RPSBLAST alignment for GI: peg_472 and conserved domain: COG2812

>gnl|CDD|32641 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]. Length = 515
 Score =  353 bits (906), Expect = 5e-98
 Identities = 153/356 (42%), Positives = 220/356 (61%), Gaps = 5/356 (1%)

Query: 1   MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFE 60
           ++GQ+ ++KTL+NA ++GRIA +Y+ SG RG+GKTT ARI+A++LN +      PT E  
Sbjct: 18  VVGQEHVVKTLSNALENGRIAHAYLFSGPRGVGKTTIARILAKALNCENG----PTAEPC 73

Query: 61  GFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLST 120
           G    C+ I  G+ +DV+E+DAAS+T +DD+REII+++ Y P   R++VYI+DEV MLS 
Sbjct: 74  GKCISCKEINEGSLIDVIEIDAASNTGVDDIREIIEKVNYAPSEGRYKVYIIDEVHMLSK 133

Query: 121 AAFNGLLKTLEEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLIELFTKILQE 180
            AFN LLKTLEEPP HVKFI ATTE +KIP T+LSRCQRFD  R+ + ++ +    IL +
Sbjct: 134 QAFNALLKTLEEPPSHVKFILATTEPQKIPNTILSRCQRFDFKRLDLEEIAKHLAAILDK 193

Query: 181 ESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCNDKIVTSSVRLMLALADRNRIMDLF 240
           E I  + +A+++IARA++GS RD LSLLDQAIA    +I   SVR ML L D  +++ L 
Sbjct: 194 EGINIEEDALSLIARAAEGSLRDALSLLDQAIAFGEGEITLESVRDMLGLTDIEKLLSLL 253

Query: 241 GYLIKGDIINVLQEFSSQYDSGVNPSVILHDLAEFTHLVTRIKYIPEMADTLLYSEAENA 300
             ++KGD    L+  +   + G +P   L DL  F   +   K        L  +E E  
Sbjct: 254 EAILKGDAKEALRLINELIEEGKDPEAFLEDLLNFLRDLLLFKQTVPNELQLNTTEIEER 313

Query: 301 RALQYSKEVSITFLSRFWQMILKGISEIEGFSRPMEAVEMVLIRLAHAVQLPSPEE 356
                + ++S+  L R +Q++L G+ E++    P   +EM LIRL  A        
Sbjct: 314 TKEL-ASQISVLNLQRLYQLLLPGLKELKRSLSPRLGLEMTLIRLLEAAPASDAAS 368