HHsearch alignment for GI: peg_477 and conserved domain: pfam03023

>pfam03023 MVIN MviN-like protein. Deletion of the mviN virulence gene in Salmonella enterica serovar. Typhimurium greatly reduces virulence in a mouse model of typhoid-like disease. Open reading frames encoding homologues of MviN have since been identified in a variety of bacteria, including pathogens and non-pathogens and plant-symbionts. In the nitrogen-fixing symbiont Rhizobium tropici, mviN is required for motility. The MviM protein is predicted to be membrane-associated.
Probab=99.67  E-value=4.6e-13  Score=82.90  Aligned_cols=182  Identities=18%  Similarity=0.146  Sum_probs=142.8

Q ss_pred             CHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02677998899629789999999999999999999999999998899999997078988899877777899999999999
Q 537021.9.peg.4    2 AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGF   81 (235)
Q Consensus         2 ~allP~lS~~~~~~~~~~~~~~l~~~l~~~~~i~iP~~~gl~~l~~piv~~lf~~G~f~~~~~~~~~~~L~~~~~~l~~~   81 (235)
T Consensus        35 ~afIP~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~fap~lv~l~a-~-Gf~~~~~~la~~l~ri~~p~i~f~  111 (452)
T pfam03023        35 SAFVPVFAELK-QADKDEAAEFVRRVSTLLIGVLLLVTLLGILAAPWVIRLLA-P-GFDAETFSLTVSLLRITFPYLLLV  111 (452)
T ss_pred             HHHHHHHHHHH-HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-C-CCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999998-53969999999999999999999999999999999999985-8-875468999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCHHHHHHHHHHHHHHHHHHHHHHHHCC-----CC
Q ss_conf             655344577877665433457889999888643245531012---1023131027999999999999997113-----66
Q 537021.9.peg.4   82 LLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG---GYGIATAEVSWVWVNTICLAVALLKRRQ-----ID  153 (235)
Q Consensus        82 ~l~~il~~~~ya~~~~~~p~~~~~i~~iini~l~~~li~~~g---~~G~a~at~is~~v~~~il~~~l~k~~~-----~~  153 (235)
T Consensus       112 ~l~a~~~~~Lna~~~F~~~a~~pi~~N~~~I~~ll~~~~~~g~~~i~~la~g~~~G~~~q~l~~~~~l~k~g~~~~~~~~  191 (452)
T pfam03023       112 SLSAVFGAVLNARKKFFAPAFSPVLLNIGVILTLLFLANYFGREPIYGLAIGVLIGGVLQLLVQLPFLRKAGLLLKPRFN  191 (452)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             99999999998838855578758989999999999999855618999999999999999999999999982996455435


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             6688999999999999999999999999864320
Q 537021.9.peg.4  154 LPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQL  187 (235)
Q Consensus       154 ~~~~~~~~~~k~~~as~im~~~~~~~~~~~~~~~  187 (235)
T Consensus       192 ~~~~~lk~~~~l~~P~~l~~~-~~qin~lvd~~~  224 (452)
T pfam03023       192 FRDKGVKRFLALALPTLLGVS-VSQLNLLIDTAL  224 (452)
T ss_pred             CCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHH
T ss_conf             454368899999999999999-999999999999