKELAYAPDRRMGVEMTLLR 355


>gi|220934248|ref|YP_002513147.1| DNA polymerase III, subunits gamma and tau [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995558|gb|ACL72160.1| DNA polymerase III, subunits gamma and tau [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 553

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 200/346 (57%), Gaps = 9/346 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ  +++ L+NA +  R+  +Y+ +GTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  MVGQPHVVRALSNALRDQRLHHAYLFTGTRGVGKTTVARVLAKCLNCETGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  +D++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLST
Sbjct: 74  GQCSACREIDEGRFIDLIEVDAASRTKVEDTRELLDNVQYAPTRGRYKVYLIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    +     K+L++
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFSLKAMPADMVGAHLKKVLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E ++FDP A+  +ARA+ GS RD LSLLDQAIA  +  +    VR ML    ++ +  + 
Sbjct: 194 EGVDFDPPAIMRLARAASGSMRDALSLLDQAIAYGSGALRDDDVREMLGAISQDHLERML 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD   ++           + + IL +L    H V   + +PE  D      A + 
Sbjct: 254 QALAAGDGPALMGAVDDLAQRAPDYNAILGELVSLLHQVALAQQVPEALD----EGAVDV 309

Query: 301 RALQ-YSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            A+Q  ++ ++   +  ++Q+ L    ++     P    EM L+R+
Sbjct: 310 AAVQAMARSLAPEDVQLYYQIALLARRDLPLAPDPRAGFEMALLRM 355


>gi|325982256|ref|YP_004294658.1| DNA polymerase III, subunits gamma and tau [Nitrosomonas sp. AL212]
 gi|325531775|gb|ADZ26496.1| DNA polymerase III, subunits gamma and tau [Nitrosomonas sp. AL212]
          Length = 537

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/345 (39%), Positives = 203/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ+ +++ LTNA +  R+  +Y+L+GTRG+GKTT ARI+A+SLN +T     P     
Sbjct: 19  LTGQEHVVRALTNALEQNRLHHAYLLTGTRGVGKTTIARILAKSLNCETGITATPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G+ +D+VELDAAS+T +D++RE+++   Y P   R+++YI+DEV MLS 
Sbjct: 75  GTCTTCVQIDSGSFIDLVELDAASNTQVDNMRELLENALYAPTCGRYKIYIIDEVHMLSK 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +KIPITVLSRC +F+L +I    + +   KIL +
Sbjct: 135 SAFNAMLKTLEEPPAHVKFILATTDQQKIPITVLSRCLQFNLKQIPQPQITDHLKKILAQ 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  ++ ++ARA+ GS RD LSLLDQAIA    KI  +SVR ML + D + + DL 
Sbjct: 195 EKIPCDILSLQLVARAAQGSMRDALSLLDQAIAFGAGKIEEASVRDMLGIIDHSYLFDLL 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L + + + +L          ++    L DLA   H +   + IP+    L     +  
Sbjct: 255 DALTQKNGLKLLSLADEMEARCLSFDCALQDLAVILHRIALAQAIPQ---ALGEDIPDYI 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R    +K ++   +  F+Q+ L G  ++           M L+R+
Sbjct: 312 RINALAKILAPDDIQLFYQIALHGRGDLSLAPDEYAGFTMTLLRM 356


>gi|42525061|ref|NP_970441.1| DNA polymerase III gamma and tau subunits [Bdellovibrio
           bacteriovorus HD100]
 gi|39577272|emb|CAE81095.1| DNA polymerase III gamma and tau subunits [Bdellovibrio
           bacteriovorus HD100]
          Length = 621

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 143/358 (39%), Positives = 203/358 (56%), Gaps = 17/358 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + +TL+NA K+GR+  + + +G RG GKT++ARI+A++L    A   VP  +  
Sbjct: 34  VVGQNHITQTLSNALKNGRLPHALLFTGPRGTGKTSSARILAKALRCPNAQNFVPCNDCY 93

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G+ +DV+E+D AS+  +D +RE+ D + + P S ++++YI+DEV MLST
Sbjct: 94  S----CNEIAGGSSIDVIEIDGASNNGVDAIRELRDTVAFMPSSGKYKIYIIDEVHMLST 149

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP HV FI ATTE+ KIP T+LSRCQRFD  RIS   + E    I   
Sbjct: 150 SAFNALLKTLEEPPAHVVFIMATTEVHKIPQTILSRCQRFDFRRISTRSITERLKLICDR 209

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  D EA+ ++AR  DGS RD  SLLDQ I   N  +  +SV  +L L DR  + +  
Sbjct: 210 EGVTADDEALWVVARQGDGSMRDSQSLLDQVITFANGPLTRASVVEILGLTDRALLFETL 269

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKY-------IPEMADTLL 293
             LI  +   VL+       +G  P +   DL E    +  IK        I EM D+ L
Sbjct: 270 NALIDRNSQAVLKVIEKIAAAGFEPHLYSQDLLEMIRNLLLIKVSEAQASQILEMPDSEL 329

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQL 351
            + +E A+ L    E  I  L   + M LKG S+I     P   +E+ L+R+A A +L
Sbjct: 330 QALSEMAQRL---PEEDIHML---FDMALKGGSDIPRAQDPRIVLEVTLLRMASAPKL 381


>gi|53723573|ref|YP_103021.1| DNA polymerase III subunits gamma and tau [Burkholderia mallei ATCC
           23344]
 gi|121598928|ref|YP_993170.1| DNA polymerase III subunits gamma and tau [Burkholderia mallei
           SAVP1]
 gi|124386554|ref|YP_001026054.1| DNA polymerase III subunits gamma and tau [Burkholderia mallei NCTC
           10229]
 gi|126448303|ref|YP_001080677.1| DNA polymerase III subunits gamma and tau [Burkholderia mallei NCTC
           10247]
 gi|254178396|ref|ZP_04885051.1| DNA polymerase III, subunits gamma and tau [Burkholderia mallei
           ATCC 10399]
 gi|52426996|gb|AAU47589.1| DNA polymerase III, subunit gamma, putative [Burkholderia mallei
           ATCC 23344]
 gi|121227738|gb|ABM50256.1| putative DNA polymerase III, subunit gamma [Burkholderia mallei
           SAVP1]
 gi|124294574|gb|ABN03843.1| putative DNA polymerase III, subunit gamma [Burkholderia mallei
           NCTC 10229]
 gi|126241173|gb|ABO04266.1| DNA polymerase III, subunits gamma and tau [Burkholderia mallei
           NCTC 10247]
 gi|160699435|gb|EDP89405.1| DNA polymerase III, subunits gamma and tau [Burkholderia mallei
           ATCC 10399]
          Length = 825

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|217421704|ref|ZP_03453208.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 576]
 gi|217395446|gb|EEC35464.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 576]
          Length = 712

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLAGLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|134277465|ref|ZP_01764180.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 305]
 gi|134251115|gb|EBA51194.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 305]
          Length = 837

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|290510163|ref|ZP_06549533.1| DNA polymerase III, subunits gamma and tau [Klebsiella sp. 1_1_55]
 gi|289776879|gb|EFD84877.1| DNA polymerase III, subunits gamma and tau [Klebsiella sp. 1_1_55]
          Length = 386

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/356 (36%), Positives = 203/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      + +     
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADMATVEVRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    +  ++Q +L G  E+         VEM L+R LA   + P PE
Sbjct: 314 REL--ARTVPPGDVQLYYQTLLMGRKELPYAPDRRMGVEMTLLRALAFHPRKPLPE 367


>gi|237812565|ref|YP_002897016.1| DNA polymerase III subunit tau [Burkholderia pseudomallei MSHR346]
 gi|237503016|gb|ACQ95334.1| DNA polymerase III subunit tau [Burkholderia pseudomallei MSHR346]
          Length = 825

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|53719132|ref|YP_108118.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei K96243]
 gi|52209546|emb|CAH35499.1| DNA polymerase III subunit gamma [Burkholderia pseudomallei K96243]
          Length = 825

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|76808592|ref|YP_333768.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 1710b]
 gi|254259031|ref|ZP_04950085.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 1710a]
 gi|76578045|gb|ABA47520.1| DNA polymerase III subunit gamma [Burkholderia pseudomallei 1710b]
 gi|254217720|gb|EET07104.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 1710a]
          Length = 822

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|254248057|ref|ZP_04941378.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           cenocepacia PC184]
 gi|124872833|gb|EAY64549.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           cenocepacia PC184]
          Length = 346

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 120/289 (41%), Positives = 184/289 (63%), Gaps = 10/289 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRN---RIM 237
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+    R++
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP 286
           D        +I+ +  E S +    ++ S  L DLA   H +   ++ P
Sbjct: 254 DALAAANGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP 299


>gi|126442209|ref|YP_001059241.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 668]
 gi|126221702|gb|ABN85208.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 668]
          Length = 826

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|227115284|ref|ZP_03828940.1| DNA polymerase III subunits gamma and tau [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 690

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +      P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCEQGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     ++LQ 
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAHLEQVLQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA+DGS RD LSL DQAIA    ++ T+SV  ML   D  + + L 
Sbjct: 194 ENLVSEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTTASVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-EMADTLLYSEAEN 299
             L KGD   V+         GV+   +L +     H +  ++ +P  + D   Y+  E+
Sbjct: 254 EALAKGDGAQVMSLLDQVAARGVDWESLLVETQTLLHRIAMVQLLPAALGDD--YAAVES 311

Query: 300 ARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 -RMRELARALPPADVQLYYQTMLIGRKELPFAPDRRMGVEMTLLR 355


>gi|107028994|ref|YP_626089.1| DNA polymerase III subunits gamma and tau [Burkholderia cenocepacia
           AU 1054]
 gi|116689848|ref|YP_835471.1| DNA polymerase III subunits gamma and tau [Burkholderia cenocepacia
           HI2424]
 gi|105898158|gb|ABF81116.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           cenocepacia AU 1054]
 gi|116647937|gb|ABK08578.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           cenocepacia HI2424]
          Length = 787

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 208/348 (59%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A    R+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGERLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRN---RIM 237
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+    R++
Sbjct: 194 EQITFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 238 DLFGYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
           D        +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAANGPEILAIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   ++++ +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFAETLSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|90416006|ref|ZP_01223939.1| DNA polymerase III subunits gamma and tau [marine gamma
           proteobacterium HTCC2207]
 gi|90332380|gb|EAS47577.1| DNA polymerase III subunits gamma and tau [marine gamma
           proteobacterium HTCC2207]
          Length = 647

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 195/344 (56%), Gaps = 7/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M GQ+ +++ L NA    R+  +Y+ +GTRG+GKTT ARI+++ LN +     VP     
Sbjct: 18  MAGQQHVLQALINALDHDRLHHAYLFTGTRGVGKTTIARILSKCLNCEVGVSSVPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  +D++E+DAAS T +DD+RE++D + Y P   R+++Y++DEV MLS 
Sbjct: 74  GECSSCTEIGEGRFIDLIEVDAASRTGVDDMRELLDNVQYAPSRGRYKIYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++F  LLKTLEEPPPHVKF+FATT+ +K+PITVLSRC +F+L  +S   + E    +L E
Sbjct: 134 SSFAALLKTLEEPPPHVKFLFATTDPQKLPITVLSRCLQFNLKNLSAERITEHLQFVLGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+  A+  +ARA+DGS RD LSL DQAI     ++    V  ML   +R+ ++D+ 
Sbjct: 194 EQVPFEEAALWSLARAADGSMRDALSLTDQAIGHGGGQVNEGEVSAMLGTIERSYVVDIC 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI G    +L       +   +    L D+    H V  ++ +PE  D  +   A   
Sbjct: 254 QALISGSGTELLAAIGRMAEQAPDYDAALTDILSVWHQVAIVQTVPEALDKGV---ANYT 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
             L  +  VS      F+Q+ L G  +++         EMV++R
Sbjct: 311 ELLALAAAVSREDTQLFYQICLLGRKDLQLSPDAKSGFEMVMLR 354


>gi|332160791|ref|YP_004297368.1| DNA polymerase III subunits gamma and tau [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318604677|emb|CBY26175.1| DNA polymerase III subunits gamma and tau [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325665021|gb|ADZ41665.1| DNA polymerase III subunits gamma and tau [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863114|emb|CBX73244.1| DNA polymerase III subunit tau [Yersinia enterocolitica W22703]
          Length = 656

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 198/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +     KIL  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRAQLEKILLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA  +  + T++V  ML   D  + + + 
Sbjct: 194 EQINSDARALQLLARAADGSMRDALSLADQAIAMGDGHVTTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQLEQAASRGVDWETLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|123443301|ref|YP_001007275.1| DNA polymerase III subunits gamma and tau [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090262|emb|CAL13128.1| DNA polymerase III subunit Tau (contains DNA polymerase III subunit
           Gamma) [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 656

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 199/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +     KIL  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRAQLEKILLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQAIA  +  + T++V  ML + D  + + + 
Sbjct: 194 EQISSDARALQLLARAADGSMRDALSLADQAIAMGDGHVTTATVSQMLGILDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQLEQAASRGVDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATIE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|148285033|ref|YP_001249123.1| DNA polymerase III subunits gamma and tau [Orientia tsutsugamushi
           str. Boryong]
 gi|146740472|emb|CAM81007.1| DNA polymerase III gamma and tau chains [Orientia tsutsugamushi
           str. Boryong]
          Length = 559

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 219/376 (58%), Gaps = 16/376 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ + K LT +  +G ++Q+Y+LSG RG+GKTT ARIIA ++N     +   T+   
Sbjct: 23  LIGQEVLTKVLTYSMITGCLSQAYLLSGIRGVGKTTAARIIATTINCLQPVVTSKTIFAC 82

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C A+   +H D+ E+DAAS T +DDVR IID   YKP+ ++++++I+DEV MLS 
Sbjct: 83  TKCNSCIAMENNSHPDINEIDAASRTGVDDVRTIIDDSEYKPLISKYKIFIIDEVHMLSK 142

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLK LEEPP H  FIFATTEI KIP+TV+SRCQ+FDL R+ I +++++ + I+ +
Sbjct: 143 SAFNALLKLLEEPPSHTIFIFATTEINKIPLTVISRCQKFDLRRLDINNIVQILSNIIAK 202

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++    E +  IA  +DGSARD +SLL+QA A   +   T+S  ++  +   N +  + 
Sbjct: 203 ENVSATKEILEFIAVKADGSARDAVSLLEQARALAQNIADTASSDVV--VISLNTVEQMC 260

Query: 241 GYLIKGDIINVLQEFSSQ------------YDSGVNPSVILHDLAEFTHLVTRIKYIPEM 288
           G L  G + ++L   + Q            Y SG +  V   ++ +    + ++K I   
Sbjct: 261 GVLCLGKLTDLLSAIAEQNAEKGINIVTDLYISGTDFIVCSQNILDLIGYLIKVKTIDGY 320

Query: 289 ADTLLYSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHA 348
            +++  S      +L  S ++S++ L+  WQ+  K I E++         E+V+I+  ++
Sbjct: 321 TESIYASHNNILNSL--SMKLSLSRLTVLWQIFSKSIQELKISHNTRLCFEVVVIKAIYS 378

Query: 349 VQLPSPEEIARYIVEE 364
             LP+P +  R +  E
Sbjct: 379 FSLPTPIDALRQLQNE 394


>gi|254252241|ref|ZP_04945559.1| DNA polymerase III [Burkholderia dolosa AUO158]
 gi|124894850|gb|EAY68730.1| DNA polymerase III [Burkholderia dolosa AUO158]
          Length = 472

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/327 (39%), Positives = 201/327 (61%), Gaps = 13/327 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  S+V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTESAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKG---DIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G   +I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGSGPEILAIADEMSLRS---LSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKG 324
           E A   +++  +S   +  F+Q+   G
Sbjct: 308 EAADLRRFADTLSPEQVQLFYQIATVG 334


>gi|315633993|ref|ZP_07889282.1| DNA polymerase III, gamma/tau subunit DnaX [Aggregatibacter segnis
           ATCC 33393]
 gi|315477243|gb|EFU67986.1| DNA polymerase III, gamma/tau subunit DnaX [Aggregatibacter segnis
           ATCC 33393]
          Length = 681

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 128/344 (37%), Positives = 205/344 (59%), Gaps = 10/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     ++  T E  
Sbjct: 18  VVGQQHILTALANGLRENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VNGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI  GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GVCEHCKAIEEGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVLGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+  K+P+T+LSRC +F L  +    + E    IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPHKLPVTILSRCMQFHLKALEQSQIAEHLGYILNQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+  +A A+ GS RD LSL DQAIA  N  +  + V  ML L D  + +++ 
Sbjct: 194 EQIPFESLALDKLASAAQGSIRDSLSLTDQAIAMSNGNVTLNIVNEMLGLLDETQAIEMI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   ++Q  S   +   +   +L ++AE  H +   + +P+ + T    EA++ 
Sbjct: 254 YALQQGNGEKLMQVVSEVANKAGDWDELLREVAENLHKIAMQQLLPQASLT----EADHI 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
             L  +K ++   +  F+Q+++ G  E+          EMVL+R
Sbjct: 310 SFL--AKHIAPQDVQFFYQVVVSGRKELSLAPTARMGAEMVLLR 351


>gi|323499527|ref|ZP_08104497.1| DNA polymerase III subunits gamma and tau [Vibrio sinaloensis DSM
           21326]
 gi|323315400|gb|EGA68441.1| DNA polymerase III subunits gamma and tau [Vibrio sinaloensis DSM
           21326]
          Length = 710

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/345 (37%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQSHVLTALENALAQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GQCDTCKEIDEGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  I++  + E    IL  
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPITVDTIHEQLDHILGH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ MIA A+DGS RD LSL DQAIA  N  ++  SV  ML   D ++ + L 
Sbjct: 194 EAVTSEPRALGMIAHAADGSMRDALSLTDQAIALGNGSVMAESVAHMLGTLDTDQALHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        ++  S+   +GV    +L  LA   H +   + +P    TL  S+ +  
Sbjct: 254 ESISSKQPEQAMETLSALAQNGVEWDGLLQQLATQLHRMAMYQALP---STLDKSQPDAD 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +    S+E+S   +  ++Q+ LKG  ++         +EMV++R+
Sbjct: 311 KIELLSRELSPQDVQLYYQIALKGRQDLPLAPSERIGLEMVVLRM 355


>gi|217969820|ref|YP_002355054.1| DNA polymerase III subunits gamma/tau [Thauera sp. MZ1T]
 gi|217507147|gb|ACK54158.1| DNA polymerase III, subunits gamma and tau [Thauera sp. MZ1T]
          Length = 716

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 134/358 (37%), Positives = 206/358 (57%), Gaps = 12/358 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A  +GR+  +++ +GTRG+GKTT +RI+A++LN +T      T E  
Sbjct: 18  LVGQEHVVRALTHALATGRLHHAWLFTGTRGVGKTTISRILAKALNCETGI----TAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+AI      D VE+DAAS+  ++++  ++D+  Y P+  RF+VY++DEV ML+ 
Sbjct: 74  GICDACRAIDADRFPDYVEMDAASNRGVEEMAALLDKAVYAPVQGRFKVYMIDEVHMLTG 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L ++  G +++  T+ILQ 
Sbjct: 134 HAFNAMLKTLEEPPEHVKFILATTDPQKIPVTVLSRCLQFNLKQMPQGHIVDHLTRILQA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+P A+  +A+A+ GS RD LSLLDQAIA    ++    V  ML     + +  + 
Sbjct: 194 EEVAFEPGALRHLAKAASGSMRDALSLLDQAIAHGAGRVEEEQVSHMLGTVGDDHLYAVL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  GD+  +L          ++    L  LA   H V   +Y P      +  E E A
Sbjct: 254 DALAAGDVPALLAVADGMEARSLSFDAALQALATLVHRVALAQYAP----AAIADELERA 309

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
           R L Y +     FL   +Q+ + G  E+           M L+RL HA +   PE+ A
Sbjct: 310 RILGYVERFDAEFLQLAYQVAVHGRDELPLAPDDYTGFTMTLLRL-HAFR---PEQPA 363


>gi|37521178|ref|NP_924555.1| DNA polymerase III gamma and tau subunits [Gloeobacter violaceus
           PCC 7421]
 gi|35212174|dbj|BAC89550.1| DNA polymerase III gamma and tau subunits [Gloeobacter violaceus
           PCC 7421]
          Length = 632

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 209/345 (60%), Gaps = 5/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ P++ TLTNA K+GRIA +Y+ +G+RG GKTTTAR+IA++LN     I  PT +  
Sbjct: 18  VVGQGPIVTTLTNALKAGRIAHAYLFTGSRGTGKTTTARLIAKALNC----IHGPTPDPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C AI  G+ +DV+E+DAAS+T +D++RE+I++  + P+ +R +VYI+DEV MLS+
Sbjct: 74  GRCEQCLAIATGSALDVIEIDAASNTGVDNIRELIERAQFAPVQSRQKVYILDEVHMLSS 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPP HV F+ ATT+ +K+  TV+SRCQRFD  RI + D+++   +I  +
Sbjct: 134 AAFNCLLKTLEEPPAHVTFVLATTDPQKVLPTVISRCQRFDFRRIPLTDMVKHLEEIAWK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ + EAV ++A+ + G  RD  SLLDQ +A     I    +  ++       ++ + 
Sbjct: 194 EDIDIEHEAVELVAQIAQGGLRDAESLLDQ-LALLEGTIGAERIWQLVGAVPERELLVIG 252

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +  GD   ++++     DSG  P  +L DL  F   +      P+  D +  + A   
Sbjct: 253 ECIQAGDSTRLIEQVRRLLDSGKEPLQVLQDLLGFYRDLLIAHTAPDRRDLVAVTAASWQ 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +  + +K +SI  L    + + +   +I+  ++P   +E+ L+ L
Sbjct: 313 QMCERAKTLSIPQLLALQERLRQAEPQIKTSTQPRLWLEVGLLGL 357


>gi|327393012|dbj|BAK10434.1| DNA polymerase III tau subunit DnaX [Pantoea ananatis AJ13355]
          Length = 656

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + +    +L++
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALEVDQIRQQLDHVLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA     + +++V  ML   D  + + L 
Sbjct: 194 EQIAREPRALQLLARAADGSMRDALSLTDQAIAMGEGSVTSATVGTMLGTLDDEQPLGLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++G+   ++   +     GV    +L ++    H +  ++ +P    +L   E  NA
Sbjct: 254 EAVVEGNGEQMMALLAQAASRGVEWEALLVEMLRLLHRIAMVQLLP---TSLNDDEESNA 310

Query: 301 -RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            R  + ++ V    L  ++Q +L G  ++         +EM L+R
Sbjct: 311 LRLRELARAVPPADLQLYYQTLLMGRKDLPLAPDRRMGIEMTLLR 355


>gi|291616582|ref|YP_003519324.1| DnaX [Pantoea ananatis LMG 20103]
 gi|291151612|gb|ADD76196.1| DnaX [Pantoea ananatis LMG 20103]
          Length = 672

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 203/345 (58%), Gaps = 8/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 34  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGITATPC---- 89

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 90  GQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 149

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + +    +L++
Sbjct: 150 HSFNALLKTLEEPPSHVKFLLATTDPQKLPVTILSRCLQFHLKALEVDQIRQQLDHVLEQ 209

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA     + +++V  ML   D  + + L 
Sbjct: 210 EQIAREPRALQLLARAADGSMRDALSLTDQAIAMGEGSVTSATVGTMLGTLDDEQPLGLL 269

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++G+   ++   +     GV    +L ++    H +  ++ +P    +L   E  NA
Sbjct: 270 EAVVEGNGEQMMALLAQAASRGVEWEALLVEMLRLLHRIAMVQLLP---TSLNDDEESNA 326

Query: 301 -RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            R  + ++ V    L  ++Q +L G  ++         +EM L+R
Sbjct: 327 LRLRELARAVPPADLQLYYQTLLMGRKDLPLAPDRRMGIEMTLLR 371


>gi|238791473|ref|ZP_04635111.1| DNA polymerase III subunit gamma [Yersinia intermedia ATCC 29909]
 gi|238729089|gb|EEQ20605.1| DNA polymerase III subunit gamma [Yersinia intermedia ATCC 29909]
          Length = 658

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/344 (37%), Positives = 199/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  I +  +     KIL  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVIDVEVIRGQLEKILLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA+A  +  + T++V  ML   D  + + + 
Sbjct: 194 EQISSDARALQLLARAADGSMRDALSLTDQAVAMGDGHVTTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   Y+  E  
Sbjct: 254 EALVSADGARVMAQVEQAASRGVDWENLLVETLSLLHRIAMVQLLPSMLDN-HYATVE-P 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +  T +  ++Q++L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPTDIQLYYQILLMGRKELAYAPDRRMGVEMTLLR 355


>gi|56961819|ref|YP_173541.1| DNA-directed DNA polymerase III gamma and tau DnaX [Bacillus
           clausii KSM-K16]
 gi|56908053|dbj|BAD62580.1| DNA-directed DNA polymerase III gamma and tau DnaX [Bacillus
           clausii KSM-K16]
          Length = 560

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 209/364 (57%), Gaps = 8/364 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + KTL NA    ++A +Y+ SG RG GKT+ A+I+A+++N K A +  P  E +
Sbjct: 18  VVGQSHITKTLKNALLQQKLAHAYLFSGPRGTGKTSAAKIVAKAINCKQAPVAEPCNECD 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C  I  G+ VDV+E+DAAS+  +D++R+I D++ + P    ++VYI+DEV MLST
Sbjct: 78  A----CVGITNGSVVDVIEIDAASNNGVDEIRDIRDKVKFAPSEVAYKVYIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HV FI ATTE  KIP+T+LSRCQRFD   IS   LI     IL  
Sbjct: 134 GAFNALLKTLEEPPAHVIFILATTEPHKIPLTILSRCQRFDFKPISNEALINRMKFILDN 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
               ++ EA+ +IARA+DG ARD LSLLDQAI+  ++K+ T  V  +     R  +  L 
Sbjct: 194 NQQPYEEEAIELIARAADGGARDALSLLDQAISFSDEKVSTEDVLTITGAVSREALHQLA 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L K +   VL+        G +P  +L DL  +   +   K  PE AD    +  ++A
Sbjct: 254 AALEKQNARLVLETIDETLKGGKDPKRLLEDLLLYYRDLLLYKTAPETADLFERAVLDDA 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
             +Q +K  S  F+    Q + +   E++   +P   +EM +++L   +QL   ++ A+ 
Sbjct: 314 -FVQVAKSYSRPFIYAAIQSLSESQQEMKWALQPKIVLEMAVMKL---MQLAPAQDTAQV 369

Query: 361 IVEE 364
             EE
Sbjct: 370 GNEE 373


>gi|330879803|gb|EGH13952.1| DNA polymerase III subunits gamma and tau [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 360

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 193/324 (59%), Gaps = 7/324 (2%)

Query: 22  QSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELD 81
            +Y+ +GTRG+GKTT ARIIA+ LN +T     P     G    C+ I  G  VD++E+D
Sbjct: 3   HAYLFTGTRGVGKTTIARIIAKCLNCETGITSTPC----GTCSVCKEIDEGRFVDLIEID 58

Query: 82  AASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIF 141
           AAS T ++D RE++D + Y P   RF+VY++DEV MLS+ +FN LLKTLEEPPP+VKFI 
Sbjct: 59  AASRTKVEDTRELLDNVQYVPSRGRFKVYLIDEVHMLSSHSFNALLKTLEEPPPYVKFIL 118

Query: 142 ATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSA 201
           ATT+ +K+P T+LSRC +F L  ++   ++E  T +L  E++ F+ +A+ ++ RA+DGS 
Sbjct: 119 ATTDPQKLPATILSRCLQFSLKNMTPERVVEHLTHVLGVENVPFEDDALWLLGRAADGSM 178

Query: 202 RDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLFGYLIKGDIINVLQEFSSQYDS 261
           RD +SL DQAIA    K++ + VR ML   D  ++ D+   L++GD   VL+      + 
Sbjct: 179 RDAMSLTDQAIAFGEGKVMAADVRAMLGTLDHGQVFDVLTALLEGDARGVLEAVRHLAEQ 238

Query: 262 GVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENARALQYSKEVSITFLSRFWQMI 321
           G + + +L ++    H V   + +PE  D       +  R L  ++ +    +  ++QM 
Sbjct: 239 GPDWNGVLSEILNVLHRVAIAQALPEGVDN---GHGDRDRVLALAQALPAEDVQFYYQMG 295

Query: 322 LKGISEIEGFSRPMEAVEMVLIRL 345
           L G  ++     P    EMVL+R+
Sbjct: 296 LIGRRDLPLAPDPRGGFEMVLLRM 319


>gi|126454158|ref|YP_001066508.1| DNA polymerase III subunits gamma and tau [Burkholderia
           pseudomallei 1106a]
 gi|242316585|ref|ZP_04815601.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 1106b]
 gi|126227800|gb|ABN91340.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 1106a]
 gi|242139824|gb|EES26226.1| DNA polymerase III, subunits gamma and tau [Burkholderia
           pseudomallei 1106b]
          Length = 825

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 203/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P+A+  +ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERIAFEPQALRFLARAAQGSMRDALSLTDQAIAYSANEVTETAVSGMLGTLDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAADGPQILAVADEMALRSLSFSAALQDLASLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAELLSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|170025415|ref|YP_001721920.1| DNA polymerase III subunits gamma and tau [Yersinia
           pseudotuberculosis YPIII]
 gi|169751949|gb|ACA69467.1| DNA polymerase III, subunits gamma and tau [Yersinia
           pseudotuberculosis YPIII]
          Length = 658

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 197/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+L  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEKVLLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA++    ++ T++V  ML   D  + + + 
Sbjct: 194 EQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTATVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   +  A   
Sbjct: 254 EALVSADGARVMAQIEQAASRGVDWENLLVESLSLLHKIAMVQLLPSMLDN--HYAAIEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|269958349|ref|YP_003328136.1| DNA polymerase III, subunits gamma and tau [Anaplasma centrale str.
           Israel]
 gi|269848178|gb|ACZ48822.1| DNA polymerase III, subunits gamma and tau [Anaplasma centrale str.
           Israel]
          Length = 513

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/358 (36%), Positives = 207/358 (57%), Gaps = 11/358 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  +++ L NAF  G ++   ++ G  G+GKTT ARI++  LN     ++ PT +  
Sbjct: 55  LVGQDVLVRILRNAFTIGSLSSPILMVGASGVGKTTCARIVSLCLNC----VNGPTPDPC 110

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C +I    + DV+E+DAAS+T +DD+R +++   Y P S+R++VYI+DEV MLS 
Sbjct: 111 GLCHECVSIQNFTNPDVIEIDAASNTGVDDIRVLLENSSYLPASSRYKVYIIDEVHMLSI 170

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLE+P  HV+F+ ATTE+RK+P+TV SRC R DL +++   L     ++ ++
Sbjct: 171 SAFNALLKTLEDPAEHVRFVMATTEVRKVPVTVASRCHRLDLSKLTSDQLFTHLVEVAKK 230

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D E + +IA  + GSAR+ L LL+Q+     +KI  + VR++L   D++   DL 
Sbjct: 231 EGIEHDDEGLRLIAENASGSARNALFLLEQSAIYTRNKIRVTDVRVLLGCVDKSLAEDLV 290

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D  + L+ F  Q  S   P  +L    E   L+     +  ++D   +    + 
Sbjct: 291 KCILLADASSALKVF-RQLCSQSLPIAVL----EGMQLIVYELCVASVSDGHKFDLGRD- 344

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIA 358
             L   K  S +FLSR WQ +  G+ E++       A EM++IRL +   LPSP+ IA
Sbjct: 345 -LLSTIKSSSTSFLSRVWQTMAHGLQEVKSADDTQRAGEMMVIRLCYLSDLPSPQRIA 401


>gi|87122720|ref|ZP_01078595.1| DNA polymerase III subunits gamma and tau [Marinomonas sp. MED121]
 gi|86162017|gb|EAQ63307.1| DNA polymerase III subunits gamma and tau [Marinomonas sp. MED121]
          Length = 823

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 201/345 (58%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           + GQ  +++ L NA K  R+  +Y+ +GTRG+GKTT ARI A+ LN +T  I   + E  
Sbjct: 18  LAGQDHVLQALVNALKQQRLHHAYLFTGTRGVGKTTIARIFAKCLNCETNGI---SPEPC 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T ++D RE+++ + Y P   RF+VY++DEV MLST
Sbjct: 75  GTCGSCVEIAEGRFVDLIEVDAASRTKVEDTRELLENVQYTPTRGRFKVYLIDEVHMLST 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L  +S G ++    K+L  
Sbjct: 135 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFNLKNMSPGRVVNYLEKVLTT 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +D   +  I +A++GS RD LSL DQAIA  N  I  + V  ML L ++ +++ L 
Sbjct: 195 EQLSYDEAGLWQIGQAANGSMRDALSLTDQAIAFGNGHISETDVTSMLGLVNQAQVVGLL 254

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++ D  N+L+  +   D   +   I   L +  H +   + +P   +  L    + A
Sbjct: 255 DAIVQSDAANLLKLVNDLADYQPDFVAICASLLDLLHRIAIEQQVPGALEDQL---GDLA 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +    +++V    +  F+Q +L G  ++     P    EM+L+RL
Sbjct: 312 KVKLIAQQVPSEVIQLFYQTMLIGKRDLPLAHSPKAGFEMLLLRL 356


>gi|15602229|ref|NP_245301.1| DNA polymerase III subunits gamma and tau [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|12720609|gb|AAK02448.1| DnaX [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 714

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/346 (37%), Positives = 205/346 (59%), Gaps = 14/346 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L+N  K  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     +   T E  
Sbjct: 18  VVGQTHILTALSNGLKENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VHGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC+AI +GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GECEHCKAIEQGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVQGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    + +    IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLKALEQQQIAQHLEFILTQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+  +A+A+ GS RD LSL DQAIA  N  I  + V  ML L D ++ +D+ 
Sbjct: 194 EKIPFEFLALEKLAKAAQGSIRDSLSLTDQAIAMSNGNITLNVVHEMLGLLDDDQALDII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP--EMADTLLYSEAE 298
             L +G   +V++   +  + G +   +L D+ E  H +   + +P  ++ DT       
Sbjct: 254 HALQQGQGESVMKGVQAVAEKGGDWDELLRDIGENLHKIAMQQLLPSSQLDDT------- 306

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            +R    +  +S   +  F+Q++L G  E+         VEM L+R
Sbjct: 307 -SRIGFLASHISPEDVQFFYQVMLTGRKELPYAPNRRIGVEMTLLR 351


>gi|323191136|gb|EFZ76400.1| DNA polymerase III, subunits gamma and tau [Escherichia coli
           RN587/1]
          Length = 643

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 212/366 (57%), Gaps = 18/366 (4%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA++GS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIP-----EMADTLLYS 295
             +++ +   V+   +     G+    +L ++    H +  ++  P     +MA T L  
Sbjct: 254 EAMVEANGERVMALINEAATRGIEWEALLVEMLGLLHRIAMVQLSPAALGNDMAATEL-- 311

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSP 354
                R  + ++ +  T +  ++Q +L G  E+         VEM L+R LA   ++P P
Sbjct: 312 -----RMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLP 366

Query: 355 E-EIAR 359
           E E+ R
Sbjct: 367 EPEVPR 372


>gi|262276244|ref|ZP_06054053.1| DNA polymerase III subunits gamma and tau [Grimontia hollisae CIP
           101886]
 gi|262220052|gb|EEY71368.1| DNA polymerase III subunits gamma and tau [Grimontia hollisae CIP
           101886]
          Length = 708

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 201/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT ARI A+ LN +      P     
Sbjct: 18  VVGQSHVLTALANALDHNRLHHAYLFSGTRGVGKTTIARIFAKGLNCEQGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    CQ I +G  VD++E+DAAS T ++D R+++D + YKP   R++VY++DEV MLS 
Sbjct: 74  GVCATCQEIEQGRFVDLLEIDAASRTKVEDTRDLLDNVQYKPARGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  + +  + +  + +L++
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKHLDVTQIKDQLSHVLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+  +  A++MIARA++GS RD LSL DQAIA  N  +    V  ML     ++ + L 
Sbjct: 194 ESVPAETRALSMIARAAEGSMRDALSLTDQAIALGNGVVQERQVTEMLGTLSTDQAILLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G   +VL   +   + GV    +L ++A   H V   + +PE  D    S  +  
Sbjct: 254 EALAEGHANHVLACLTHLAEVGVEWDGLLKEIASQLHRVAMAQALPESVDG---SSPDAE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           R L   K VS   +  F+Q+ L+G  ++         +EMVL+R+
Sbjct: 311 RILALGKLVSPQDVQLFYQIALQGRQDLPYAPDGRAGLEMVLLRM 355


>gi|24111853|ref|NP_706363.1| DNA polymerase III subunits gamma and tau [Shigella flexneri 2a
           str. 301]
 gi|30061970|ref|NP_836141.1| DNA polymerase III subunits gamma and tau [Shigella flexneri 2a
           str. 2457T]
 gi|110804497|ref|YP_688017.1| DNA polymerase III subunits gamma and tau [Shigella flexneri 5 str.
           8401]
 gi|24050648|gb|AAN42070.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Shigella flexneri 2a str. 301]
 gi|30040214|gb|AAP15947.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Shigella flexneri 2a str. 2457T]
 gi|110614045|gb|ABF02712.1| DNA polymerase III, tau and gamma subunits [Shigella flexneri 5
           str. 8401]
 gi|281599809|gb|ADA72793.1| DNA polymerase III, tau and gamma subunits [Shigella flexneri
           2002017]
 gi|313646900|gb|EFS11357.1| DNA polymerase III, subunits gamma and tau [Shigella flexneri 2a
           str. 2457T]
          Length = 641

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/361 (36%), Positives = 210/361 (58%), Gaps = 8/361 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA++GS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++G+   V+   +     G+    +L ++    H +  ++  P      +   A   
Sbjct: 254 EAMVEGNGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPAALGNDMA--AIEL 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE-EIA 358
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R LA   ++P PE E+ 
Sbjct: 312 RMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVP 371

Query: 359 R 359
           R
Sbjct: 372 R 372


>gi|204930489|ref|ZP_03221419.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204320423|gb|EDZ05626.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|198243935|ref|YP_002214437.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|207855963|ref|YP_002242614.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|197938451|gb|ACH75784.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|206707766|emb|CAR32051.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|326622184|gb|EGE28529.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|62179095|ref|YP_215512.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|62126728|gb|AAX64431.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322713556|gb|EFZ05127.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|322614760|gb|EFY11689.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618867|gb|EFY15755.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623574|gb|EFY20413.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629127|gb|EFY25906.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631848|gb|EFY28602.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637415|gb|EFY34117.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642100|gb|EFY38710.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322645876|gb|EFY42397.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652338|gb|EFY48693.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653241|gb|EFY49574.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660610|gb|EFY56846.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322664762|gb|EFY60955.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669185|gb|EFY65335.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670730|gb|EFY66863.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322679031|gb|EFY75086.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682060|gb|EFY78085.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322685111|gb|EFY81108.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323192995|gb|EFZ78218.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196923|gb|EFZ82065.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203908|gb|EFZ88925.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323207007|gb|EFZ91960.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323214210|gb|EFZ98968.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214466|gb|EFZ99217.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323219191|gb|EGA03688.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323226972|gb|EGA11153.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230210|gb|EGA14330.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233948|gb|EGA18037.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238358|gb|EGA22416.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244045|gb|EGA28054.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323251832|gb|EGA35695.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323257828|gb|EGA41507.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261158|gb|EGA44750.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264912|gb|EGA48411.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323272475|gb|EGA55882.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|283784297|ref|YP_003364162.1| DNA polymerase III subunits gamma and tau [Citrobacter rodentium
           ICC168]
 gi|282947751|emb|CBG87307.1| DNA polymerase III subunits gamma and tau [Citrobacter rodentium
           ICC168]
          Length = 643

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 206/358 (57%), Gaps = 11/358 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVDQIRHQLEHILDE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + +I T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQITTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEM--ADTLLYSEAE 298
             ++  D   V+   +     G+    +L ++    H +  ++  P    +D  +     
Sbjct: 254 EAVVAADGERVMSLVNEAAARGIEWEALLVEMLGLLHRIALVQLSPAALGSDMAMI---- 309

Query: 299 NARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
             R  + ++ V  T +  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 310 EVRMRELARTVPPTDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|290474637|ref|YP_003467517.1| DNA polymerase III subunits tau/gamma; DNA elongation factor III
           [Xenorhabdus bovienii SS-2004]
 gi|289173950|emb|CBJ80737.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Xenorhabdus bovienii SS-2004]
          Length = 658

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 204/347 (58%), Gaps = 12/347 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ ++  L N  +  R+  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VIGQQHVLTALANGLEHQRLHHAYLFSGTRGVGKTTIARLLAKGLNCETGITKTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  +++  +      +L  
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALNVDQISGQLEHVLNA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A  ++ARA+DGS RD LSL DQAIA    K+    V  ML   D ++ +++ 
Sbjct: 194 EQIESDSRARHLLARAADGSMRDALSLTDQAIALGGGKLTADIVSQMLGTLDNDQPLEMI 253

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
            +L++ D   ++ ++++ +S+   GV+   +L D+    H +  ++ +P+  D    S  
Sbjct: 254 EWLVRADGQQLMALVEQIASR---GVDWEHLLVDILSLLHRIAMLQLLPQQPDNDPSSME 310

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
              R L  ++ +S   L  F+Q +L G  ++         VEM L+R
Sbjct: 311 GRLRLL--ARSISPADLQLFYQALLVGRKDLPYAPERRMGVEMALLR 355


>gi|197247588|ref|YP_002145467.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197211291|gb|ACH48688.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|168237601|ref|ZP_02662659.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194735928|ref|YP_002113515.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|194711430|gb|ACF90651.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197289588|gb|EDY28951.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|167550989|ref|ZP_02344745.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168231475|ref|ZP_02656533.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168261077|ref|ZP_02683050.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194471215|ref|ZP_03077199.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197262082|ref|ZP_03162156.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200389464|ref|ZP_03216075.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|224582321|ref|YP_002636119.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|194457579|gb|EDX46418.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197240337|gb|EDY22957.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|199601909|gb|EDZ00455.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205324245|gb|EDZ12084.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205334143|gb|EDZ20907.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205349826|gb|EDZ36457.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|224466848|gb|ACN44678.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|320084759|emb|CBY94549.1| DNA polymerase III, tau and gamma subunits [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|148653256|ref|YP_001280349.1| DNA polymerase III subunits gamma and tau [Psychrobacter sp.
           PRwf-1]
 gi|148572340|gb|ABQ94399.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Psychrobacter sp. PRwf-1]
          Length = 751

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 204/345 (59%), Gaps = 6/345 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  + K L NA    R+  +Y+ +GTRG+GKTT ARI+++ LN +T     P     
Sbjct: 20  LVGQSHVSKALINAIDHNRLHHAYLFTGTRGVGKTTIARILSKCLNCETGVTSTPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C AI +G  +D++E+DAAS T ++D RE+ID + Y P   R++VY++DEV MLST
Sbjct: 76  GVCSSCVAIDQGRFIDLIEIDAASRTKVEDTRELIDNVPYAPTQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+PIT++SRC +F L  +    L +    +L +
Sbjct: 136 HSFNALLKTLEEPPAHVKFLLATTDPQKLPITIISRCLQFVLRPLPQQALSDHIANLLTQ 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I+F   A+  +A A+ GS RD LSL DQAIA    ++   +V  ML L D   ++ L 
Sbjct: 196 ENIDFTQPALWQLANAAKGSVRDALSLTDQAIAFGQGRLTDETVNDMLGLIDSADLISLL 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             + +G+   +           V+   +   LA+  H +  ++ +P ++  +   +A+  
Sbjct: 256 LDIYQGNAPALSAHIEQMRAQLVDAGSMFDGLADLLHQIAMVQLLPNVSLNVNDLQAQQI 315

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
            AL  + ++    L  ++Q++++G  +I+  + P++A+EM L+RL
Sbjct: 316 TAL--AAQIGPDVLQLYYQIVIQGREQIKLANTPLQALEMCLLRL 358


>gi|261341080|ref|ZP_05968938.1| DNA polymerase III subunit tau [Enterobacter cancerogenus ATCC
           35316]
 gi|288316753|gb|EFC55691.1| DNA polymerase III subunit tau [Enterobacter cancerogenus ATCC
           35316]
          Length = 645

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 205/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEHILDE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA+DGS RD LSL DQAIA  + K+ T +V  ML   D ++ + L 
Sbjct: 194 EKIVHEPRALQLLARAADGSLRDALSLTDQAIASGDGKLSTDAVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +I  +   V+   +     GV    +L ++    H V  ++  P      + +  +  
Sbjct: 254 EAMIAANGERVMSLVNEAAARGVEWESLLVEMLGLLHRVAMLQLSPSAIGADMATIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    +  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPADVQLYYQTLLIGRKELPFAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|212711281|ref|ZP_03319409.1| hypothetical protein PROVALCAL_02353 [Providencia alcalifaciens DSM
           30120]
 gi|212686010|gb|EEB45538.1| hypothetical protein PROVALCAL_02353 [Providencia alcalifaciens DSM
           30120]
          Length = 648

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 194/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKTT AR+ A+ LN +T     P     
Sbjct: 18  VVGQQHVLTALANGLEHQRLHHAYLFSGTRGVGKTTIARLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GKCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + E    IL  
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVAQISEQLELILNA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+IE D  A  +IARA+DGS RD LSL DQAIA    K+    V  ML   D  + + + 
Sbjct: 194 ENIEHDTRARQLIARAADGSLRDALSLTDQAIAMGQGKVTADIVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+ +   V+ +       G +   +L ++    H +  I+ +P   +T     +   
Sbjct: 254 EALIRAEGAAVMSQVEQAASRGADWENLLVEILSLLHRIAMIQLLPAEQET--DPSSTEG 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  Q ++ +S   L  F+Q +L G  E+         VEM L+R
Sbjct: 312 RLRQAARLISPADLQLFYQTLLVGRKELAYAPERRMGVEMALLR 355


>gi|205351792|ref|YP_002225593.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205271573|emb|CAR36393.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326626828|gb|EGE33171.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 642

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|168240315|ref|ZP_02665247.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194450868|ref|YP_002044517.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194409172|gb|ACF69391.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205339944|gb|EDZ26708.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 642

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|16759463|ref|NP_455080.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|29142765|ref|NP_806107.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|213162890|ref|ZP_03348600.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213427143|ref|ZP_03359893.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213865424|ref|ZP_03387543.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|25288577|pir||AG0562 DNA polymerase III chains gamma and tau [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16501755|emb|CAD04969.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138397|gb|AAO69967.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
          Length = 642

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|291326691|ref|ZP_06125481.2| DNA polymerase III subunit tau [Providencia rettgeri DSM 1131]
 gi|291313231|gb|EFE53684.1| DNA polymerase III subunit tau [Providencia rettgeri DSM 1131]
          Length = 652

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 195/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N     R+  +Y+ SGTRG+GKTT AR+ A+ LN +T     P     
Sbjct: 23  VVGQQHVLTALANGLTHQRLHHAYLFSGTRGVGKTTIARLFAKGLNCETGITASPC---- 78

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 79  GKCANCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 138

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  + E    IL  
Sbjct: 139 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVTQISEQLELILNA 198

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+IE D  A  +IARA+DGS RD LSL DQAIA    K+    V  ML   D  + + + 
Sbjct: 199 ENIEHDQRARQLIARAADGSLRDALSLTDQAIAMGQGKVTADIVSQMLGTLDDEQPLAII 258

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L++ D + V+++       G +   +L ++    H +  I+ +P   +T     +   
Sbjct: 259 EALVRADSMAVMEQVEQAASRGADWENLLVEVLSQLHRIAMIQLLPAEQET--DPSSTEG 316

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  Q ++ +S   L  F+Q +L G  E+         VEM L+R
Sbjct: 317 RLRQVARIISPADLQLFYQTLLVGRKELPYAPERRMGVEMALLR 360


>gi|288554626|ref|YP_003426561.1| DNA polymerase III subunits gamma and tau [Bacillus pseudofirmus
           OF4]
 gi|288545786|gb|ADC49669.1| DNA polymerase III gamma and tau subunits [Bacillus pseudofirmus
           OF4]
          Length = 561

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 137/368 (37%), Positives = 206/368 (55%), Gaps = 7/368 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ + KTL NA    + + +Y+ SG RG GKT+ A+IIA+++N + A +  P  E  
Sbjct: 18  VVGQEHITKTLQNALLQNKFSHAYLFSGPRGTGKTSAAKIIAKAINCEKAPVAEPCNECA 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
                C+ I  G  VDV+E+DAAS+  +D++R+I D++ + P    ++VYI+DEV MLST
Sbjct: 78  A----CKGITSGAIVDVMEIDAASNNGVDEIRDIRDKVKFAPNEVPYKVYIIDEVHMLST 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HV FI ATTE  KIP+T++SRCQRFD  RI    ++    +IL  
Sbjct: 134 GAFNALLKTLEEPPGHVIFILATTEPHKIPLTIISRCQRFDFKRIPNTAIVGRMNEILLH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           + IE D EA+ MIARA+DG  RD LSLLDQAI+     +    V  +        +++L 
Sbjct: 194 DGIEVDDEALNMIARAADGGMRDALSLLDQAISYAEGPLTLEDVLAITGAVSEQVLVNLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D   VL+        G  P  IL DL  +   +   K  P+  D L  +++ + 
Sbjct: 254 EAVANKDSAVVLESLDQLVRDGKEPGRILEDLIYYMRDLLLCKTAPDSKDLLERADSGDI 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
            A+  S++    +L +  +++   + E++  + P   +EM LIRL +  Q PS       
Sbjct: 314 -AVSLSEQFDFPWLYQAIEVLNGSVQEMKWSTHPKVILEMALIRLVN--QRPSESSAGSE 370

Query: 361 IVEEKKKK 368
           +  E  K+
Sbjct: 371 VKSETVKQ 378


>gi|16763864|ref|NP_459479.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|167990471|ref|ZP_02571571.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168465581|ref|ZP_02699463.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|20141409|sp|P74876|DPO3X_SALTY RecName: Full=DNA polymerase III subunit tau; Contains: RecName:
           Full=DNA polymerase III subunit gamma
 gi|16418992|gb|AAL19438.1| DNA polymerase III, tau and gamma subunits [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|195631598|gb|EDX50118.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|205330903|gb|EDZ17667.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261245766|emb|CBG23563.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992201|gb|ACY87086.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157093|emb|CBW16577.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911516|dbj|BAJ35490.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|321226062|gb|EFX51113.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|323128803|gb|ADX16233.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 642

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|93006233|ref|YP_580670.1| DNA polymerase III, subunits gamma and tau [Psychrobacter
           cryohalolentis K5]
 gi|92393911|gb|ABE75186.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Psychrobacter cryohalolentis K5]
          Length = 685

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 133/361 (36%), Positives = 207/361 (57%), Gaps = 6/361 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ  + + L NA    R+  +Y+ +GTRG+GKTT ARI+++ LN  T     P     
Sbjct: 20  LIGQTHVSQALINAIDYNRLHHAYLFTGTRGVGKTTIARILSKCLNCDTGITSTPC---- 75

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C AI +G  +D++E+DAAS T ++D RE++D + Y P   R++VY++DEV MLST
Sbjct: 76  GVCDNCVAIDQGRFIDLIEIDAASRTKVEDTRELLDNVPYAPSQGRYKVYLIDEVHMLST 135

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+PIT++SRC +F L  +S   L E    +L +
Sbjct: 136 HSFNALLKTLEEPPEHVKFLLATTDPQKLPITIISRCLQFVLRPLSQSLLSEHLANVLTQ 195

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + +   A+  +A A+ GS RD LSL DQAIA     +   +V  ML L D   ++ L 
Sbjct: 196 EQVGYTQPALWQLASAAKGSVRDALSLTDQAIAFGQGALDDVTVNSMLGLIDAADLVSLI 255

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D   V           V+ S +   LAE  H +   + +PE+A  L  +EA+  
Sbjct: 256 TDIYNHDKPAVAAHIEQMRAQMVDASSMFDGLAELLHQLALCQLLPEVA--LNVNEAQAQ 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEEIARY 360
              Q ++ +S   L  +++++++    ++  S PM+A+EM ++RL     LP  E +A  
Sbjct: 314 HIDQLAQHMSPDVLQLYYEIVVQAREGVKLASTPMQALEMCILRLLAFRPLPVDEILANV 373

Query: 361 I 361
           +
Sbjct: 374 L 374


>gi|168818899|ref|ZP_02830899.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344020|gb|EDZ30784.1| DNA polymerase III, tau subunit [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 642

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRCVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|260776402|ref|ZP_05885297.1| DNA polymerase III subunits gamma and tau [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260607625|gb|EEX33890.1| DNA polymerase III subunits gamma and tau [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 694

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQRHVLTALENALAQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GICDTCREIDEGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  IS+ ++ E    IL+ 
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVDNIHEQLDHILKH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +P A+ MIA A+DGS RD LSL DQAIA  N +++  SV  ML   D ++ + L 
Sbjct: 194 EQVSSEPRALGMIAHAADGSMRDALSLSDQAIALGNGQVLADSVAHMLGTLDTDQALHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +   S+   +GV    +L  LA   H +   + +P   D     +AE  
Sbjct: 254 EAISSKQPQVAMDSLSALAQNGVEWDGLLQQLATQLHRLAMYQALPATLDK-AQPDAEKV 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  S+ ++   +  ++Q+ LKG  ++         +EM+++R+
Sbjct: 313 ELL--SRALAPQDVQLYYQIALKGRQDLPLAPSERIGLEMIVLRM 355


>gi|229896122|ref|ZP_04511292.1| DNA polymerase III subunits gamma and tau [Yersinia pestis
           Pestoides A]
 gi|229701045|gb|EEO89074.1| DNA polymerase III subunits gamma and tau [Yersinia pestis
           Pestoides A]
          Length = 653

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 13  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 68

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 69  GTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 128

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+L  
Sbjct: 129 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEKVLLA 188

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA++    ++ T +V  ML   D  + + + 
Sbjct: 189 EQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTVTVSQMLGTLDDEQPLAII 248

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   +  A   
Sbjct: 249 EALVSADGARVMAQIEQAASRGVDWENLLVESLSLLHKIAMVQLLPSMLDN--HYAAIEP 306

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 307 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 350


>gi|37527701|ref|NP_931046.1| DNA polymerase III subunits gamma and tau [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787136|emb|CAE16213.1| DNA polymerase III subunit Tau [Contains: DNA polymerase III
           subunit gamma] [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 658

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 133/344 (38%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ ++  L N    GR+  +Y+ SGTRG+GKTT AR+ A+ LN +T   D P     
Sbjct: 18  VIGQEYILTALANGLAHGRLHHAYLFSGTRGVGKTTIARLFAKGLNCETGITDKPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C  I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GKCVNCLEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + IG + +   +IL+ 
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKSLDIGQISDQLERILKA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E IE D  A  ++ARA+DGS RD LSL DQAIA     + T  V LML   D  + + + 
Sbjct: 194 EHIESDNRARQLLARAADGSMRDALSLTDQAIAIGQGLVTTEIVSLMLGTLDDEQPLSII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             LI+ D   V+         G +   +L ++    H +  ++ +P   ++   S +   
Sbjct: 254 EALIRADGQQVMALVEQVASRGADWEDLLVEILALLHRIAMLQLLPSQPES--DSSSIEG 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R    +K VS   L  ++Q +L G  ++         VEM L R
Sbjct: 312 RLRIVAKAVSPEDLQLYYQTLLIGRRDLPYAPERRMGVEMALFR 355


>gi|119774447|ref|YP_927187.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
 gi|119766947|gb|ABL99517.1| DNA-directed DNA polymerase [Shewanella amazonensis SB2B]
          Length = 909

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 129/345 (37%), Positives = 206/345 (59%), Gaps = 10/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  LTNA    R+  +Y+ +GTRG+GKT+ AR+ A+ LN +      P     
Sbjct: 18  VVGQSHVLHALTNALGQQRLHHAYLFTGTRGVGKTSLARLFAKGLNCEQGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T +DD REI+D + Y+P   RF+VY++DEV MLS 
Sbjct: 74  GQCSACREIAEGRFVDLIEVDAASRTKVDDTREILDNVQYRPSRGRFKVYLIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           ++FN LLKTLEEPP HVKF+ ATT+ +K+P+TVLSRC +F+L  ++   +      +L  
Sbjct: 134 SSFNALLKTLEEPPEHVKFLLATTDPQKLPVTVLSRCLQFNLKALTQPQIQAQLAAVLSG 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + FD +A++++A+A+ GS RD LSL DQAIA    ++  + V+ ML   D+ +I++LF
Sbjct: 194 EGLGFDEDALSLLAKAAAGSMRDALSLTDQAIAFGGGEVRLAQVQTMLGAIDKGQILNLF 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +GDI  +L    +    G +   +L  L E  H ++  ++ P  A     S ++N 
Sbjct: 254 DALCQGDIETLLTTARTAMGFGADADEVLRALLELLHQISLAQFAPATA-----SISDNG 308

Query: 301 RA-LQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
            A L +++ +    +  ++Q++L G  ++     P   +EM L+R
Sbjct: 309 AAVLAWAQALKPEQVQLYYQILLSGRKDLPYAPDPASGLEMSLLR 353


>gi|114330605|ref|YP_746827.1| DNA polymerase III, subunits gamma and tau [Nitrosomonas eutropha
           C91]
 gi|114307619|gb|ABI58862.1| DNA polymerase III, subunits gamma and tau [Nitrosomonas eutropha
           C91]
          Length = 527

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 142/380 (37%), Positives = 218/380 (57%), Gaps = 29/380 (7%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ L N+ +  R+  +Y+ +GTRG+GKTT ARI+A++LN +      P     
Sbjct: 19  LVGQEHVVRALVNSMEQNRLHHAYLFTGTRGVGKTTVARILAKALNCEQGVTATPC---- 74

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C AI +GN VD++ELDAAS+T +D +RE++D   Y P++AR++VY++DEV MLS 
Sbjct: 75  GKCAACLAIDQGNFVDLIELDAASNTQVDAMRELLDNAQYAPVTARYKVYLIDEVHMLSK 134

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+ +KIP+TVLSRC +F+L +I    ++   ++IL  
Sbjct: 135 SAFNAMLKTLEEPPEHVKFILATTDPQKIPVTVLSRCLQFNLKQIPPSLIVTRLSEILSM 194

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++A+A+ GS RD LSLLDQAIA  N  +   + R+ML   D++ +  L 
Sbjct: 195 ERIVADATALKLLAKAAKGSLRDALSLLDQAIALGNATVDEKNTRVMLGALDQDHLFALL 254

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             L + D      I + L+  S  +DS       L DLA   H +  ++ +P+M D    
Sbjct: 255 EALAEQDGAALLAIADQLEAASVSFDSA------LQDLAALLHRLAIVQTVPQMLDE--- 305

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL--------- 345
            + E+ R L   K  +   +  F+Q+ L G +++           M L+R+         
Sbjct: 306 EQPESDRLLALVKCFTPEDIQLFYQIALHGRADLGQAPDEYSGFTMTLMRMLAFMPHSQQ 365

Query: 346 -AHAVQLPSPEEIARYIVEE 364
            +H V   +   I R I  E
Sbjct: 366 SSHPVHASTNANITRKIKSE 385


>gi|167470065|ref|ZP_02334769.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis FV-1]
          Length = 583

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+L  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEKVLLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA++    ++ T +V  ML   D  + + + 
Sbjct: 194 EQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTVTVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   +  A   
Sbjct: 254 EALVSADGARVMAQIEQAASRGVDWENLLVESLSLLHKIAMVQLLPSMLDN--HYAAIEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|172060787|ref|YP_001808439.1| DNA polymerase III subunits gamma and tau [Burkholderia ambifaria
           MC40-6]
 gi|171993304|gb|ACB64223.1| DNA polymerase III, subunits gamma and tau [Burkholderia ambifaria
           MC40-6]
          Length = 813

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+ +A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EQISFELQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L  G+   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DALAAGNGPEILAIADEMSLRSLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              +++  +S   +  F+Q+   G +E+           M L+R+
Sbjct: 311 DLRRFADALSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|293390054|ref|ZP_06634388.1| DNA polymerase III subunit tau [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290950588|gb|EFE00707.1| DNA polymerase III subunit tau [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 681

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 204/344 (59%), Gaps = 10/344 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N  +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     +   T E  
Sbjct: 18  VVGQQHILTALANGLRENRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VSGVTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  EHC AI +GN +D++E+DAAS T ++D RE++D + YKP+  R++VY++DEV MLS 
Sbjct: 74  GVCEHCNAIEKGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVLGRYKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+  K+P+T+LSRC +F L  +    + +    IL +
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPYKLPVTILSRCMQFHLKALEQSQIADHLAYILNQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+  A+  +A A+ GS RD LSL DQAIA  N  +  + V  ML L D ++ +++ 
Sbjct: 194 EQIPFESLALDKLANAAQGSIRDSLSLTDQAIAMSNGNVTLNIVNDMLGLLDESQAIEMI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L +G+   ++Q  ++  D   +   +L ++AE  H +   + +P+ A        E++
Sbjct: 254 YALQQGNGEKLMQAVNAVADKAGDWDELLREVAENLHKIAMQQLLPQAALD------ESS 307

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           +    +K ++   +  F+Q+++ G  E+          EMVL+R
Sbjct: 308 QIGFLAKHIAPQDVQFFYQVVVTGRKELSVAPTARMGAEMVLLR 351


>gi|115351816|ref|YP_773655.1| DNA polymerase III subunits gamma and tau [Burkholderia ambifaria
           AMMD]
 gi|115281804|gb|ABI87321.1| DNA polymerase III, subunits gamma and tau [Burkholderia ambifaria
           AMMD]
          Length = 824

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 130/348 (37%), Positives = 208/348 (59%), Gaps = 13/348 (3%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVSHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+ +A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 EQISFELQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEA 297
             L  G+   I+ +  E S +    ++ S  L DLA   H +   ++ P    ++L    
Sbjct: 254 DALAAGNGPEILTIADEMSLR---SLSFSTALQDLASLLHRIAWAQFAP---GSVLDEWP 307

Query: 298 ENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           E A   +++  +S   +  F+Q+   G +E+           M L+R+
Sbjct: 308 EAADLRRFADALSPEQVQLFYQIATVGRAELGLAPDEYAGFTMTLLRM 355


>gi|323493358|ref|ZP_08098481.1| DNA polymerase III subunits gamma and tau [Vibrio brasiliensis LMG
           20546]
 gi|323312444|gb|EGA65585.1| DNA polymerase III subunits gamma and tau [Vibrio brasiliensis LMG
           20546]
          Length = 714

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 201/345 (58%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQAHVLTALENALAQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GVCDTCKEIDEGRFVDLLEIDAASRTKVEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  IS+ ++ +    ILQ 
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVDNIHQQLDHILQH 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +  A+ MI+ A+DGS RD LSL DQAIA  N +++T SV  ML   D ++ + L 
Sbjct: 194 ENVAAEARALGMISHAADGSMRDALSLTDQAIALGNGQVLTDSVAHMLGTLDTDQALHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +   +    +GV    +L  LA   H +   + +P    TL  S+ +  
Sbjct: 254 EAISSKQPQVAMDSVAHLAQNGVEWDGLLQQLATQLHRLAMYQALPA---TLDQSQPDAE 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           +    S+++S   +  ++Q+ LKG  ++         +EMV++R+
Sbjct: 311 KVELLSRQLSPQDVQLYYQIALKGRQDLPLAPSERTGLEMVILRM 355


>gi|294635357|ref|ZP_06713851.1| DNA polymerase III subunit tau [Edwardsiella tarda ATCC 23685]
 gi|291091244|gb|EFE23805.1| DNA polymerase III subunit tau [Edwardsiella tarda ATCC 23685]
          Length = 681

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 201/344 (58%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 42  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 97

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 98  GVCDNCREIEQGRFVDLLEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 157

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    +     KI Q 
Sbjct: 158 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLRALDHEQIRAQLAKIAQA 217

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ES+  D  A+ ++ARA++GS RD LSL+DQAIA    +I   +V  ML   D  + + L 
Sbjct: 218 ESLAADARALQLLARAAEGSMRDALSLMDQAIAMGQGQITADAVSQMLGTLDDEQPLALI 277

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   V++        GV+   +L ++    H V  ++ +P   D+  Y+  E+ 
Sbjct: 278 EALTAADGALVMERVEQAAGRGVDWENLLLEMLTLLHRVAMLQLLPSALDS-QYAAVES- 335

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    L  F+Q++L G  E+         VEM L+R
Sbjct: 336 RLRELARLLPPADLQLFYQIMLNGRKELAYAPDRRMGVEMTLLR 379


>gi|53804576|ref|YP_113790.1| DNA polymerase III, gamma and tau subunits, programmed frameshift
           [Methylococcus capsulatus str. Bath]
 gi|53758337|gb|AAU92628.1| DNA polymerase III, gamma and tau subunits [Methylococcus
           capsulatus str. Bath]
          Length = 547

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 133/352 (37%), Positives = 207/352 (58%), Gaps = 22/352 (6%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K LT+A ++GR+  +Y+ +GTRG+GKTT ARI+A++LN +      P     
Sbjct: 18  VVGQEHVVKALTHALEAGRMHHAYLFTGTRGVGKTTLARILAKALNCEDRQGANPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ +  G  +D++E+DAAS T ++D R+++D + Y P   R++VY++DEV MLS 
Sbjct: 74  GRCLICREVDEGRFIDLIEVDAASRTKVEDTRDLLDNVQYAPNQGRYKVYLIDEVHMLSG 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +KIP+TVLSRC +F+L R++   +     +IL  
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKIPVTVLSRCLQFNLKRLTPEQIRAQMAQILAS 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           ESI+F+P A   +ARA+ GS RDGLSLLDQAIA C  ++  + V  ML    R  +    
Sbjct: 194 ESIDFEPAATKALARAAQGSMRDGLSLLDQAIAHCGGRLTNTGVSAMLGTVSREPVYGAL 253

Query: 241 GYLIKGD------IINVLQEFSSQYDSGVNPSV-ILHDLAEFTHLVTRIKYIPEMADTLL 293
             L +        +   L EFS  Y   V   + ILH +A           I + A   +
Sbjct: 254 EALAESRADELLAVSATLAEFSPDYQDVVQQLLAILHQIA-----------IAQFAPDAI 302

Query: 294 YSEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             + E  R L  ++ ++      ++Q+ L+G  +++    P +  EM+L+R+
Sbjct: 303 RQDDEAERVLTLARCLTPEDTQLYYQIALQGQKDLQLAPDPRDGFEMLLLRM 354


>gi|238027056|ref|YP_002911287.1| DNA polymerase III subunits gamma and tau [Burkholderia glumae
           BGR1]
 gi|237876250|gb|ACR28583.1| DNA polymerase III, subunits gamma and tau [Burkholderia glumae
           BGR1]
          Length = 861

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 204/345 (59%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ +++ LT+A   GR+  +Y+ +GTRG+GKTT +RI A++LN +T     P     
Sbjct: 18  LVGQEHVVRALTHALDGGRLHHAYLFTGTRGVGKTTLSRIFAKALNCETGVTSQPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD VE+DAAS+  +D++  ++++  Y P+ ARF+VY++DEV ML+ 
Sbjct: 74  GVCRACREIDEGRFVDYVEMDAASNRGVDEMAALLERAVYAPVDARFKVYMIDEVHMLTN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN +LKTLEEPPPHVKFI ATT+ +KIP+TVLSRC +F+L ++  G ++    +IL E
Sbjct: 134 HAFNAMLKTLEEPPPHVKFILATTDPQKIPVTVLSRCLQFNLKQMPAGHIVMHLERILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E + F+P+A+ ++ARA+ GS RD LSL DQAIA   +++  ++V  ML   D+  ++ L 
Sbjct: 194 ERVAFEPQALRLLARAAQGSMRDALSLTDQAIAYSANEVTEAAVSGMLGALDQTYMVRLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +   D   +L          ++ S  L DLA   H +   ++ P    ++L    E A
Sbjct: 254 DAIASSDGPEILAIADEMALRSLSFSTALQDLAGLLHRIAWAQFAPA---SVLDEWPEAA 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
              ++++ +S   +  ++Q+   G  E+           M L+R+
Sbjct: 311 DLRRFAEALSPEQVQLYYQIATVGRGELGLAPDEYAGFTMTLLRM 355


>gi|262041601|ref|ZP_06014797.1| DNA polymerase III [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259041074|gb|EEW42149.1| DNA polymerase III [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 361

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 197/344 (57%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILGE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I F+P A+ +++RA+DGS RD LSL DQAIA    ++  +SV  ML   D ++ + L 
Sbjct: 194 EQIAFEPRALQLLSRAADGSLRDALSLTDQAIASGEGQLTAASVSTMLGTLDDDQALSLI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+   +     GV    +L ++    H +  ++  P      +   A   
Sbjct: 254 EALVAADGERVMAGVNDAAARGVEWEALLVEMQSLLHRIAMVQLSPSALGADM--AAVEV 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ V    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RMRELARTVPPGDVQLYYQTLLIGRKELPYAPDRRMGVEMTLLR 355


>gi|148977687|ref|ZP_01814248.1| DNA polymerase III subunits gamma and tau [Vibrionales bacterium
           SWAT-3]
 gi|145963055|gb|EDK28324.1| DNA polymerase III subunits gamma and tau [Vibrionales bacterium
           SWAT-3]
          Length = 747

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 200/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ  ++  L NA    R+  +Y+ SGTRG+GKTT  R+ A+ LN +T     P     
Sbjct: 18  VVGQAHVLTALENALSQNRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGITSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G  VD++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECATCKEIDEGRFVDLLEIDAASRTKLEDTRELLDNVQYKPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+P+T+LSRC +F L  IS+ ++ E    IL++
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVDNIHEQLDHILEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +  A+ MIA A+DGS RD LSL DQAIA  N  +VT +V  ML   D ++ + L 
Sbjct: 194 EKVTSESRALGMIAHAADGSMRDALSLTDQAIALGNGNVVTDTVAHMLGTLDTDQAIHLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +        +    +  ++GV    +L+ LA   H +   + +P   D     +AE  
Sbjct: 254 EAISSKQPQEAMACIQNLAENGVEWDGLLNQLAAQLHRLAMYQALPSTLDK-AQPDAEKL 312

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  SK +S   +  ++Q++LKG  ++         +EMV++R+
Sbjct: 313 ELL--SKALSPQDIQLYYQIVLKGREDLPLSPTARVGIEMVVLRM 355


>gi|251790619|ref|YP_003005340.1| DNA polymerase III subunits gamma and tau [Dickeya zeae Ech1591]
 gi|247539240|gb|ACT07861.1| DNA polymerase III, subunits gamma and tau [Dickeya zeae Ech1591]
          Length = 678

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 126/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKTT AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAKGLNCETGVTATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  + C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GQCDTCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    +      +L++
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDAEQIRRQLQHVLEQ 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E +  +P A+ ++ARA+DGS RD LSL DQAIA    ++  ++V  ML   D  + + L 
Sbjct: 194 EQLIAEPRALQLLARAADGSLRDALSLTDQAIAMGQGQVTAAAVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+KGD   V+         GV+   +L +     H +  ++ +P          A   
Sbjct: 254 EALVKGDGAGVMALLGQAAARGVDWEALLVETLTLLHRIAMLQLLPSALGDEYNQVAPRL 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R L  ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 314 REL--ARVIPPAEVQLYYQTLLVGRKELPYAPDRRMGVEMALLR 355


>gi|161615318|ref|YP_001589283.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161364682|gb|ABX68450.1| hypothetical protein SPAB_03088 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 642

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKVLDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|261377458|ref|ZP_05982031.1| DNA polymerase III, subunit gamma and tau [Neisseria cinerea ATCC
           14685]
 gi|269146186|gb|EEZ72604.1| DNA polymerase III, subunit gamma and tau [Neisseria cinerea ATCC
           14685]
          Length = 722

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 127/345 (36%), Positives = 199/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALRNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GVCESCTQIDAGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+P+TVLSRC +F L  ++   + +    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPVTVLSRCLQFVLRNMTSQQVADHLAHVLDS 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++P A+ ++ RA+ GS RD LSLLDQAIA  +  +    VR M+   D+  + +L 
Sbjct: 194 EKIAYEPAALQLLGRAAAGSMRDALSLLDQAIAMGSGSVAEQDVRQMIGAVDKQYLYELL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +I  D   +L +        V     L +LA     +  I+ +P     L + + +  
Sbjct: 254 TGIINQDGEALLAKAQEMAACAVGFDNALGELAMLLQHLALIQAVP---SALAHDDPDRG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  S+ +S   +  ++Q  ++G  ++           M L+R+
Sbjct: 311 VLLPLSQTLSGEQIQLYYQCAIRGKQDLSLAPDEYAGFVMTLLRM 355


>gi|254786716|ref|YP_003074145.1| DNA polymerase III subunits gamma and tau [Teredinibacter turnerae
           T7901]
 gi|237683496|gb|ACR10760.1| DNA polymerase III subunits gamma and tau [Teredinibacter turnerae
           T7901]
          Length = 672

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 201/351 (57%), Gaps = 19/351 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           M+GQ+ +++ L NA    R+  +Y+ +GTRG+GKTT ARI+A+ LN  +     P     
Sbjct: 18  MVGQEHVLRALINALDHNRLHHAYLFTGTRGVGKTTIARILAKCLNCDSGVTSTPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C  I  G  VD++E+DAAS T ++D RE++D + Y P   R+++Y++DEV MLS 
Sbjct: 74  GECTSCVEIAEGRFVDLIEVDAASRTKVEDTRELLDNVQYAPTRGRYKIYLIDEVHMLSN 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F+L  +S   ++     +L++
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFNLKNMSPERIVGHLQNVLEK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I  D  A+  +ARA+DGS RD LSL DQAIA  + K+  S V  ML   D   I  L 
Sbjct: 194 EAIPSDNAALWSLARAADGSMRDALSLTDQAIAFGSGKVADSDVAAMLGTIDHQLIQRLI 253

Query: 241 GYLIKGD---IINVLQEFSSQ---YDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLY 294
             LI+ D   ++N + EF+     +D+       L DL    H +   + +PE  D    
Sbjct: 254 EALIESDGARLLNAVAEFAEHAPDFDAA------LSDLLTMLHRIAIAQALPEALDN--- 304

Query: 295 SEAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
           S  + A+ L ++  ++   +  F+Q  L G  ++   S      EM L+R+
Sbjct: 305 SFGDRAQVLDFAARLTPEDVQLFYQTALIGRRDLPLASDSRSGFEMSLLRM 355


>gi|153949412|ref|YP_001402019.1| DNA polymerase III subunits gamma and tau [Yersinia
           pseudotuberculosis IP 31758]
 gi|152960907|gb|ABS48368.1| DNA polymerase III, subunits gamma and tau [Yersinia
           pseudotuberculosis IP 31758]
          Length = 658

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+L  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEKVLLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA++    ++ T +V  ML   D  + + + 
Sbjct: 194 EQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTVTVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   +  A   
Sbjct: 254 EALVSADGARVMAQIEQAASRGVDWENLLVESLSLLHKIAMVQLLPSMLDN--HYAAIEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|22124967|ref|NP_668390.1| DNA polymerase III subunits gamma and tau [Yersinia pestis KIM 10]
 gi|45440656|ref|NP_992195.1| DNA polymerase III subunits gamma and tau [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595342|ref|YP_069533.1| DNA polymerase III subunits gamma and tau [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808607|ref|YP_652523.1| DNA polymerase III subunits gamma and tau [Yersinia pestis Antiqua]
 gi|108811131|ref|YP_646898.1| DNA polymerase III subunits gamma and tau [Yersinia pestis
           Nepal516]
 gi|145600018|ref|YP_001164094.1| DNA polymerase III subunits gamma and tau [Yersinia pestis
           Pestoides F]
 gi|149365029|ref|ZP_01887064.1| DNA polymerase III subunit Tau (contains DNA polymerase III subunit
           Gamma) [Yersinia pestis CA88-4125]
 gi|162421503|ref|YP_001607270.1| DNA polymerase III subunits gamma and tau [Yersinia pestis Angola]
 gi|165927644|ref|ZP_02223476.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165935942|ref|ZP_02224512.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011016|ref|ZP_02231914.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166213081|ref|ZP_02239116.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399280|ref|ZP_02304804.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422767|ref|ZP_02314520.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423551|ref|ZP_02315304.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186894361|ref|YP_001871473.1| DNA polymerase III subunits gamma and tau [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930155|ref|YP_002348030.1| DNA polymerase III subunits gamma and tau [Yersinia pestis CO92]
 gi|229838721|ref|ZP_04458880.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229899289|ref|ZP_04514432.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901363|ref|ZP_04516485.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis Nepal516]
 gi|270489548|ref|ZP_06206622.1| DNA polymerase III, subunit gamma and tau [Yersinia pestis KIM D27]
 gi|294504861|ref|YP_003568923.1| DNA polymerase III subunits gamma and tau [Yersinia pestis Z176003]
 gi|21957809|gb|AAM84641.1|AE013709_10 DNA polymerase III, tau and gamma subunits [Yersinia pestis KIM 10]
 gi|45435514|gb|AAS61072.1| DNA polymerase III subunit Tau (Contains DNA polymerase III subunit
           Gamma) [Yersinia pestis biovar Microtus str. 91001]
 gi|51588624|emb|CAH20232.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Yersinia pseudotuberculosis IP 32953]
 gi|108774779|gb|ABG17298.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Yersinia pestis Nepal516]
 gi|108780520|gb|ABG14578.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Yersinia pestis Antiqua]
 gi|115348766|emb|CAL21718.1| DNA polymerase III subunit Tau (contains DNA polymerase III subunit
           Gamma) [Yersinia pestis CO92]
 gi|145211714|gb|ABP41121.1| DNA polymerase III, gamma subunit / DNA polymerase III, tau subunit
           [Yersinia pestis Pestoides F]
 gi|149291442|gb|EDM41516.1| DNA polymerase III subunit Tau (contains DNA polymerase III subunit
           Gamma) [Yersinia pestis CA88-4125]
 gi|162354318|gb|ABX88266.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis Angola]
 gi|165916087|gb|EDR34694.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165920398|gb|EDR37675.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165990016|gb|EDR42317.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205868|gb|EDR50348.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166958358|gb|EDR55379.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051784|gb|EDR63192.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167057721|gb|EDR67467.1| DNA polymerase III, subunits gamma and tau [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186697387|gb|ACC88016.1| DNA polymerase III, subunits gamma and tau [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681292|gb|EEO77386.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis Nepal516]
 gi|229687691|gb|EEO79764.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229695087|gb|EEO85134.1| DNA polymerase III/DNA elongation factor III, tau and gamma
           subunits [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|262362925|gb|ACY59646.1| DNA polymerase III subunits gamma and tau [Yersinia pestis D106004]
 gi|262366846|gb|ACY63403.1| DNA polymerase III subunits gamma and tau [Yersinia pestis D182038]
 gi|270338052|gb|EFA48829.1| DNA polymerase III, subunit gamma and tau [Yersinia pestis KIM D27]
 gi|294355320|gb|ADE65661.1| DNA polymerase III subunits gamma and tau [Yersinia pestis Z176003]
 gi|320016308|gb|ADV99879.1| Holliday junction DNA helicase RuvB [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 658

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +CQ I +G  VD++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +     K+L  
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLEKVLLA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  D  A+ ++ARA+DGS RD LSL DQA++    ++ T +V  ML   D  + + + 
Sbjct: 194 EQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTVTVSQMLGTLDDEQPLAII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L+  D   V+ +       GV+   +L +     H +  ++ +P M D   +  A   
Sbjct: 254 EALVSADGARVMAQIEQAASRGVDWENLLVESLSLLHKIAMVQLLPSMLDN--HYAAIEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    +  ++Q +L G  E+         VEM L+R
Sbjct: 312 RLRELARTLPPADIQLYYQTLLVGRKELAYAPDRRMGVEMTLLR 355


>gi|56414361|ref|YP_151436.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363281|ref|YP_002142918.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|56128618|gb|AAV78124.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|197094758|emb|CAR60291.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
          Length = 642

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMSLINEAAARGIEWEGLLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|261491572|ref|ZP_05988155.1| DNA polymerase III subunits gamma and tau [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261494932|ref|ZP_05991401.1| DNA polymerase III subunits gamma and tau [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261309341|gb|EEY10575.1| DNA polymerase III subunits gamma and tau [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261312698|gb|EEY13818.1| DNA polymerase III subunits gamma and tau [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 685

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 135/369 (36%), Positives = 217/369 (58%), Gaps = 22/369 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N+ +  R+  +Y+ SGTRG+GKT+ AR+ A+ LN     ++  T E  
Sbjct: 18  VVGQQHVLSALENSLREDRLHHAYLFSGTRGVGKTSIARLFAKGLNC----VNGITAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   +C+AI  G+ +D++E+DAAS T ++D RE++D + YKP   RF+VY++DEV MLS 
Sbjct: 74  GECANCKAIEEGHFIDLIEIDAASRTKVEDTRELLDNVQYKPTVGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP +VKF+ ATT+ +K+PIT+LSRC +F L  +    +      IL  
Sbjct: 134 HSFNALLKTLEEPPEYVKFLLATTDPQKLPITILSRCMQFHLRALEQSQIARHLEFILNA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+I F+P A+  +A+A+ GS RD LSL DQAIA  N  I  + V  ML L D N+ ++L 
Sbjct: 194 ENIPFEPLALEKLAKAAQGSIRDSLSLTDQAIAMSNANITLAIVSQMLGLIDDNQPLELV 253

Query: 241 GYLIKGD---IINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYI--PEMADTLLYS 295
             + + D    + ++++ +++   GV+   +L D+AE  H +  ++ +  P   +TL++ 
Sbjct: 254 QAIAQADGEKAMAIIEQIAAK---GVDWQQLLSDVAEVLHKIAMLQLVKTPTTEETLVHF 310

Query: 296 EAENARALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPE 355
                     +K++    +  F+Q+IL    E+         VEM ++R A A      E
Sbjct: 311 ---------LAKQIPPEDVQFFYQLILNSKKELPFAPEQRAGVEMAILR-ALAFHPKQAE 360

Query: 356 EIARYIVEE 364
           +IA   VE+
Sbjct: 361 KIATVAVEK 369


>gi|238919040|ref|YP_002932554.1| DNA polymerase III subunit tau, putative [Edwardsiella ictaluri
           93-146]
 gi|238868608|gb|ACR68319.1| DNA polymerase III subunit tau, putative [Edwardsiella ictaluri
           93-146]
          Length = 652

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 127/344 (36%), Positives = 196/344 (56%), Gaps = 6/344 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLLEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPPPHVKF+ ATT+ +K+P+T+LSRC +F L  +    +     KI   
Sbjct: 134 HSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLRALDHEQIRAQLEKIAHA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E++  +P A+ ++ARA++GS RD LSL+DQAIA    +I   +V  ML   D  + + L 
Sbjct: 194 EALTAEPRALQLLARAAEGSMRDALSLMDQAIAMGQGQITADTVSQMLGTLDDEQPLALI 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D   V+         GV+   +L ++    H V  ++ +P   D+     A   
Sbjct: 254 EALTAADGALVMARVEQAAGRGVDWENLLVEMLALLHRVAMLQLLPSALDSQFA--AVEP 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR 344
           R  + ++ +    L  F+Q+IL G  E+          EM L+R
Sbjct: 312 RLRELARMLPPADLQLFYQIILNGRKELAFAPDRRMGAEMTLLR 355


>gi|238911386|ref|ZP_04655223.1| DNA polymerase III subunits gamma and tau [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
          Length = 642

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ +++RA+DGS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  +   V+   +     G+    +L ++    H +  ++  P    + + +  +  
Sbjct: 254 EAVVDANGERVMLLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGSDMAAIEQRM 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE 355
           R L  ++ V    L  ++Q +L G  E+         VEM L+R LA   ++P PE
Sbjct: 314 REL--ARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFHPRMPLPE 367


>gi|238899119|ref|YP_002924801.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466879|gb|ACQ68653.1| DNA polymerase III, tau and gamma subunits; DNA elongation factor
           III [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 640

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 204/353 (57%), Gaps = 19/353 (5%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N+   GRI  +Y+LSGTRG+GKT+ AR+IA+ LN  +     P     
Sbjct: 18  VVGQEHVLTALVNSLSLGRIHHAYLLSGTRGVGKTSIARLIAKGLNCTSGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G   HCQ I +G+ +D++E+DAAS T ++D RE++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GKCIHCQGIEQGHFIDLIEIDAASRTKVEDTRELLDNLPYSPTQGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATTE +K+P+T++SRC +F L  ++   ++    KIL  
Sbjct: 134 HSFNALLKTLEEPPSHVKFLLATTEPKKLPVTIISRCLQFHLKALNALVILNQLEKILAA 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ D EA+ ++A+A+ GS RD LSL DQA+A  + K+ T  VR ML + D  + + + 
Sbjct: 194 EKIDSDTEALKLLAKAASGSMRDALSLTDQAVAIGSGKVTTQIVREMLTILDDGQSLSII 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L K D   ++ E       G +   +L ++    H +   + +PE +    Y+E E  
Sbjct: 254 EALAKADAEKIMFEIEQTAAVGKDWENLLIEMLNLFHRIAIKQLLPETSYK-EYNEVEPE 312

Query: 301 RALQYSKEVSITFLSR---------FWQMILKGISEIEGFSRPMEAVEMVLIR 344
                  E+ ++ L+R         ++Q +L G  E+         VEM L+R
Sbjct: 313 HI-----ELGLSKLARTLAPEKIQFYYQTLLIGRKELPYAPNHRMGVEMTLLR 360


>gi|258404639|ref|YP_003197381.1| DNA polymerase III, subunits gamma and tau [Desulfohalobium
           retbaense DSM 5692]
 gi|257796866|gb|ACV67803.1| DNA polymerase III, subunits gamma and tau [Desulfohalobium
           retbaense DSM 5692]
          Length = 538

 Score =  238 bits (608), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 129/325 (39%), Positives = 191/325 (58%), Gaps = 5/325 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQK +   L+ A    ++A +Y+ SGTRG+GKTT ARI+A+++N +      P  +  
Sbjct: 18  VVGQKQVRTILSRAAAENQVAPAYLFSGTRGVGKTTVARILAKAINCEQGPASEPCNQCR 77

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
               HC+ I +G  VDVVE+D ASHT +D VR++ + + Y P+S R++V I+DE  MLS 
Sbjct: 78  ----HCREITQGTGVDVVEIDGASHTGVDHVRKLKEDVGYAPLSCRYKVIIIDEAHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           AAFN LLKTLEEPPP   FI ATTE  + P T++SRCQ     R+   +L +   ++L+ 
Sbjct: 134 AAFNALLKTLEEPPPQAIFIMATTEPHRFPATIISRCQHHIFQRLRQEELTDHLRRVLEN 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E+IE D EAV +IAR   GS RD +SLL Q +A    ++ ++ VR +L LA +  ++ LF
Sbjct: 194 EAIEMDAEAVRLIARKGAGSVRDAMSLLAQVLALGQRRLESAHVREVLGLAGQETLLSLF 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             L   D I +     S  D G++ +  L +L      +  +K   E A +LL    E A
Sbjct: 254 EALRDQDCIAINTVLRSVLDQGLDLAFFLRELTATWRNLFLLKQSGEGALSLLDLPQEEA 313

Query: 301 RA-LQYSKEVSITFLSRFWQMILKG 324
           R  LQ+++  S + +   WQM L+G
Sbjct: 314 REWLQWAEAFSASHIHACWQMTLEG 338


>gi|296314215|ref|ZP_06864156.1| DNA polymerase III, subunit gamma and tau [Neisseria polysaccharea
           ATCC 43768]
 gi|296839114|gb|EFH23052.1| DNA polymerase III, subunit gamma and tau [Neisseria polysaccharea
           ATCC 43768]
          Length = 727

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 199/345 (57%), Gaps = 7/345 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++K L NA   GR+  +Y+L+GTRG+GKTT ARI+A+SLN + A    P     
Sbjct: 18  LVGQEHVVKALQNALDEGRLHHAYLLTGTRGVGKTTIARILAKSLNCENAQHGEPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  E C  I  G +VD++E+DAAS+T ID++RE+++   Y P + +++VYI+DEV MLS 
Sbjct: 74  GVCESCTQIDAGRYVDLLEIDAASNTGIDNIREVLENAQYAPTAGKYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN +LKTLEEPP HVKFI ATT+  K+P+TVLSRC +F L  ++   + +    +L  
Sbjct: 134 SAFNAMLKTLEEPPEHVKFILATTDPHKVPVTVLSRCLQFVLRNMTSQQVADHLAHVLDS 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I ++P A+ ++ RA+ GS RD LSLLDQAIA  +  +    VR M+   D+  + +L 
Sbjct: 194 EKIAYEPPALQLLGRAAAGSMRDALSLLDQAIAMGSGSVAEQDVRQMIGAVDKQYLYELL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D   +L +        V     L +LA     +  I+ +P     L + + +  
Sbjct: 254 TGIVNQDGEALLVKAQEMAACAVGFDNALGELAMLLQHLALIQAVP---SALAHDDPDRG 310

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRL 345
             L  S+ +S   +  ++Q  ++G  ++           M L+R+
Sbjct: 311 VLLPLSQALSGEQIQLYYQCAIRGKQDLSLAPDEYAGFVMTLLRM 355


>gi|194437483|ref|ZP_03069580.1| DNA polymerase III, tau subunit [Escherichia coli 101-1]
 gi|194423652|gb|EDX39642.1| DNA polymerase III, tau subunit [Escherichia coli 101-1]
 gi|323972324|gb|EGB67534.1| DNA polymerase III [Escherichia coli TA007]
          Length = 643

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 129/361 (35%), Positives = 209/361 (57%), Gaps = 8/361 (2%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA++GS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLV 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             +++ +   V+   +     G+    +L ++    H +  ++  P      +   A   
Sbjct: 254 EAMVEANGERVMALINEAAARGIEWEALLVEMLSLLHRIAMVQLSPAALGNDMA--AIEL 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIR-LAHAVQLPSPE-EIA 358
           R  + ++ +  T +  ++Q +L G  E+         VEM L+R LA   ++P PE E+ 
Sbjct: 312 RMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVP 371

Query: 359 R 359
           R
Sbjct: 372 R 372


>gi|170767813|ref|ZP_02902266.1| DNA polymerase III, tau and gamma subunit [Escherichia albertii
           TW07627]
 gi|170123301|gb|EDS92232.1| DNA polymerase III, tau and gamma subunit [Escherichia albertii
           TW07627]
          Length = 640

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 206/356 (57%), Gaps = 7/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++  L N    GRI  +Y+ SGTRG+GKT+ AR++A+ LN +T     P     
Sbjct: 18  VVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPC---- 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G  ++C+ I +G  VD++E+DAAS T ++D R+++D + Y P   RF+VY++DEV MLS 
Sbjct: 74  GVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSR 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            +FN LLKTLEEPP HVKF+ ATT+ +K+P+T+LSRC +F L  + +  +      IL E
Sbjct: 134 HSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNE 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  +P A+ ++ARA++GS RD LSL DQAIA  + ++ T +V  ML   D ++ + L 
Sbjct: 194 EHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDD