HHsearch alignment for GI: peg_477 and conserved domain: PRK00187

>PRK00187 multidrug efflux protein NorA; Provisional.
Probab=99.88  E-value=3.8e-19  Score=113.15  Aligned_cols=225  Identities=11%  Similarity=0.066  Sum_probs=158.1

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             26779988996297899999999999999999999999999988999999970789888998777778999999999996
Q 537021.9.peg.4    3 ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFL   82 (235)
Q Consensus         3 allP~lS~~~~~~~~~~~~~~l~~~l~~~~~i~iP~~~gl~~l~~piv~~lf~~G~f~~~~~~~~~~~L~~~~~~l~~~~   82 (235)
T Consensus        68 g~~~lvaq~~Ga~~~~~~~~~~~~~l~~~~~~~~~~~~~~~-~~~~il~~-~g---~~~~~~~~a~~Yl~i~~~~~~~~~  142 (462)
T PRK00187         68 AVGTLVAIRHGAGDIEGATRLAQSGLWLAWLLALVAALLLW-NLEPLLLL-FG---QAPQNVDAAMQFLHLLPFALPGYL  142 (462)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHH-HC---CCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999977999898999999999999999999999999-99999998-69---899999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCHHHHHHHHHHHHHHHHHHHHHHHHC------
Q ss_conf             55344577877665433457889999888643245531------012102313102799999999999999711------
Q 537021.9.peg.4   83 LSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP------FIGGYGIATAEVSWVWVNTICLAVALLKRR------  150 (235)
Q Consensus        83 l~~il~~~~ya~~~~~~p~~~~~i~~iini~l~~~li~------~~g~~G~a~at~is~~v~~~il~~~l~k~~------  150 (235)
T Consensus       143 ~~~~~~~~l~~~g~~~~~~~~~~~~~v~Ni~Ln~~lI~g~~g~p~lGv~Gaa~at~~~~~~~~~~l~~~~~~~~~~~~~~  222 (462)
T PRK00187        143 SFMALRGFTSALGRAGPVMVISLAGAVANLALNYALIEGWFGLPKLGLMGIGLVTALVSNCMALALALYIRRHPAYAAYP  222 (462)
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99999999986799716999999999999999988861445655321689889999999999999999999905523011


Q ss_pred             ----CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHH-----CCCCCHHHHHHHHHHHHHHHHHH-HHHHHHHH
Q ss_conf             ----366668899999999999999999999999986---432-----02210599999999999999999-99999999
Q 537021.9.peg.4  151 ----QIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL---FNQ-----LSAETAFSPFKNLAIILSGAVLV-YLCSISLL  217 (235)
Q Consensus       151 ----~~~~~~~~~~~~~k~~~as~im~~~~~~~~~~~---~~~-----~~~~~~~~~~~~l~~~~~~~~~~-y~~~~~~~  217 (235)
T Consensus       223 ~~~~~~~~~~~~~~~il~ig~P~~~~~~~~~~~~~~~~~~~~~lG~~alAA~~i~~~i~~l~~~~~~gi~~A~~~~vG~~  302 (462)
T PRK00187        223 LRKGLSRPSRAALRELWRLGLPIGGTYAVEVGLFTFAALCMGALGSTQLAAHQIALQAVSVAFMVPVGLSYAVTMRVGQH  302 (462)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             03312457799999999998679999999999999999999856809999999999999999999999999999999998


Q ss_pred             HHHHHHHHHHHHHCC
Q ss_conf             866768999997305
Q 537021.9.peg.4  218 LGKGFLASLKYSLKT  232 (235)
Q Consensus       218 ~~~~~~~~l~~~~r~  232 (235)
T Consensus       303 lGa~~~~~a~~~~~~  317 (462)
T PRK00187        303 YGAGRLLEARRAGRV  317 (462)
T ss_pred             HCCCCHHHHHHHHHH
T ss_conf             768999999999999