HHsearch results for GI: peg_477 and protein with PDBid: 3mkt_A

>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A
Probab=99.44  E-value=2.6e-13  Score=83.07  Aligned_cols=143  Identities=13%  Similarity=0.059  Sum_probs=122.8

Q ss_pred             CHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             02677998899629789999999999999999999999999998899999997078988899877777899999999999
Q 537021.9.peg.4    2 AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGF   81 (235)
Q Consensus         2 ~allP~lS~~~~~~~~~~~~~~l~~~l~~~~~i~iP~~~gl~~l~~piv~~lf~~G~f~~~~~~~~~~~L~~~~~~l~~~   81 (235)
                      .+.-|.++++..+||.++.++....+++.....+++.+..+..+++++.. +|..   |++........+.+++++.++.
T Consensus       295 ~a~~~~vg~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~-~f~~---d~~~~~~~~~~l~~~~l~~~~~  370 (460)
T 3mkt_A          295 AAVSIRVGHKLGEQDTKGAAIAANVGLMTGLATACITALLTVLFREQIAL-LYTE---NQVVVALAMQLLLFAAIYQCMD  370 (460)
T ss_dssp             HHHHHHHHHHHHSSCCCTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-CSSC---CSTTHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCC---CHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999987277689999999999984489999999999999999986-2689---8999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHH-------HHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             655344577877665433457889999-88864324553-------10121023131027999999999999997
Q 537021.9.peg.4   82 LLSRVLLSEFYARNDVKTPAKFYILSI-VMGFVIAIGLF-------PFIGGYGIATAEVSWVWVNTICLAVALLK  148 (235)
Q Consensus        82 ~l~~il~~~~ya~~~~~~p~~~~~i~~-iini~l~~~li-------~~~g~~G~a~at~is~~v~~~il~~~l~k  148 (235)
                      +.+.++...+++.+|++.|+..++++. ++.+.+.+++-       +.+|..|.-++..++..+..+++.+.+++
T Consensus       371 ~~~~~~~~~l~g~g~~~~~~~~~~~~~~~i~ip~~~~l~~~~~~~~~~~G~~Giw~~~~~~~~~~~~~~~~~l~~  445 (460)
T 3mkt_A          371 AVQVVAAGSLRGYKDMTAIFHRTFISYWVLGLPTGYILGMTNWLTEQPLGAKGFWLGFIIGLSAAALMLGQRLYW  445 (460)
T ss_dssp             HHHHHHHHHHGGGSTHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSCCSSHHHHHHHHHHHHHHHHHHHHHSSSSS
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999998674899999999999999999999999998523524469999999999999999999999999