RPSBLAST alignment for GI: peg_472 and conserved domain: TIGR02397

>gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis. Length = 355
 Score =  401 bits (1034), Expect = e-112
 Identities = 152/346 (43%), Positives = 216/346 (62%), Gaps = 6/346 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           +IGQ+ +++TL NA K+GRIA +Y+ SG RG GKT+ ARI A++LN      + P  E  
Sbjct: 16  VIGQEHIVQTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALN----CQNGPDGEPC 71

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
              E C+ I  G+ +DV+E+DAAS+  +DD+REI+D + Y P S +++VYI+DEV MLS 
Sbjct: 72  NECESCKEINSGSSLDVIEIDAASNNGVDDIREILDNVKYAPSSGKYKVYIIDEVHMLSK 131

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
           +AFN LLKTLEEPP HV FI ATTE  KIP T+LSRCQRFD  RI + D++E   KIL +
Sbjct: 132 SAFNALLKTLEEPPEHVVFILATTEPHKIPATILSRCQRFDFKRIPLEDIVERLKKILDK 191

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I+ + EA+ +IARA+DGS RD LSLLDQ I+  N  I    V  +L L D  ++++L 
Sbjct: 192 EGIKIEDEALELIARAADGSLRDALSLLDQLISFGNGNITYEDVNELLGLVDDEKLIELL 251

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++  D    L+      +SGV+P   L DL E    +  IK  P     +L SE E  
Sbjct: 252 EAILNKDTAEALKILDEILESGVDPEKFLEDLIEILRDLLLIKKTPSNLLAVLESEQEFL 311

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLA 346
           + L  + ++S+ FL R   ++L+ + ++   + P   +EM L+RL 
Sbjct: 312 KEL--ALKLSLEFLLRLLDILLEALKDLRFSNDPRIWLEMTLLRLL 355