RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.473_1 (165 letters) >d1hf8a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Score = 28.1 bits (63), Expect = 0.36 Identities = 7/37 (18%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Query: 78 KMVEMLQRFLHVV-SFELGRLEVSFLKEIPEDFIENL 113 + + FL V + R ++ L + P ++ L Sbjct: 93 TRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDAL 129 >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Score = 27.8 bits (61), Expect = 0.55 Identities = 9/63 (14%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Query: 65 KQLIELCEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGED 124 +++++ + +M + + L + + I E NL+ LK D Sbjct: 351 QEVLDYLTNSASLQMKSPAITA--TLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVD 408 Query: 125 WEI 127 + Sbjct: 409 GQE 411 >d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 665 Score = 27.0 bits (59), Expect = 0.84 Identities = 9/43 (20%), Positives = 17/43 (39%) Query: 22 AIGENALPRNISSDECFPLAEAGITEKQDVLNRLSACTPDNYT 64 A G N L ++S ++ E I + + V + + T Sbjct: 6 AAGRNVLRWDLSPEQIKTRTEQLIAQTKQVYDTVGTIALKEVT 48 >d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Length = 165 Score = 26.1 bits (57), Expect = 1.6 Identities = 6/25 (24%), Positives = 10/25 (40%) Query: 64 TKQLIELCEKNHDYKMVEMLQRFLH 88 L+E + DY LQ ++ Sbjct: 101 INTLVEHMLTHKDYSTFNFLQWYVS 125 >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Score = 25.4 bits (55), Expect = 2.5 Identities = 6/30 (20%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Query: 55 LSACTPDNYTKQLIELCEKNH---DYKMVE 81 +++ TP Y +L + + + YK + Sbjct: 1 MASDTPGFYMDKLNKYRQMHGVAITYKELS 30 >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Score = 25.4 bits (55), Expect = 2.5 Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Query: 47 EKQDVLNRLSA-CTPDNYTKQLIELCEKNH---DYKMVEMLQRFLHVVSFE 93 E+ D+ L T +N +L + +K +YK ++ H SF Sbjct: 11 EEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPD--HNRSFI 59 >d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Length = 164 Score = 25.3 bits (55), Expect = 3.0 Identities = 6/24 (25%), Positives = 12/24 (50%) Query: 65 KQLIELCEKNHDYKMVEMLQRFLH 88 ++EL + D+ V L+ F+ Sbjct: 104 YNILELASEEKDHATVSFLKWFVD 127 >d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Length = 169 Score = 24.7 bits (53), Expect = 3.8 Identities = 6/33 (18%), Positives = 14/33 (42%) Query: 66 QLIELCEKNHDYKMVEMLQRFLHVVSFELGRLE 98 Q +++C++ D + +R + L E Sbjct: 105 QFLKVCKEQGDIVTARLFERIIEEEQAHLTYYE 137 >d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Score = 24.6 bits (53), Expect = 3.9 Identities = 4/23 (17%), Positives = 7/23 (30%) Query: 62 NYTKQLIELCEKNHDYKMVEMLQ 84 L L D + + L+ Sbjct: 107 QALLDLHALGSARADPHLCDFLE 129 >d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Length = 158 Score = 24.6 bits (53), Expect = 4.2 Identities = 6/22 (27%), Positives = 10/22 (45%) Query: 66 QLIELCEKNHDYKMVEMLQRFL 87 + I + HDY +M+ L Sbjct: 103 EAIGYADSVHDYVSRDMMIEIL 124 >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Score = 24.5 bits (52), Expect = 4.6 Identities = 9/74 (12%), Positives = 22/74 (29%) Query: 71 CEKNHDYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKLKNWTGEDWEIRFS 130 ++ +++E+ + L + E KL WT +D Sbjct: 211 YIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKMAEDE 270 Query: 131 LGRCCEYFEIDSDI 144 + F+++ Sbjct: 271 VEVYIPQFKLEEHY 284 >d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Length = 161 Score = 24.5 bits (53), Expect = 4.9 Identities = 6/24 (25%), Positives = 9/24 (37%) Query: 65 KQLIELCEKNHDYKMVEMLQRFLH 88 +L N DY LQ ++ Sbjct: 101 NELAHAAMTNQDYPTFNFLQWYVS 124 >d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 162 Score = 24.5 bits (53), Expect = 5.0 Identities = 5/24 (20%), Positives = 12/24 (50%) Query: 65 KQLIELCEKNHDYKMVEMLQRFLH 88 +L+E+ + D+ LQ ++ Sbjct: 102 HELVEMAMQEKDFATYNFLQWYVA 125 >d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Length = 382 Score = 24.2 bits (52), Expect = 5.6 Identities = 14/60 (23%), Positives = 22/60 (36%), Gaps = 11/60 (18%) Query: 78 KMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATKL-----------KNWTGEDWE 126 + E L+++L V E +EI + F E +L +NW E W Sbjct: 17 ALEESLKKYLESVKPFANEDEYKKTEEIVQKFQEGAGKRLHQKLLERARGKRNWLEEWWL 76 >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Score = 24.3 bits (52), Expect = 6.3 Identities = 3/33 (9%), Positives = 11/33 (33%), Gaps = 3/33 (9%) Query: 52 LNRLSACTPDNYTKQLIELCEKN---HDYKMVE 81 + + + ++L +K Y+ + Sbjct: 4 MEMAGDLSAGFFMEELNTYRQKQGVVLKYQELP 36 >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 333 Score = 24.0 bits (50), Expect = 7.3 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Query: 93 ELGRLEVS-FLKEIPEDFIE 111 EL R E S FL E+P+D + Sbjct: 313 ELVRPEPSRFLLELPQDDLI 332 >d1kxpd3 a.126.1.1 (D:405-473) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Score = 23.7 bits (51), Expect = 7.5 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 37 CFPLAEAGITEKQDVLN-RLSACTPDNYTKQLIELCEKNHDY 77 C +E TE + L RL A PD K+L +L K D+ Sbjct: 3 CADYSENTFTEYKKKLAERLKAKLPDATPKELAKLVNKRSDF 44 >g1qhh.1 c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 623 Score = 23.8 bits (50), Expect = 7.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Query: 101 FLKEIPEDFIEN 112 FL EIP +E Sbjct: 609 FLNEIPAHLLET 620 >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 333 Score = 23.9 bits (50), Expect = 8.1 Identities = 6/11 (54%), Positives = 7/11 (63%) Query: 101 FLKEIPEDFIE 111 FL EIP +E Sbjct: 319 FLNEIPAHLLE 329 >d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Score = 23.7 bits (51), Expect = 9.5 Identities = 13/62 (20%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Query: 58 CTPDNYTKQLIELCEKNH-DYKMVEMLQRFLHVVSFELGRLEVSFLKEIPEDFIENLATK 116 P+ L LCE+ Y V Q E+ V+ + E + ++ L K Sbjct: 51 VKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEK 110 Query: 117 LK 118 + Sbjct: 111 VN 112 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0443 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 640,547 Number of extensions: 28533 Number of successful extensions: 90 Number of sequences better than 10.0: 1 Number of HSP's gapped: 90 Number of HSP's successfully gapped: 30 Length of query: 165 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 86 Effective length of database: 1,322,926 Effective search space: 113771636 Effective search space used: 113771636 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.4 bits)