BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.477_1
         (235 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780793|ref|YP_003065206.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040470|gb|ACT57266.1| integral membrane protein MviN [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 518

 Score =  277 bits (709), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 145/232 (62%), Positives = 181/232 (78%), Gaps = 2/232 (0%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           M  +LP LS +++ +NKQ+S EL+N+AIE + FFGIP    L ML KEI+QTLYERGAF+
Sbjct: 287 MIVILPALSRSLRSKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFS 346

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           +Q+TILVSS+LSIYS  I+  +LS+ L + FYA+ND+K P KF I+SI +   IAIG FP
Sbjct: 347 SQNTILVSSFLSIYSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFP 406

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           FIGGYGIA AEVS  WVNTICLA+ LLKR+QI+LPF+TIYRILS+ IS+GLMG FI+ F+
Sbjct: 407 FIGGYGIALAEVSSSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFR 466

Query: 181 PCLFNQL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           P  FNQ  SA T F PFKNL I+LSGA+LVYL SI L LGK FL+ L+  ++
Sbjct: 467 P-YFNQFSSATTFFDPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIR 517


>gi|315122015|ref|YP_004062504.1| integral membrane protein MviN [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495417|gb|ADR52016.1| integral membrane protein MviN [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 519

 Score =  216 bits (549), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 128/229 (55%), Positives = 167/229 (72%), Gaps = 1/229 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS A++ ++K  +  L+N+AIE VLF  IP   IL +L KEIIQTLYERGAFT ++
Sbjct: 290 VLPELSRALKSKDKSTTFTLQNQAIECVLFLSIPAFIILYILSKEIIQTLYERGAFTHEN 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           TI VSS +SIYS  I+ F+LS+ L + FYAR ++KTP  F ++SI +  VI+I  FPFIG
Sbjct: 350 TIFVSSIISIYSIGIIAFILSKTLQTIFYARKNMKTPMHFTLISIAVSCVISIVSFPFIG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
           GYGIA AEV+  WVN I L V LL+R+Q+ LP +TIYRILSIFISSGLMG FI+  KP  
Sbjct: 410 GYGIACAEVASGWVNAILLTVTLLRRKQLFLPMETIYRILSIFISSGLMGAFIILSKPYF 469

Query: 184 FNQLSAETAF-SPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           F+ ++ E  F S F +L  ILS AVLVYL SI+L +GK +++S K  +K
Sbjct: 470 FSNIAIEQTFVSQFTSLFAILSCAVLVYLSSIALFIGKKYVSSFKKMMK 518


>gi|116250173|ref|YP_766011.1| transmembrane mviN virulence factor homologue [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115254821|emb|CAK05895.1| putative transmembrane mviN virulence factor homologue [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 526

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 129/227 (56%), Gaps = 2/227 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  N +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T 
Sbjct: 292 PELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTA 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFP++G  
Sbjct: 352 VVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFN 185
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IVF K     
Sbjct: 412 GIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVMGAAIVFLKQYWAP 471

Query: 186 QL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L S     +    L ++++ A+L+Y  + + L+G   L+ ++ +L 
Sbjct: 472 SLASGAPLLTKIGTLGLLIAIAMLIYFAA-AFLVGGANLSMIRRNLN 517


>gi|241202798|ref|YP_002973894.1| integral membrane protein MviN [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856688|gb|ACS54355.1| integral membrane protein MviN [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 526

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 128/227 (56%), Gaps = 2/227 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  N +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T 
Sbjct: 292 PELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTA 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFP++G  
Sbjct: 352 VVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFN 185
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IVF K     
Sbjct: 412 GIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVMGAAIVFLKQYWAP 471

Query: 186 QL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L S     +    L ++++ A+L+Y  + + L+G   L  ++ +L 
Sbjct: 472 SLASGAPLLTKIGTLGLLIAIAMLIYFAA-AFLVGGANLGMIRRNLN 517


>gi|209547641|ref|YP_002279558.1| integral membrane protein MviN [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533397|gb|ACI53332.1| integral membrane protein MviN [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 528

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 129/227 (56%), Gaps = 2/227 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  N +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T 
Sbjct: 292 PELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTA 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V + L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFPF+G  
Sbjct: 352 VVGAILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAVAVATNCATALTLFPFMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFN 185
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IVF K     
Sbjct: 412 GIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRTALLIVAAAVMGAAIVFLKQYFAP 471

Query: 186 QLSAETA-FSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L++     +    L ++++ ++LVY  + + L+G   L  ++ +L 
Sbjct: 472 WLASSAPLLTKIGTLGLLIAISMLVYFAA-AFLIGGADLGMIRRNLN 517


>gi|327188579|gb|EGE55789.1| virulence factor transmembrane protein [Rhizobium etli CNPAF512]
          Length = 526

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 129/227 (56%), Gaps = 2/227 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  + +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T+
Sbjct: 292 PELARALKAGHLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTL 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFP++G  
Sbjct: 352 VVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFN 185
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IVF K     
Sbjct: 412 GIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRAALLIVAAAVMGAAIVFLKQYFAP 471

Query: 186 QL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L S     +    L ++++ ++LVY  + + L+G   L  ++ +L 
Sbjct: 472 WLASGAPLLTKIGTLGLLIAISMLVYFAA-AFLIGGANLGMIRRNLN 517


>gi|218516517|ref|ZP_03513357.1| virulence factor transmembrane protein [Rhizobium etli 8C-3]
          Length = 294

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 130/230 (56%), Gaps = 8/230 (3%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  + +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T+
Sbjct: 60  PELARALKAGHLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTL 119

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFP++G  
Sbjct: 120 VVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAP 179

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV----FFKP 181
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IV    +F P
Sbjct: 180 GIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRAALLIVAAAVMGAAIVVLKQYFAP 239

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L    S     +    L ++++ ++LVY  + + L+G   L  ++ +L 
Sbjct: 240 WL---ASGAPLLTKIGTLGLLIAISMLVYFAA-AFLIGGANLGMIRRNLN 285


>gi|190890056|ref|YP_001976598.1| virulence factor transmembrane protein [Rhizobium etli CIAT 652]
 gi|190695335|gb|ACE89420.1| virulence factor transmembrane protein [Rhizobium etli CIAT 652]
          Length = 526

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 130/230 (56%), Gaps = 8/230 (3%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++  + +++  L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T+
Sbjct: 292 PELARALKAGHLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTL 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++      A+ LFP++G  
Sbjct: 352 VVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV----FFKP 181
           GIA AE +  W++T+ L   LL+R  +   +    R   + +++ +MG  IV    +F P
Sbjct: 412 GIAVAEATAGWISTVLLFTTLLRRGHLTWEWALAKRAALLIVAAAVMGAAIVVLKQYFAP 471

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L    S     +    L ++++ ++LVY  + + L+G   L  ++ +L 
Sbjct: 472 WL---ASGAPLLTKIGTLGLLIAISMLVYFAA-AFLIGGANLGMIRRNLN 517


>gi|163842414|ref|YP_001626818.1| integral membrane protein MviN [Brucella suis ATCC 23445]
 gi|163673137|gb|ABY37248.1| integral membrane protein MviN [Brucella suis ATCC 23445]
          Length = 529

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 135/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P    LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAVALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|23501055|ref|NP_697182.1| virulence factor MviN [Brucella suis 1330]
 gi|161618132|ref|YP_001592019.1| integral membrane protein MviN [Brucella canis ATCC 23365]
 gi|254705321|ref|ZP_05167149.1| integral membrane protein MviN [Brucella suis bv. 3 str. 686]
 gi|260567218|ref|ZP_05837688.1| integral membrane protein MviN [Brucella suis bv. 4 str. 40]
 gi|261756033|ref|ZP_05999742.1| integral membrane protein MviN [Brucella suis bv. 3 str. 686]
 gi|23346921|gb|AAN29097.1| virulence factor MviN [Brucella suis 1330]
 gi|161334943|gb|ABX61248.1| integral membrane protein MviN [Brucella canis ATCC 23365]
 gi|260156736|gb|EEW91816.1| integral membrane protein MviN [Brucella suis bv. 4 str. 40]
 gi|261745786|gb|EEY33712.1| integral membrane protein MviN [Brucella suis bv. 3 str. 686]
          Length = 529

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 135/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P    LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAVALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|86356043|ref|YP_467935.1| virulence factor transmembrane protein [Rhizobium etli CFN 42]
 gi|86280145|gb|ABC89208.1| virulence factor transmembrane protein [Rhizobium etli CFN 42]
          Length = 526

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/227 (33%), Positives = 128/227 (56%), Gaps = 2/227 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++    ++++ L+NR+IE+VLF  IP    L +L  EII+ LYERGAF  ++T 
Sbjct: 292 PELARALKGGALREAANLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTA 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V + L+IY   +  F+L + L   FYAR D KTP +F  +++    V A+ LFPF+G  
Sbjct: 352 VVGTILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVGTNCVTALTLFPFMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFN 185
           GIA AE +  W++T+ L   LL+R  +   +    R   + ++S +MG  I F K     
Sbjct: 412 GIAVAEATAGWISTLLLFTTLLRRGHLTWEWALAKRAALLIVASAVMGAAIFFLKHYWAP 471

Query: 186 QL-SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L S     +    L ++++ A+L+Y  + + L+G   L  ++ +L 
Sbjct: 472 WLASGAPLLTKVGTLGLLIAIAMLIYFAA-AFLIGGANLGMIRRNLN 517


>gi|222084683|ref|YP_002543212.1| integral membrane protein MviN [Agrobacterium radiobacter K84]
 gi|221722131|gb|ACM25287.1| integral membrane protein MviN [Agrobacterium radiobacter K84]
          Length = 533

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 132/230 (57%), Gaps = 8/230 (3%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ +++  + +++  L+NR+IE+VLF  +P    L +L  +II+ LYER AF  ++T+
Sbjct: 292 PELARSLKSGHLKEAGNLQNRSIEFVLFLTLPAAMALWVLSDDIIRVLYERRAFHQENTL 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V S L+IY   +  F+L + L   FYAR D KTP +F  +++     IA+ LFP++G  
Sbjct: 352 IVGSILAIYGLGLPAFVLIKALQPGFYAREDTKTPMRFSGVAVATNCAIALSLFPYMGAP 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF----FKP 181
           GIA AE +  W++T+ L   LL+R  +   +    R   + +S+G+M   +V+    ++P
Sbjct: 412 GIAVAEATAGWISTVLLFTTLLRRGHLTWEWALARRAALLLVSAGVMTAMVVYLQHRWEP 471

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            L    S  T       L +++  ++LVY  +++ L+G   +  ++ ++K
Sbjct: 472 YLATGASLLTKVG---TLGLLIGISMLVYF-AVAFLIGGADIGMIRRNVK 517


>gi|7387908|sp|O05467|MVIN_RHITR RecName: Full=Virulence factor mviN homolog
 gi|1932722|gb|AAC32291.1| hypothetical protein [Rhizobium tropici CIAT 899]
          Length = 533

 Score =  121 bits (304), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 132/235 (56%), Gaps = 8/235 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ +++  + ++++ ++NR+IE+VLF  +P    L +L  +II+ LYERGAF A +
Sbjct: 290 LLPELARSLKSGHIKEAANIQNRSIEFVLFLTLPAAVALWLLSDDIIRVLYERGAFNANN 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T LV S L+I+   +  F+L + L   FYAR D K+P ++  +++ +   ++I LFP + 
Sbjct: 350 TTLVGSILAIFGLGLPAFVLIKALQPGFYAREDTKSPMRYTAIAVAVNSALSILLFPVLA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF----F 179
             GIA AE    W+N + L V L +R  +   +    R   + +SS +MG  IV+    +
Sbjct: 410 ERGIALAEAVAGWLNAVQLFVTLYRRGHLVWEWSLARRTAMLLVSSAVMGGVIVYLSHRW 469

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
           +P L    S  T  +    L +++  A+ VY   ++ L+G   +  ++ +LK  +
Sbjct: 470 EPLLG---SGSTLLTKTGVLGLLILIAMAVYFI-VAFLIGGVDVGMIRRNLKRKR 520


>gi|222147342|ref|YP_002548299.1| integral membrane protein MviN [Agrobacterium vitis S4]
 gi|221734332|gb|ACM35295.1| integral membrane protein MviN [Agrobacterium vitis S4]
          Length = 532

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 98/149 (65%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+ A++ ++++++S ++NR+IE+VLF  +P    L +L  +II+ LYERGAFTA +T 
Sbjct: 292 PELARALKSDHQREASTIQNRSIEFVLFLTLPAAVGLWVLSDDIIRVLYERGAFTAHNTA 351

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V++ L+ Y   + GF++ + L   FYAR D KTP +F  +S+V+   +AI LFP +   
Sbjct: 352 IVAAILAYYGLGLPGFVMIKALQPGFYAREDTKTPMRFTGISVVVNSALAISLFPLLQER 411

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDL 154
           GIA AE +   +NT+ L   L++R  + +
Sbjct: 412 GIAIAEATAGAINTVLLFTMLVRRGHLQV 440


>gi|319405377|emb|CBI78996.1| MviN protein [Bartonella sp. AR 15-3]
          Length = 520

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 125/229 (54%), Gaps = 2/229 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +    S EL+NRAIE+ LF  +P +   L++   II  L+ERG FT+  
Sbjct: 290 LLPELTKALRNKKNIDSDELQNRAIEFSLFLTLPASVAFLLISNPIISLLFERGQFTSDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  + +Y   +  F+L +V +  F+AR D KTP  F  + + +   +A+ LF F+ 
Sbjct: 350 TNSVAQLVQLYGIGLPAFVLIKVFIPNFFAREDTKTPMVFAGVCVFINISLALTLFSFLS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVN + L   LLKR       Q I R+ S+ I+S  M + + +     
Sbjct: 410 ARGIVIAEITAGWVNILLLCSTLLKRGYWKYDAQLIKRMASLIIASFFMALTLYYSISFF 469

Query: 184 FNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              LS++T+F    + LA +L  +  VY   I LL G  +L+ L+ ++K
Sbjct: 470 SGPLSSQTSFFLRASILAGLLITSTSVYFI-ICLLFGTNYLSLLRKNVK 517


>gi|294851543|ref|ZP_06792216.1| integral membrane protein MviN [Brucella sp. NVSL 07-0026]
 gi|294820132|gb|EFG37131.1| integral membrane protein MviN [Brucella sp. NVSL 07-0026]
          Length = 529

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+I+  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVIVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|319406950|emb|CBI80587.1| MviN protein [Bartonella sp. 1-1C]
          Length = 520

 Score =  115 bits (287), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 121/232 (52%), Gaps = 8/232 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+  ++ +    S EL+NRAIE+ LF   P +   L++   II  L+ERG FT+  
Sbjct: 290 LLPELTKTLRNKKHTDSDELQNRAIEFSLFLTFPASVAFLLISNPIISLLFERGQFTSAS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  + +Y   +  F+L +V +  F+AR D KTP  F  + + +   +A+ LF  + 
Sbjct: 350 TNNVAQLVQLYGIGLPAFVLIKVFIPNFFAREDTKTPMIFAGICVFINISLALTLFSCLS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVN + L   LLKR       Q I RI S+ I+S  M + + +     
Sbjct: 410 ARGIVIAEITAGWVNILLLCSTLLKRGYWKYDTQLIKRIASLIIASFFMALTLYYSISFF 469

Query: 184 FNQLSAETAF----SPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              LS++T+F    S    L II   A  VY   I LL G  +L+ L+ ++K
Sbjct: 470 SAPLSSQTSFFLRASSLAGLLII---ATSVYFI-ICLLFGTNYLSFLRKNVK 517


>gi|254707165|ref|ZP_05168993.1| integral membrane protein MviN [Brucella pinnipedialis M163/99/10]
 gi|254709292|ref|ZP_05171103.1| integral membrane protein MviN [Brucella pinnipedialis B2/94]
 gi|256030815|ref|ZP_05444429.1| integral membrane protein MviN [Brucella pinnipedialis M292/94/1]
 gi|261314641|ref|ZP_05953838.1| integral membrane protein MviN [Brucella pinnipedialis M163/99/10]
 gi|261316801|ref|ZP_05955998.1| integral membrane protein MviN [Brucella pinnipedialis B2/94]
 gi|265987871|ref|ZP_06100428.1| integral membrane protein MviN [Brucella pinnipedialis M292/94/1]
 gi|261296024|gb|EEX99520.1| integral membrane protein MviN [Brucella pinnipedialis B2/94]
 gi|261303667|gb|EEY07164.1| integral membrane protein MviN [Brucella pinnipedialis M163/99/10]
 gi|264660068|gb|EEZ30329.1| integral membrane protein MviN [Brucella pinnipedialis M292/94/1]
          Length = 529

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|225851678|ref|YP_002731911.1| integral membrane protein MviN [Brucella melitensis ATCC 23457]
 gi|256264812|ref|ZP_05467344.1| integral membrane protein MviN [Brucella melitensis bv. 2 str.
           63/9]
 gi|225640043|gb|ACN99956.1| integral membrane protein MviN [Brucella melitensis ATCC 23457]
 gi|263095222|gb|EEZ18891.1| integral membrane protein MviN [Brucella melitensis bv. 2 str.
           63/9]
          Length = 529

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|256045934|ref|ZP_05448806.1| integral membrane protein MviN [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260563216|ref|ZP_05833702.1| integral membrane protein MviN [Brucella melitensis bv. 1 str. 16M]
 gi|265992345|ref|ZP_06104902.1| integral membrane protein MviN [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260153232|gb|EEW88324.1| integral membrane protein MviN [Brucella melitensis bv. 1 str. 16M]
 gi|263003411|gb|EEZ15704.1| integral membrane protein MviN [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 529

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|306842569|ref|ZP_07475220.1| integral membrane protein MviN [Brucella sp. BO2]
 gi|306287425|gb|EFM58905.1| integral membrane protein MviN [Brucella sp. BO2]
          Length = 529

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFAYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|254718360|ref|ZP_05180171.1| integral membrane protein MviN [Brucella sp. 83/13]
 gi|265983321|ref|ZP_06096056.1| integral membrane protein MviN [Brucella sp. 83/13]
 gi|306839591|ref|ZP_07472395.1| integral membrane protein MviN [Brucella sp. NF 2653]
 gi|264661913|gb|EEZ32174.1| integral membrane protein MviN [Brucella sp. 83/13]
 gi|306405289|gb|EFM61564.1| integral membrane protein MviN [Brucella sp. NF 2653]
          Length = 529

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|254694937|ref|ZP_05156765.1| integral membrane protein MviN [Brucella abortus bv. 3 str. Tulya]
 gi|261215275|ref|ZP_05929556.1| integral membrane protein MviN [Brucella abortus bv. 3 str. Tulya]
 gi|260916882|gb|EEX83743.1| integral membrane protein MviN [Brucella abortus bv. 3 str. Tulya]
          Length = 529

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|62289121|ref|YP_220914.1| virulence factor MviN [Brucella abortus bv. 1 str. 9-941]
 gi|82699060|ref|YP_413634.1| virulence factor MVIN-like [Brucella melitensis biovar Abortus
           2308]
 gi|254690447|ref|ZP_05153701.1| integral membrane protein MviN [Brucella abortus bv. 6 str. 870]
 gi|254696567|ref|ZP_05158395.1| integral membrane protein MviN [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700952|ref|ZP_05162780.1| integral membrane protein MviN [Brucella suis bv. 5 str. 513]
 gi|254713285|ref|ZP_05175096.1| integral membrane protein MviN [Brucella ceti M644/93/1]
 gi|254716362|ref|ZP_05178173.1| integral membrane protein MviN [Brucella ceti M13/05/1]
 gi|254731480|ref|ZP_05190058.1| integral membrane protein MviN [Brucella abortus bv. 4 str. 292]
 gi|256158840|ref|ZP_05456697.1| integral membrane protein MviN [Brucella ceti M490/95/1]
 gi|256254221|ref|ZP_05459757.1| integral membrane protein MviN [Brucella ceti B1/94]
 gi|256258703|ref|ZP_05464239.1| integral membrane protein MviN [Brucella abortus bv. 9 str. C68]
 gi|256368607|ref|YP_003106113.1| virulence factor MviN [Brucella microti CCM 4915]
 gi|260169719|ref|ZP_05756530.1| integral membrane protein MviN [Brucella sp. F5/99]
 gi|260546418|ref|ZP_05822158.1| integral membrane protein MviN [Brucella abortus NCTC 8038]
 gi|260755999|ref|ZP_05868347.1| integral membrane protein MviN [Brucella abortus bv. 6 str. 870]
 gi|260759223|ref|ZP_05871571.1| integral membrane protein MviN [Brucella abortus bv. 4 str. 292]
 gi|260760945|ref|ZP_05873288.1| integral membrane protein MviN [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885019|ref|ZP_05896633.1| integral membrane protein MviN [Brucella abortus bv. 9 str. C68]
 gi|261218145|ref|ZP_05932426.1| integral membrane protein MviN [Brucella ceti M13/05/1]
 gi|261221371|ref|ZP_05935652.1| integral membrane protein MviN [Brucella ceti B1/94]
 gi|261321008|ref|ZP_05960205.1| integral membrane protein MviN [Brucella ceti M644/93/1]
 gi|261751471|ref|ZP_05995180.1| integral membrane protein MviN [Brucella suis bv. 5 str. 513]
 gi|261759258|ref|ZP_06002967.1| integral membrane protein MviN [Brucella sp. F5/99]
 gi|265997331|ref|ZP_06109888.1| integral membrane protein MviN [Brucella ceti M490/95/1]
 gi|297247537|ref|ZP_06931255.1| integral membrane protein MviN [Brucella abortus bv. 5 str. B3196]
 gi|306844412|ref|ZP_07477002.1| integral membrane protein MviN [Brucella sp. BO1]
 gi|62195253|gb|AAX73553.1| MviN, virulence factor [Brucella abortus bv. 1 str. 9-941]
 gi|82615161|emb|CAJ10098.1| Virulence factor MVIN-like [Brucella melitensis biovar Abortus
           2308]
 gi|255998765|gb|ACU47164.1| virulence factor MviN [Brucella microti CCM 4915]
 gi|260096525|gb|EEW80401.1| integral membrane protein MviN [Brucella abortus NCTC 8038]
 gi|260669541|gb|EEX56481.1| integral membrane protein MviN [Brucella abortus bv. 4 str. 292]
 gi|260671377|gb|EEX58198.1| integral membrane protein MviN [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676107|gb|EEX62928.1| integral membrane protein MviN [Brucella abortus bv. 6 str. 870]
 gi|260874547|gb|EEX81616.1| integral membrane protein MviN [Brucella abortus bv. 9 str. C68]
 gi|260919955|gb|EEX86608.1| integral membrane protein MviN [Brucella ceti B1/94]
 gi|260923234|gb|EEX89802.1| integral membrane protein MviN [Brucella ceti M13/05/1]
 gi|261293698|gb|EEX97194.1| integral membrane protein MviN [Brucella ceti M644/93/1]
 gi|261739242|gb|EEY27238.1| integral membrane protein MviN [Brucella sp. F5/99]
 gi|261741224|gb|EEY29150.1| integral membrane protein MviN [Brucella suis bv. 5 str. 513]
 gi|262551799|gb|EEZ07789.1| integral membrane protein MviN [Brucella ceti M490/95/1]
 gi|297174706|gb|EFH34053.1| integral membrane protein MviN [Brucella abortus bv. 5 str. B3196]
 gi|306275225|gb|EFM56975.1| integral membrane protein MviN [Brucella sp. BO1]
          Length = 529

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|256112647|ref|ZP_05453568.1| integral membrane protein MviN [Brucella melitensis bv. 3 str.
           Ether]
 gi|265994088|ref|ZP_06106645.1| integral membrane protein MviN [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765069|gb|EEZ10990.1| integral membrane protein MviN [Brucella melitensis bv. 3 str.
           Ether]
          Length = 529

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 467

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 468 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|326408164|gb|ADZ65229.1| integral membrane protein MviN [Brucella melitensis M28]
          Length = 527

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 288 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 348 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 407

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 408 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 465

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 466 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 519


>gi|17988088|ref|NP_540722.1| virulence factor MVIN [Brucella melitensis bv. 1 str. 16M]
 gi|17983839|gb|AAL52986.1| virulence factor mvin [Brucella melitensis bv. 1 str. 16M]
          Length = 555

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 316 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 375

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 376 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 435

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 436 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 493

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 494 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 547


>gi|256060285|ref|ZP_05450458.1| integral membrane protein MviN [Brucella neotomae 5K33]
 gi|261324257|ref|ZP_05963454.1| integral membrane protein MviN [Brucella neotomae 5K33]
 gi|261300237|gb|EEY03734.1| integral membrane protein MviN [Brucella neotomae 5K33]
          Length = 529

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 137/239 (57%), Gaps = 14/239 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M     F   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIM----AFGIH 463

Query: 182 CLFNQLSAE-TAFSPFK----NLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
           C     + E ++ +P       +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 464 CAIGHFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 521


>gi|189023396|ref|YP_001934164.1| Virulence factor MVIN-like protein [Brucella abortus S19]
 gi|189018968|gb|ACD71690.1| Virulence factor MVIN-like protein [Brucella abortus S19]
          Length = 527

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 288 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 348 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 407

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 408 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 465

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 466 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 519


>gi|148560056|ref|YP_001258177.1| integral membrane protein MviN [Brucella ovis ATCC 25840]
 gi|225626683|ref|ZP_03784722.1| integral membrane protein MviN [Brucella ceti str. Cudo]
 gi|237814612|ref|ZP_04593610.1| integral membrane protein MviN [Brucella abortus str. 2308 A]
 gi|148371313|gb|ABQ61292.1| integral membrane protein MviN [Brucella ovis ATCC 25840]
 gi|225618340|gb|EEH15383.1| integral membrane protein MviN [Brucella ceti str. Cudo]
 gi|237789449|gb|EEP63659.1| integral membrane protein MviN [Brucella abortus str. 2308 A]
          Length = 555

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 136/235 (57%), Gaps = 6/235 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 316 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 375

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 376 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 435

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + I++G+M   I +   
Sbjct: 436 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLIAAGIMAFGIHYAIG 493

Query: 182 CLFNQLSAETAFSPFKN-LAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +LS+    +     +A+++  A++VY  +++  LG      ++ +LK   G
Sbjct: 494 HFTYELSSAAPLAARAGTVAVMVITAMIVYF-ALAFGLGGANTGMIRRNLKRGGG 547


>gi|319403936|emb|CBI77524.1| MviN protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 520

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 119/234 (50%), Gaps = 8/234 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +    S EL+NRAIE+ LF   P +   L++   II  L+ERG FT+  
Sbjct: 290 LLPELTKALRNKKHTDSDELQNRAIEFSLFLTFPASVAFLLISNPIISLLFERGQFTSAS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  + +Y   +  F+L +V +  F+AR D KTP  F  + + +   +A+ LF  + 
Sbjct: 350 TNNVAQLVQLYGIGLPAFVLIKVFIPNFFAREDTKTPMIFAGICVFINISLALTLFSCLS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMF----IVFF 179
             GI  AE++  WVN + L   LLKR       Q I RI S+ I+S  M +     I FF
Sbjct: 410 ARGIVIAEITAGWVNILLLCGTLLKRGYWKYDAQLIKRIASLIIASFFMALTLYYSISFF 469

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTD 233
              L  Q S     S    L II   A  VY   I LL G  +L+ L+ ++K  
Sbjct: 470 SAPLSPQASFFLRASSLAGLLII---ATSVYFI-ICLLFGTNYLSFLRKNVKQH 519


>gi|240850977|ref|YP_002972377.1| virulence factor MviN [Bartonella grahamii as4aup]
 gi|240268100|gb|ACS51688.1| virulence factor MviN [Bartonella grahamii as4aup]
          Length = 523

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 118/229 (51%), Gaps = 6/229 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +  +++  L+NR+IE  L   +P +   L+L   I+  L+ERG FT+Q 
Sbjct: 290 LLPELTRALRSKKHKETHHLQNRSIELTLLLTLPASIAFLLLSTPIVSLLFERGQFTSQS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L +Y   +  F+L +V +  F+A  D KTP  F  + + +   +A+ LFP + 
Sbjct: 350 THHVAQLLELYGLGLPAFVLIKVFIPNFFAHEDTKTPMIFTGICVFINISLALTLFPILS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVN + L   L+KR      FQ I +IL + I++ L+    +++   +
Sbjct: 410 ARGIVIAEITSGWVNALLLWGVLIKRGYWKYDFQLIKQILCLMIAT-LLSTLALYYGLNM 468

Query: 184 FNQL-----SAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLK 227
           F  L     S  + F     LA I+ G  L+Y  +  L     F   LK
Sbjct: 469 FGFLSFPLSSQASFFLRASTLAGIMLGIFLIYFSAYFLFNTHSFFHMLK 517


>gi|49474593|ref|YP_032635.1| virulence factor mviN-like protein [Bartonella quintana str.
           Toulouse]
 gi|49240097|emb|CAF26536.1| Virulence factor mviN homolog [Bartonella quintana str. Toulouse]
          Length = 523

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 96/166 (57%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +N +++ +L+NR+IE  L   +P +   L+L   I+  L+ERG FT++ 
Sbjct: 290 LLPELTRALRSKNHKETHDLQNRSIELTLLLTLPASVAFLLLSHPIVSLLFERGQFTSES 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L +Y   +  F+L +V +  F+A  D KTP  F  + + +   +A+ LFP + 
Sbjct: 350 THHVAQLLGLYGIGLPAFVLIKVFIPNFFAHEDTKTPMIFTGICVFINISLALILFPILS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
             GI  AE++  WVNT+ L   L+KR       Q I R+L + I++
Sbjct: 410 ARGIVIAEITSGWVNTLLLWGVLIKRGYWKYDTQLIKRMLCLIITT 455


>gi|239830993|ref|ZP_04679322.1| integral membrane protein MviN [Ochrobactrum intermedium LMG 3301]
 gi|239823260|gb|EEQ94828.1| integral membrane protein MviN [Ochrobactrum intermedium LMG 3301]
          Length = 529

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 114/188 (60%), Gaps = 4/188 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+ +   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVAVNVSLAISLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLMGMFIVFFKP 181
             GIATAE+   WVN + L   L+KR     D+P  T  RI  + +++ +M + I F   
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKRGHWGQDIPLLT--RIPRLLVAAAIMAVGIHFAIG 467

Query: 182 CLFNQLSA 189
              ++LS+
Sbjct: 468 YFAHELSS 475


>gi|13474439|ref|NP_106007.1| virulence factor MviN-like protein [Mesorhizobium loti MAFF303099]
 gi|14025192|dbj|BAB51793.1| virulence factor MviN-like protein [Mesorhizobium loti MAFF303099]
          Length = 526

 Score =  108 bits (270), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 117/215 (54%), Gaps = 3/215 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA-Q 62
           LLP+LS A++  N  +++ L+NR++E+ LF  +P  A L ++ + I++ +YERGAF A  
Sbjct: 290 LLPELSRALKSGNLIEAANLQNRSVEFTLFMTLPAAAALWVMAEPIVRLVYERGAFAANH 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T  V++ L+I+   +  F+L +     ++AR D +TP  F  +S+ +    A+ LFP +
Sbjct: 350 STPTVAAILAIFGLGLPAFVLIKAFTPGYFAREDTRTPMIFAAISVAVNVATALTLFPRM 409

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  GIA A     WVN + L   L++R         + RI  + +S+ +M + + F +  
Sbjct: 410 GAPGIAVASAVAGWVNALMLLAVLIRRGHWGRDVPLLKRIPRLVLSAAVMAVALYFAEHW 469

Query: 183 LFNQLSAETAF--SPFKNLAIILSGAVLVYLCSIS 215
           L  +L   +         LA++ SGA+L ++ + +
Sbjct: 470 LAVRLGPGSPLVVKATTLLALVASGALLYFVTAFA 504


>gi|153007501|ref|YP_001368716.1| integral membrane protein MviN [Ochrobactrum anthropi ATCC 49188]
 gi|151559389|gb|ABS12887.1| integral membrane protein MviN [Ochrobactrum anthropi ATCC 49188]
          Length = 529

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 106/171 (61%), Gaps = 4/171 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+ +   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVAVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQTIYRILSIFISSGLM 172
             GIATAE+   WVN I L   L+KR     D+P  T  RI  + I++ +M
Sbjct: 410 PTGIATAEIVAGWVNAILLFAMLVKRGHWGRDIPLLT--RIPRLLIAAAIM 458


>gi|163868793|ref|YP_001610017.1| MviN protein [Bartonella tribocorum CIP 105476]
 gi|161018464|emb|CAK02022.1| MviN protein [Bartonella tribocorum CIP 105476]
          Length = 523

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 119/229 (51%), Gaps = 6/229 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +  +++  L+NR+IE  L   +P +   L+L   I+  L+ERG FT+Q 
Sbjct: 290 LLPELTRALRSKKHEETHHLQNRSIELTLLLTLPASIAFLLLSTPIVSLLFERGQFTSQS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L +Y   +  F+L +V +  F+A  D K P     + + +   +A+ LFP + 
Sbjct: 350 TQHVAQLLELYGLGLPAFVLIKVFIPNFFAHEDTKAPMIVTGICVFINVSLALTLFPILS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVNT+ L   L+KR       Q I +IL + I+S L+    +++   +
Sbjct: 410 ARGIVIAEITSGWVNTLLLWGILIKRGYWKYDLQLIKQILCLTIAS-LLSALTLYYGLNV 468

Query: 184 FNQLS-----AETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLK 227
           F  LS       + F     LA I+ G  L+YL +  L   + F  +LK
Sbjct: 469 FRFLSFPLSTQASFFLRASTLAGIILGIFLIYLSAYFLFNTRSFFHTLK 517


>gi|304393802|ref|ZP_07375727.1| integral membrane protein MviN [Ahrensia sp. R2A130]
 gi|303294001|gb|EFL88376.1| integral membrane protein MviN [Ahrensia sp. R2A130]
          Length = 542

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 100/180 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  +  ++ +L+NR++E+ L   +P     +++P  I+  LYERGAF A  
Sbjct: 312 LLPELSRALKSGDAAEAQKLQNRSLEFALALTLPAAVGFIVIPDAIVSLLYERGAFDATA 371

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L+ +++ +  ++  +V    F+AR D+KTP +  +L +V+    ++ +FP +G
Sbjct: 372 TRNTAMALAAFASGLPAYVAIKVFQPVFFAREDMKTPFRLSVLMVVVNIAASLLMFPILG 431

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     WVN I LA    +R +      T+ R+  +  S+ +MGM + F +  L
Sbjct: 432 HVGIALATSISAWVNVIGLATIAWRRGEFRPTATTLRRLAGLLASAAIMGMLLWFLRDWL 491


>gi|319898612|ref|YP_004158705.1| MviN protein [Bartonella clarridgeiae 73]
 gi|319402576|emb|CBI76121.1| MviN protein [Bartonella clarridgeiae 73]
          Length = 520

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 125/229 (54%), Gaps = 2/229 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +    S+EL+NRAIE+ LF  +P +   L++   II  L+ERG FT+  
Sbjct: 290 LLPELTKALRNKKHGDSNELQNRAIEFSLFLTLPASVAFLLISNPIISLLFERGQFTSGS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  + +Y   +  F+L +V +  F+AR D KTP  F  + + +   +++ LF  + 
Sbjct: 350 TNSVAQLVQLYGIGLPAFVLIKVFIPNFFAREDTKTPMIFAGICVFINISLSLILFSLLS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  W+N + L   LLKR       Q I RI+S+ I+S  M + + +     
Sbjct: 410 AQGIVIAEITAGWLNILLLCSVLLKRGYWKYDAQLIKRIISLMIASFFMALTLYYSISFF 469

Query: 184 FNQLSAETAFS-PFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              LS++T+F      LA ++  A  VY   I LL G  +L+ L+ ++K
Sbjct: 470 SVTLSSQTSFFLRASTLAGLIFVATSVYFI-ICLLFGTNYLSLLRQNVK 517


>gi|163757731|ref|ZP_02164820.1| integral membrane protein MviN [Hoeflea phototrophica DFL-43]
 gi|162285233|gb|EDQ35515.1| integral membrane protein MviN [Hoeflea phototrophica DFL-43]
          Length = 521

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 116/211 (54%), Gaps = 15/211 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++  L+NR++E+ L   +P    L +LP+ II  ++ERGAFT + 
Sbjct: 290 LLPELSRALRAGDAKEAQHLQNRSLEFGLAITVPAAVGLALLPEPIIALVFERGAFTRET 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+L S+ L+ ++  +  F+L+++    FYAR D++TP    ++S+V+    ++ LFP +G
Sbjct: 350 TLLTSTVLAAFALGLPAFVLTKIFTPAFYAREDMRTPLWASVVSVVLNIAGSLILFPRLG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     WV+ + L   L+         QT+ RI  I +++ LMG  + +     
Sbjct: 410 VTGIAIATSFAGWVSVLFLGQRLVSGGLFRPSGQTVKRIGLILVAAALMGSLLWW----- 464

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
                 E +F  F     +L G +LV L S+
Sbjct: 465 -----VEASFPQF-----LLEGTLLVRLVSV 485


>gi|326537876|gb|ADZ86091.1| integral membrane protein MviN [Brucella melitensis M5-90]
          Length = 471

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 95/146 (65%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  + +++S L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+   
Sbjct: 290 LLPELSRALRGGHMKEASNLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPDS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++VS+ L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +AI LFP  G
Sbjct: 350 TLVVSNILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAITLFPHFG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             GIATAE+   WVN + L   L+KR
Sbjct: 410 PTGIATAEIVAGWVNAVLLFATLVKR 435


>gi|260462739|ref|ZP_05810944.1| integral membrane protein MviN [Mesorhizobium opportunistum
           WSM2075]
 gi|259031383|gb|EEW32654.1| integral membrane protein MviN [Mesorhizobium opportunistum
           WSM2075]
          Length = 532

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 114/215 (53%), Gaps = 8/215 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA-Q 62
           LLP+LS A++  N  +++ L+NR++E+ LF  +P  A L ++ + I++ +YERGAF A  
Sbjct: 290 LLPELSRALKSGNLIEAANLQNRSVEFTLFMTLPAAAALWVMSEPIVRLVYERGAFAANH 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T  V++ L+I+   +  F+L +     ++AR D +TP  F  +S+ +    A+ LFP +
Sbjct: 350 STPTVAAILAIFGLGLPAFVLIKAFTPGYFAREDTRTPMIFAAISVAVNVATALTLFPRM 409

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  GIA A     WVN + L   L++R         + RI  + +S+ +M + + F +  
Sbjct: 410 GAPGIAVASAVAGWVNALMLLGVLIRRGHWGRDVPLLKRIPRLVLSAAVMAVALYFAEHW 469

Query: 183 LFNQLSAETAFSPF----KNLAIILSGAVLVYLCS 213
           L  +L      SP       L  +++G  L+Y  +
Sbjct: 470 LAVRLGPG---SPLVVKATTLLTLVAGGALLYFVT 501


>gi|319409216|emb|CBI82860.1| MviN protein [Bartonella schoenbuchensis R1]
          Length = 520

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 121/229 (52%), Gaps = 2/229 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A + +N ++++ L+N AI + LF  +P + +  ++   I+   +ERG FT+Q 
Sbjct: 290 LLPELTKAFRNKNNKEANYLQNYAIAFTLFLTLPASILFFLISNPIVSLFFERGQFTSQS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L +Y   +  F+L +V +  F+A  D KTP  F  + +++   +A+ LFP + 
Sbjct: 350 THTVAHLLELYGLGLPAFVLIKVFIPNFFAHEDTKTPMIFAGICVLINIGLALTLFPLLS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVNT+ L   L+KR       Q I  +  + ++  LM   + +    L
Sbjct: 410 ARGIVIAEITSGWVNTLLLCSTLIKRGYWKCDMQLIKWVGCLIVAILLMAAALYYALGFL 469

Query: 184 FNQLSAETA-FSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              LS++   F     LA ++  ++L++ C I   LG  +   L+ +LK
Sbjct: 470 SFPLSSQAPLFLRIGTLAGLIF-SILLFYCIICFSLGMSYFPFLRKNLK 517


>gi|319779936|ref|YP_004139412.1| integral membrane protein MviN [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165824|gb|ADV09362.1| integral membrane protein MviN [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 535

 Score =  105 bits (261), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/176 (32%), Positives = 99/176 (56%), Gaps = 1/176 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ- 62
           LLP+LS A++  N  +++ L+NR++E+ LF  +P  A L ++ + I++ +YERGAF A  
Sbjct: 290 LLPELSRALKSGNLIEAANLQNRSVEFTLFLTLPAAAALWVMSEPIVRLVYERGAFAANG 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T  V++ L+I+   +  F+L +     ++AR D +TP  F  +S+ +    A+ LFP +
Sbjct: 350 STPTVAAILAIFGLGLPAFVLIKAFTPGYFAREDTRTPMIFAAISVAVNVTTALTLFPRM 409

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           G  GIA A     WVN + L   L++R         + RI  + +S+ +MG  + F
Sbjct: 410 GAPGIAVASAVAGWVNAVMLLGVLIRRGHWGRDVPLMKRIPRLVLSAIVMGAALYF 465


>gi|154254035|ref|YP_001414859.1| integral membrane protein MviN [Parvibaculum lavamentivorans DS-1]
 gi|154157985|gb|ABS65202.1| integral membrane protein MviN [Parvibaculum lavamentivorans DS-1]
          Length = 512

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 112/213 (52%), Gaps = 1/213 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++   ++  +NRA+E+ +   IP      +L  +II+ L+ERGAFT +D
Sbjct: 285 LLPDLSRRLRADDGAGANWAQNRAVEFSMLLTIPAAVGAAVLSFDIIRVLFERGAFTRED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+  S  L++Y+  +  F+L++V    ++AR D  TP +F  +SIV+  V +  LF ++G
Sbjct: 345 TVATSLALTVYALGLPAFVLNKVFSPAYFAREDTMTPLRFAAISIVVNIVTSFALFWYLG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA       WVNT  LA  L +R++  +  Q   R+    +++  MG  + F    L
Sbjct: 405 FIGIAIGTTLAAWVNTGQLAARLWRRKEFIVDAQLARRLPLTLMAALGMGATLWFGARAL 464

Query: 184 FNQLSAETAFSPFKNLAIILSGAVL-VYLCSIS 215
            +        S     A+I  GA+   +LC I+
Sbjct: 465 GSFFENGLLVSIGALFALIAGGALAYFFLCEIT 497


>gi|227820620|ref|YP_002824590.1| integral membrane protein MviN [Sinorhizobium fredii NGR234]
 gi|227339619|gb|ACP23837.1| integral membrane protein MviN [Sinorhizobium fredii NGR234]
          Length = 535

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 97/157 (61%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS A++  N  +++ L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+ + 
Sbjct: 290 LLPELSRALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGKFSPEA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++V   L+IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +A+ LFP +G
Sbjct: 350 TVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLAVTLFPPLG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQT 158
             GIATAE+   WVN + L   LL R     D+P  T
Sbjct: 410 ASGIATAEIVAGWVNALLLFTTLLWRGHWGRDIPLLT 446


>gi|121601768|ref|YP_989425.1| integral membrane protein MviN [Bartonella bacilliformis KC583]
 gi|120613945|gb|ABM44546.1| integral membrane protein MviN [Bartonella bacilliformis KC583]
          Length = 520

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 106/190 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +N  +++ L+NR+IE  LF  +P + +  ++   I+  L+ERG FT++ 
Sbjct: 290 LLPELTKALRSKNYTEANNLQNRSIELTLFLTLPASVLFFLISTPIVSLLFERGQFTSES 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L++Y   +  F+L ++ +  F+A  D KTP  F  + + +   +A+ LFP   
Sbjct: 350 TDSVAYLLALYGLGLPAFVLIKIFIPSFFAHEDTKTPMIFSGICVFINVSLALILFPLFS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GI  AE++  WVNT+ L  AL+KR       + I  I+ + I+  LM + + +    L
Sbjct: 410 ARGIVIAEITSAWVNTLLLCTALIKRGYWKYDIKLIKWIMRLIIAICLMAVALYYAHEFL 469

Query: 184 FNQLSAETAF 193
              LS+  +F
Sbjct: 470 SVPLSSSASF 479


>gi|49476029|ref|YP_034070.1| virulence factor mvin-like protein [Bartonella henselae str.
           Houston-1]
 gi|49238837|emb|CAF28119.1| Virulence factor mvin homolog [Bartonella henselae str. Houston-1]
 gi|56368463|emb|CAD89514.1| MviN homolog [Bartonella henselae]
          Length = 523

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 91/166 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++ +N +++  L+NR+IE  L   +P +   L+L   I+  L+ERG FT+  
Sbjct: 290 LLPELTRALRSKNHKETHNLQNRSIELTLLLTLPASVAFLILSTPIVSLLFERGQFTSLS 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V+  L +Y   +  F+L ++ +  F+A  D KTP     + + +   +A+ LFP + 
Sbjct: 350 THYVAQLLKLYGLGLPAFVLIKIFIPNFFAHEDTKTPMIITGICVFINISLALILFPILS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
             GI  AE++  W+N + L   L++R       Q I RI  + I++
Sbjct: 410 ARGIVIAEITSGWMNALLLWTILIQRGYWKYDIQLIKRITCLIITT 455


>gi|110636358|ref|YP_676566.1| integral membrane protein MviN [Mesorhizobium sp. BNC1]
 gi|110287342|gb|ABG65401.1| integral membrane protein MviN [Chelativorans sp. BNC1]
          Length = 528

 Score = 98.2 bits (243), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 118/228 (51%), Gaps = 1/228 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS +++  +   +  L+NR++E+ L   +P    L+++P  I+  LYERG FTA D
Sbjct: 290 LLPELSRSLKAGDFADAQHLQNRSLEFALGLTLPAAIGLMVMPAPIVSLLYERGEFTALD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T + ++ L+ +++ +  ++L +V    F+AR D+KTP  F + S++    +++ LFP  G
Sbjct: 350 TQMTAAALAAFASGLPAYVLIKVFQPGFFAREDMKTPMWFSLASVIANIGLSLALFPLYG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
              IA A     W+N + LA  L +R        T  R+  +  +S  MG         L
Sbjct: 410 HVAIALATSLSSWLNVVLLAGTLWRRNDFRPSPVTWRRVAMVIFASAAMGAVAYLLNAVL 469

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              L   +       +  I++ A ++YL ++++L G    A LK +L+
Sbjct: 470 SGPLEQASVLLQGLGVLFIVAIAGVIYL-ALAILTGAIDRAELKSALR 516


>gi|90420549|ref|ZP_01228456.1| putative virulence factor MviN [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335277|gb|EAS49030.1| putative virulence factor MviN [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 541

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 94/170 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  + +++   +NR++E+ LF  +P    L ++P+ II+ +YERGAF    
Sbjct: 303 LLPELARALKAGHLREAQHTQNRSLEFALFLTLPAAVALFIIPEPIIRVIYERGAFDPSV 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T +V+S L +Y+  +  F++ +V    ++AR D KTP K  + S     V+++ LF  I 
Sbjct: 363 TPVVASVLGLYALGLPAFVMIKVFSPGYFAREDTKTPMKATLASAGANIVLSLILFWLIA 422

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             GIA A     W+N   L   L ++ Q  +  + + R   + + S LMG
Sbjct: 423 ERGIALATTLAGWLNAGLLFAGLYRKGQWQIDRELLKRTALVLVCSLLMG 472


>gi|329848204|ref|ZP_08263232.1| integral membrane protein MviN [Asticcacaulis biprosthecum C19]
 gi|328843267|gb|EGF92836.1| integral membrane protein MviN [Asticcacaulis biprosthecum C19]
          Length = 543

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 97/189 (51%), Gaps = 11/189 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS ++Q  +  ++ +  + A+ Y + F +P TA L+ +P  +I  LY RG F   
Sbjct: 305 ALLPALSRSVQSGDHDRAQQTLDDALIYAMVFTLPATAALIAIPHYLIDGLYTRGEFLPH 364

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF--- 119
           D +  ++ L  Y   +  F+L+R+L   FYAR D   P KF ++++ +   + + LF   
Sbjct: 365 DALETAAALLHYGWGVPAFVLTRILSPAFYARKDTYGPMKFALVNVAVNLGVGVALFNGV 424

Query: 120 --------PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGL 171
                   P IG  G+A    +  W N + + + LLKR+   L  ++   ++ I +   +
Sbjct: 425 VIDGVQIIPEIGVPGLAIGTSAGAWANVLLMLLTLLKRKVWHLSGRSASALVKIVLCGAV 484

Query: 172 MGMFIVFFK 180
           MG+ + FF+
Sbjct: 485 MGVALAFFQ 493


>gi|27381027|ref|NP_772556.1| virulence factor [Bradyrhizobium japonicum USDA 110]
 gi|27354193|dbj|BAC51181.1| bll5916 [Bradyrhizobium japonicum USDA 110]
          Length = 509

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 112/227 (49%), Gaps = 8/227 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   + + + RA ++ L F IP  A  L +P EI++ L+ RGAF+  D
Sbjct: 284 LLPEMSRRITANDHDGAMKAQRRAFDFTLLFSIPFVAAFLTVPDEIMRALFARGAFSKAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +   S L+ Y+  ++ F+L R  ++ FYAR D  TP +  +  I +   + + L   + 
Sbjct: 344 AVAAGSTLAAYAIGLIPFVLIRSAVATFYARKDTATPVRASLTGIAVNVALKLALMGSLA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM----GMFIVFF 179
             G+A A    VW N + L +    RR   +  +     L+ F+ +GL+       I  F
Sbjct: 404 QIGLALATAVGVWTN-LLLVLFFAVRRGFLVLDRAWLLSLAKFLLTGLILAAAFWLIARF 462

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASL 226
            P     L++  AF     LA++  G  +VY  +I +L G+ +L SL
Sbjct: 463 SPA---ALASVHAFRDEATLALLAVGGTIVYALAILILFGRKWLMSL 506


>gi|325291781|ref|YP_004277645.1| virulence factor MviN [Agrobacterium sp. H13-3]
 gi|325059634|gb|ADY63325.1| virulence factor MviN [Agrobacterium sp. H13-3]
          Length = 545

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 94/157 (59%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  +  ++  L+NR++E+VLF  +P  A LL++ + I++ LYERG F    
Sbjct: 306 LLPELARALRGGHMVEAGSLQNRSVEFVLFLTLPAAAALLVMAEPIVRFLYERGNFAPSA 365

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+ V+  L IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +A+ LFP  G
Sbjct: 366 TVTVAQILGIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVSLALTLFPRFG 425

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR--QIDLPFQT 158
           G GIA AE++  WVN   L   LL R    +D+P  T
Sbjct: 426 GPGIAIAEITAGWVNAALLFGMLLWRGHWHVDIPLLT 462


>gi|307317966|ref|ZP_07597403.1| integral membrane protein MviN [Sinorhizobium meliloti AK83]
 gi|306896368|gb|EFN27117.1| integral membrane protein MviN [Sinorhizobium meliloti AK83]
          Length = 535

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 95/157 (60%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  N  +++ L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+ + 
Sbjct: 290 LLPELARALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGQFSPES 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++V   L+IY   +  F+L +  +  F+AR D +TP  F  +S+ +   +A+ LFP + 
Sbjct: 350 TVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAGISVAVNVSLALTLFPSLA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQT 158
             GIATAE+   WVN + L   L+ R     D+P  T
Sbjct: 410 ASGIATAEIVAGWVNALLLFATLVWRGHWGRDIPLLT 446


>gi|15964150|ref|NP_384503.1| putative virulence factor MviN-like protein [Sinorhizobium meliloti
           1021]
 gi|307301295|ref|ZP_07581057.1| integral membrane protein MviN [Sinorhizobium meliloti BL225C]
 gi|8473277|sp|P56882|MVIN_RHIME RecName: Full=Virulence factor mviN homolog
 gi|15073326|emb|CAC41834.1| Uncharacterized membrane protein, putative virulence factor
           [Sinorhizobium meliloti 1021]
 gi|306903751|gb|EFN34338.1| integral membrane protein MviN [Sinorhizobium meliloti BL225C]
          Length = 535

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 95/157 (60%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  N  +++ L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+ + 
Sbjct: 290 LLPELARALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGQFSPES 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++V   L+IY   +  F+L +  +  F+AR D +TP  F  +S+ +   +A+ LFP + 
Sbjct: 350 TVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAGISVAVNVSLALTLFPSLA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI--DLPFQT 158
             GIATAE+   WVN + L   L+ R     D+P  T
Sbjct: 410 ASGIATAEIVAGWVNALLLFATLVWRGHWGRDIPLLT 446


>gi|312112931|ref|YP_004010527.1| integral membrane protein MviN [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218060|gb|ADP69428.1| integral membrane protein MviN [Rhodomicrobium vannielii ATCC
           17100]
          Length = 518

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 99/187 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  +   ++  +   +NR++E+ L   +P +  L+++P  IIQ L++RG+FT + 
Sbjct: 290 LLPTLTRHLADADEPAALASQNRSLEFALLLTLPASVALIVIPDPIIQVLFQRGSFTPEA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  VS  L+ Y+  +  F++++V L  F+AR D  TP +F   S+ +    ++ +FP+IG
Sbjct: 350 TRQVSLALAAYAAGLTAFVMTKVFLPGFFAREDTATPMRFVAASVAVNVGGSLLMFPYIG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W N + L + L++R           R   I  +S  MG  + + +P L
Sbjct: 410 HVGIAIATSLSGWTNALLLMITLMRRGHFRFDDALKRRAPRIVAASVAMGGALYWLEPVL 469

Query: 184 FNQLSAE 190
               +A+
Sbjct: 470 DPYFAAD 476


>gi|84499735|ref|ZP_00998023.1| putative virulence factor, MviN [Oceanicola batsensis HTCC2597]
 gi|84392879|gb|EAQ05090.1| putative virulence factor, MviN [Oceanicola batsensis HTCC2597]
          Length = 511

 Score = 95.1 bits (235), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 16/177 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++       NRA E+ LF  +PC   L+++P+ +I TL++RGAFT +D
Sbjct: 286 LLPDLSRRLRAGDEAGGRHGFNRAAEFALFLTLPCAVALVVIPEPLISTLFQRGAFTPED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  +++Y   +  F+L +VL   FYAR D + P ++ ++++ +  V+AIGL PF+G
Sbjct: 346 ARATALAVAVYGLGLPAFVLQKVLQPLFYAREDTRAPFRYALVAMGVNAVLAIGLAPFVG 405

Query: 124 ---------GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGL 171
                      G A   + W     +  AVAL  R +     + I+RI  +  S+GL
Sbjct: 406 YIAAAVATTTAGWAMMVLLWAGSRRMGAAVALDDRLR-----RRIWRI--VLASAGL 455


>gi|221233002|ref|YP_002515438.1| virulence factor MviN [Caulobacter crescentus NA1000]
 gi|220962174|gb|ACL93530.1| virulence factor MviN [Caulobacter crescentus NA1000]
          Length = 520

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 116/237 (48%), Gaps = 5/237 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP+LS A+  E++ ++    ++AI + L   +P    L  +P  +I  L+ RG FT  
Sbjct: 284 ALLPRLSRAVAAEDRAEAQGAMDQAIVFALALTLPAAVALFSIPFFLIDGLFTRGEFTVF 343

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    ++ L  Y      F+L+R+L   F+AR D K P +F ++S+ +   + + LFP +
Sbjct: 344 DARQTANALLHYGWGTPAFVLARILSPAFFARGDTKGPMRFALISVAVNIGLGLALFPVM 403

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQI---DLPFQTIYRILSIFISSGLMGMFIVFF 179
           G  G+A A  +  W+N + +A+ L KR         +  I R+L   ++ GL+   I   
Sbjct: 404 GVPGLAAATSAASWINVLQMALTLRKRGDYAPSAAAWGKIIRVLGASVALGLILAAISRG 463

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGF-LASLKYSLKTDKG 235
           +  L   + A       K LAI+ + A+   L  + LLL  G  LA  +  L+   G
Sbjct: 464 RAALEAPILA-MGIGSAKELAILATCALAAGLYPVLLLLSGGVTLAEARTVLRRGTG 519


>gi|16124320|ref|NP_418884.1| MviN family protein [Caulobacter crescentus CB15]
 gi|13421160|gb|AAK22052.1| MviN family protein [Caulobacter crescentus CB15]
          Length = 550

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 116/237 (48%), Gaps = 5/237 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP+LS A+  E++ ++    ++AI + L   +P    L  +P  +I  L+ RG FT  
Sbjct: 314 ALLPRLSRAVAAEDRAEAQGAMDQAIVFALALTLPAAVALFSIPFFLIDGLFTRGEFTVF 373

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    ++ L  Y      F+L+R+L   F+AR D K P +F ++S+ +   + + LFP +
Sbjct: 374 DARQTANALLHYGWGTPAFVLARILSPAFFARGDTKGPMRFALISVAVNIGLGLALFPVM 433

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQI---DLPFQTIYRILSIFISSGLMGMFIVFF 179
           G  G+A A  +  W+N + +A+ L KR         +  I R+L   ++ GL+   I   
Sbjct: 434 GVPGLAAATSAASWINVLQMALTLRKRGDYAPSAAAWGKIIRVLGASVALGLILAAISRG 493

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGF-LASLKYSLKTDKG 235
           +  L   + A       K LAI+ + A+   L  + LLL  G  LA  +  L+   G
Sbjct: 494 RAALEAPILA-MGIGSAKELAILATCALAAGLYPVLLLLSGGVTLAEARTVLRRGTG 549


>gi|114571562|ref|YP_758242.1| integral membrane protein MviN [Maricaulis maris MCS10]
 gi|114342024|gb|ABI67304.1| integral membrane protein MviN [Maricaulis maris MCS10]
          Length = 514

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 92/176 (52%), Gaps = 3/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+ ++    Q +S   NRA+E  +   +P    L  +P  I   LYER AFT+QD
Sbjct: 286 LLPALSARVRAGETQAASNAMNRALEISMALTLPAATALATIPVFIATGLYERNAFTSQD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF--PF 121
            ++VS  L  ++  +  F+L +VL   F+AR D  TP KF  + + +   + +GLF  P 
Sbjct: 346 AVMVSQALVPFAIGLPAFVLIKVLSPGFFAREDTMTPMKFAAIGVAVNLALGLGLFFGP- 404

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
           +G  G+A A     WVN   LA+ L +R   +   + + ++  I ++   M  F++
Sbjct: 405 LGFAGLAIATAVAGWVNMSLLAITLSRRGLFEPDIRLLGKLPRIVLACAAMAAFLL 460


>gi|150395260|ref|YP_001325727.1| integral membrane protein MviN [Sinorhizobium medicae WSM419]
 gi|150026775|gb|ABR58892.1| integral membrane protein MviN [Sinorhizobium medicae WSM419]
          Length = 535

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 93/159 (58%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  N  +++ L+NR++E+ LF  +P  A LL++ + I++ L+ERG F+ + 
Sbjct: 290 LLPELARALRGGNINEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLFERGQFSPES 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+ V   L+IY   +  F+L +  +  F+AR D +TP  F  +S+ +   +A+ LFP + 
Sbjct: 350 TVAVGRILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAGISVAVNVSLALTLFPVLA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             GIA AE++  WVN + L   L+ R         + RI
Sbjct: 410 ASGIAMAEIAAGWVNALLLFATLVWRGHWGRDIALLTRI 448


>gi|159184270|ref|NP_353379.2| virulence factor MviN [Agrobacterium tumefaciens str. C58]
 gi|159139597|gb|AAK86164.2| virulence factor MviN [Agrobacterium tumefaciens str. C58]
          Length = 529

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 96/157 (61%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A++  +  ++  L+NR++E+VLF  +P  A LL++ + I++ LYERG F+   
Sbjct: 290 LLPELARALRGGHMVEAGSLQNRSVEFVLFLTLPAAAALLVMAEPIVRFLYERGNFSPSA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           TI V+  L IY   +  F+L +  +  F+AR D +TP  F  +S+V+   +A+ LFP +G
Sbjct: 350 TITVAQILGIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAVSVVVNVSLALTLFPRLG 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR--QIDLPFQT 158
           G GIA AE++  WVN   L   LL R    +D+P  T
Sbjct: 410 GPGIAIAEITAGWVNAALLFGMLLWRGHWHVDIPLLT 446


>gi|167643984|ref|YP_001681647.1| integral membrane protein MviN [Caulobacter sp. K31]
 gi|167346414|gb|ABZ69149.1| integral membrane protein MviN [Caulobacter sp. K31]
          Length = 518

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 85/174 (48%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP+LS A+   + Q +    ++AI   +   IP  A L+ +P  +   LY RG FT  
Sbjct: 279 ALLPRLSRAVNTGDGQDAQSAMDQAITLAMALTIPAAAALVAMPGFLSDALYTRGEFTPF 338

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    +S L  Y      F+L ++    F+AR D K+P +F ++S+ +     + LF  I
Sbjct: 339 DASQTASALFFYGLGTPAFVLQQLYSRAFFARGDTKSPMRFALISVAVNVAFGVVLFNLI 398

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
           G  GIA A     W+N   +A  L ++       QT  R+  I  +S +MG+ +
Sbjct: 399 GVKGIAAATALASWLNVGQMAWGLSRKDHYSPSLQTWSRVARILAASLVMGLVL 452


>gi|260428009|ref|ZP_05781988.1| integral membrane protein MviN [Citreicella sp. SE45]
 gi|260422501|gb|EEX15752.1| integral membrane protein MviN [Citreicella sp. SE45]
          Length = 533

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 80/142 (56%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++ + S    +RA E  L   +P    L+++P  ++  L+ERGA  A D
Sbjct: 304 LLPDLSRRLKADDTEGSRHAFSRAGEMALALTVPAAVALMVIPLPMVSVLFERGATKADD 363

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L +VL   F+AR D +TP ++ + S+V+  V+AIGL P +G
Sbjct: 364 SAAIALAVAIYGLGLPAFVLQKVLQPLFFAREDTRTPFRYAVWSMVVNAVLAIGLVPLMG 423

Query: 124 GYGIATAEVSWVWVNTICLAVA 145
               A A  +  WV  + LAV 
Sbjct: 424 WIAPAVATTAAGWVMVVMLAVG 445


>gi|114770138|ref|ZP_01447676.1| putative virulence factor, MviN [alpha proteobacterium HTCC2255]
 gi|114548975|gb|EAU51858.1| putative virulence factor, MviN [alpha proteobacterium HTCC2255]
          Length = 507

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 99/194 (51%), Gaps = 17/194 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS  +  +N        NRA+E+ L   IP    L+++P  +I  L+ERGAFT  D
Sbjct: 281 LLPELSRTLINKNSTDGQNAFNRALEFSLLLTIPSAIALIIIPLSLISVLFERGAFTNTD 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +I  +  L+IY   +  F+L +VL   ++AR D K+P KF ++++++   +AIGL  +IG
Sbjct: 341 SISTAHALAIYGLGLPAFVLQKVLQPLYFAREDTKSPFKFALIAMLLNVGLAIGLSFYIG 400

Query: 124 --GYGIATAEVSWVWV-------NTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGM 174
                I T+  SW  +         +  +  +  R + +LPF        I ISS LMG 
Sbjct: 401 FLAAAIGTSVSSWAMIFLLWNGCKKMGKSSRIDNRLKHNLPF--------IIISSILMGF 452

Query: 175 FIVFFKPCLFNQLS 188
            I   +  L N L 
Sbjct: 453 IIYIVQYFLNNSLH 466


>gi|307943360|ref|ZP_07658704.1| integral membrane protein MviN [Roseibium sp. TrichSKD4]
 gi|307772990|gb|EFO32207.1| integral membrane protein MviN [Roseibium sp. TrichSKD4]
          Length = 522

 Score = 91.7 bits (226), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 89/173 (51%), Gaps = 6/173 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  ++   + +     N A+E+ L   +P    L ++P EI+  L+ERG F   D
Sbjct: 290 LLPSLTRLLRSGQETEYQRSLNNALEFSLVLTLPAAVALAVVPHEIVSVLFERGKF---D 346

Query: 64  TILVSSYLSIYSTEIVG---FLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + V    +  +    G   F+L++V    ++AR D KTP KF  + +++   ++I LFP
Sbjct: 347 QLAVEGTAAALAAFAFGLPAFVLNKVFSPGYFAREDTKTPMKFAAVGMILNVALSIVLFP 406

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
           F    GIA A     W+NT  L V L +R      F+ + +I+ I ++S +MG
Sbjct: 407 FFHHVGIAMATTIAGWINTALLVVVLWRRGHFAPDFKVLRKIVLILVASLVMG 459


>gi|114765401|ref|ZP_01444516.1| integral membrane protein MviN [Pelagibaca bermudensis HTCC2601]
 gi|114542244|gb|EAU45274.1| integral membrane protein MviN [Roseovarius sp. HTCC2601]
          Length = 515

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (52%), Gaps = 9/175 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ E+   +    +RA E  L   IP    L+++P  ++  L+ERGA +A D
Sbjct: 286 LLPDLSRRLKAEDDGGARHAFSRAGEMALALTIPAAVALMVIPLPMVSVLFERGATSADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L +VL   F+AR D +TP ++ + S+V+  VIA+GL P IG
Sbjct: 346 SAAIALAVAIYGLGLPAFVLQKVLQPLFFAREDTRTPFRYAVWSMVVNAVIAVGLAPLIG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-----QIDLPFQTIYRILSIFISSGLMG 173
               A A     WV  + L +    RR     + D  F+   RI  I  +S +MG
Sbjct: 406 WIAPAIATTVAGWVMVLMLGIG--GRRIGDTARFDQRFRR--RIWGILAASFVMG 456


>gi|256822884|ref|YP_003146847.1| integral membrane protein MviN [Kangiella koreensis DSM 16069]
 gi|256796423|gb|ACV27079.1| integral membrane protein MviN [Kangiella koreensis DSM 16069]
          Length = 510

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 87/169 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ Q  S   +  +  VL  GIP    L  L + I+ T+++ GAFT  D
Sbjct: 288 LLPTLSKFFSKKDMQHYSGTLDWGLRMVLMIGIPAAIGLFWLAEPIMITVFQHGAFTEYD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +      L  YS+ ++ F++ +V L+ FY+R D KTP K  ++++V   V+ + LF   G
Sbjct: 348 SFKAGQSLQAYSSGLIAFMMVKVFLTGFYSRQDTKTPVKIAVVAVVTNIVLNLALFKPFG 407

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     +VN I L   L K   + L  ++   I  + ++SGL+
Sbjct: 408 HVGLAAATSVSAFVNAILLYHYLSKDNHLKLSRESKLWIGKLIVASGLL 456


>gi|254461383|ref|ZP_05074799.1| integral membrane protein MviN [Rhodobacterales bacterium HTCC2083]
 gi|206677972|gb|EDZ42459.1| integral membrane protein MviN [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 514

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 89/171 (52%), Gaps = 1/171 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +Q  ++  + +  +RA E  L   IP +  L+++   ++  L+ERGA T+ D
Sbjct: 286 LLPDLSRRLQAGDEAGAKDAFSRATEISLALTIPASVALMVIALPLVSVLFERGALTSDD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L + L   FYAR D K+P +F ++++ +  V+A GL P+IG
Sbjct: 346 SAAIAVAVTIYGFGLPAFVLQKTLQPLFYAREDTKSPFRFALIAMAVNAVLAFGLTPYIG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI-DLPFQTIYRILSIFISSGLMG 173
               A A     WV  +CLA+       +     Q   RI  I  +S  MG
Sbjct: 406 WLAPAIATTFAGWVMVLCLALGTRPMGDVARFDAQLKRRIWRICAASAAMG 456


>gi|254472494|ref|ZP_05085894.1| integral membrane protein MviN [Pseudovibrio sp. JE062]
 gi|211958777|gb|EEA93977.1| integral membrane protein MviN [Pseudovibrio sp. JE062]
          Length = 517

 Score = 89.7 bits (221), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 96/190 (50%), Gaps = 1/190 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  ++   ++     +NR++E+ L   +P    L+++P  +I  L++RG FT   
Sbjct: 290 LLPSLTRQLRSGQEELVYHTQNRSMEFALALTLPAAVALVIIPDTVIAVLFQRGQFTDAA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  ++  +  F+L++VL   F+AR D KTP  F  + +V+   ++I LFP   
Sbjct: 350 VEQTALALMAFAVGLPAFVLNKVLSPGFFAREDTKTPMYFAAVGMVVNVALSILLFPAFK 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA    +  WVNT  LA  L +R    +    + RI  +  +S LMG+ +V+    +
Sbjct: 410 HVGIAIGTTAAGWVNTSLLAFVLWRRGHFVIDSALMKRIPLLGFASALMGV-VVYGGTLV 468

Query: 184 FNQLSAETAF 193
              LSA   F
Sbjct: 469 LEPLSASNLF 478


>gi|114707347|ref|ZP_01440244.1| virulence factor transmembrane protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537228|gb|EAU40355.1| virulence factor transmembrane protein [Fulvimarina pelagi
           HTCC2506]
          Length = 535

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 95/174 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ +++     ++   +NR++E+ LF  +P    L ++P+ II+ +YERG F    
Sbjct: 302 LLPELARSLKAGRLAEAQHTQNRSLEFALFLTVPAAVALFIIPEPIIRVIYERGEFDPSS 361

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  V++ L +Y+  +  F++ +V    ++AR + ++P    ++S     V+++ LF  I 
Sbjct: 362 TPAVAAVLGLYALGLPAFVMMKVFQPGYFARENTRSPMIATMISAGANIVLSLVLFQIIA 421

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
             GIA A     W+N   L   L ++   ++  Q + R   + +S+GLMG+ ++
Sbjct: 422 EQGIALATTIAGWLNAGLLFWGLYRKGLWEIDGQLMKRSALVLLSAGLMGLSLI 475


>gi|94498193|ref|ZP_01304754.1| integral membrane protein MviN [Sphingomonas sp. SKA58]
 gi|94422323|gb|EAT07363.1| integral membrane protein MviN [Sphingomonas sp. SKA58]
          Length = 524

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 102/207 (49%), Gaps = 1/207 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +      Q+ E +NR IE  LF  +P T   L++ + I++ L++ G FTA+D
Sbjct: 294 LLPTISRMLSNGQDAQAMETQNRGIELALFLTLPATVAFLVVAEPIVRGLFQYGRFTAED 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     LS +S  +  ++L +VL   +YAR D KTP ++ +LSI++     + + P +G
Sbjct: 354 AMRCGWALSAFSIGLPSYVLVKVLTPGYYARGDTKTPVRYAMLSILINIAGNLAMIPTLG 413

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G   A      VN   L   L+KR           RI  + +++ +MG  +   +  L
Sbjct: 414 HIGPPLATALSSTVNVAMLYTTLVKRGHFAADAGLRRRIPRLALAALIMGAALWAGEDLL 473

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVY 210
              L+  T F  +  LA+++   V +Y
Sbjct: 474 DPWLTG-TMFQRYLALALLVGAGVALY 499


>gi|163740692|ref|ZP_02148086.1| integral membrane protein MviN [Phaeobacter gallaeciensis 2.10]
 gi|161386550|gb|EDQ10925.1| integral membrane protein MviN [Phaeobacter gallaeciensis 2.10]
          Length = 518

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 91/172 (52%), Gaps = 1/172 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   + +  +RA E+ L   +P TA  L +P  ++  LYERGA  A D
Sbjct: 286 LLPDLSRRLRAGDDAGARDAFSRAGEFSLLLTLPSTAAFLAVPVVLVSVLYERGATGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L +VL   F+AR D ++P ++ ++++V+  V+A GL P++G
Sbjct: 346 VAAIALAVAIYGAGLPAFVLQKVLQPLFFAREDTRSPFRYAVVAMVINAVLAFGLKPYLG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMGM 174
               A A     W    CL +   +  ++    Q  Y R L I  +S +MG+
Sbjct: 406 WIAPAIAATVAGWAMVACLWLGARRMGEVARFDQRFYDRSLRILAASAIMGL 457


>gi|89068997|ref|ZP_01156378.1| putative virulence factor, MviN [Oceanicola granulosus HTCC2516]
 gi|89045366|gb|EAR51431.1| putative virulence factor, MviN [Oceanicola granulosus HTCC2516]
          Length = 516

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 70/120 (58%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS  +   ++Q   E  NRA E+ L   +P    L+ +P  ++  L+ERGAF + D
Sbjct: 286 LLPELSRRLAAGDEQGGRESFNRACEFSLAMTVPAAVALMAIPVPLVSVLFERGAFDSDD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  ++IY   +  F+L + L   ++AR D K+P +F ++S+++   +AIGL P +G
Sbjct: 346 TYATALAVAIYGAGLPAFVLQKTLQPLYFAREDTKSPFRFAVVSMLVNAAVAIGLAPLVG 405


>gi|261856824|ref|YP_003264107.1| integral membrane protein MviN [Halothiobacillus neapolitanus c2]
 gi|261837293|gb|ACX97060.1| integral membrane protein MviN [Halothiobacillus neapolitanus c2]
          Length = 521

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 115/233 (49%), Gaps = 18/233 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LPKLS A    +    S   N AI++ +  G+P  A L++L + ++ TL+E G+F A D
Sbjct: 286 ILPKLSRAYSRTDHGDFSGTLNWAIKFTVLLGLPICAGLVVLAQPMLATLFEYGSFNAFD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPFI 122
           T +V+  +S Y+  +  FLL ++    FYAR D KTP K  ++++    +  AI + P++
Sbjct: 346 THMVALAMSAYALGLPAFLLIKMFAPGFYARQDTKTPVKIGMVAVAANLIFKAIIVLPWM 405

Query: 123 ---GGY----GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGL-MGM 174
              GGY    G+A       WVN   LA   LK+R    P   ++  L   +++ L M  
Sbjct: 406 FLFGGYAAHAGLALTTAMAAWVNFGLLAY-FLKKRDAWQPDPALWLFLRQVLAATLVMAA 464

Query: 175 FIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLK 227
            +++ +P    Q +   A +    L +++ G   VY  S       G+LA L 
Sbjct: 465 VLLWLRPAAI-QWTDANALTRIGWLVLLIGGGAGVYAIS-------GWLAGLH 509


>gi|163736886|ref|ZP_02144304.1| integral membrane protein MviN [Phaeobacter gallaeciensis BS107]
 gi|161389490|gb|EDQ13841.1| integral membrane protein MviN [Phaeobacter gallaeciensis BS107]
          Length = 518

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 90/171 (52%), Gaps = 1/171 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   + +  +RA E+ L   +P TA  L +P  ++  LYERGA  A D
Sbjct: 286 LLPDLSRRLRAGDDAGARDAFSRAGEFSLLLTLPSTAAFLAVPLVLVSVLYERGATGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  +++Y   +  F+L +VL   F+AR D ++P ++ ++++V+  V+A GL P++G
Sbjct: 346 VAAIALAVAVYGAGLPAFVLQKVLQPLFFAREDTRSPFRYAVVAMVINAVLAFGLKPYLG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMG 173
               A A     W    CL +   +  ++    Q  Y R L I  +S +MG
Sbjct: 406 WIAPAIAATVAGWTMVACLWLGARRMGEVARFDQRFYDRSLRILTASAIMG 456


>gi|126734869|ref|ZP_01750615.1| integral membrane protein MviN [Roseobacter sp. CCS2]
 gi|126715424|gb|EBA12289.1| integral membrane protein MviN [Roseobacter sp. CCS2]
          Length = 520

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 91/177 (51%), Gaps = 5/177 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +     +  NRA E  L   IP +  L+ +P  ++  L+ERGAFT+ D
Sbjct: 294 LLPDLSRRLRAGDAAGGRDAFNRASEISLALTIPASVALMAIPLPLVSVLFERGAFTSDD 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  ++IY   +  F+L + L   F+AR D K P  + ++++V+   +AIGL P IG
Sbjct: 354 TAATALAVAIYGLGLPAFVLQKTLQPLFFAREDTKRPFYYAVMAMVLNAALAIGLAPVIG 413

Query: 124 --GYGIATAEVSWVWVNTICL-AVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
                I T+   W  V  +   A  +    + D  F+   R+  I ++SG MG+ +V
Sbjct: 414 FAAAAIGTSLTGWAMVLLLMRGARTMGDAGKFDNRFKQ--RLGRIVVASGAMGLILV 468


>gi|254295438|ref|YP_003061461.1| integral membrane protein MviN [Hirschia baltica ATCC 49814]
 gi|254043969|gb|ACT60764.1| integral membrane protein MviN [Hirschia baltica ATCC 49814]
          Length = 521

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 97/183 (53%), Gaps = 7/183 (3%)

Query: 3   ALLPKLSSAI-QLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+LP+LS A+ ++ + + +    +  I   +   +P    L ++P  +I  L+ RG F A
Sbjct: 284 AILPRLSRAMSKVGSSEDTHRTLDEGISLAMALTLPAAVALAIIPFFLIDALFGRGQFDA 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D+ L +S L  Y+  +  F+L +VL   F+AR+D K P +F ++S+++  V+  G F +
Sbjct: 344 SDSTLAASALIHYAWGVPAFVLVKVLAPAFFARHDTKRPMQFAVVSVLVNTVLGAGAFFW 403

Query: 122 IGGYG------IATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMF 175
           + G G      +A A     W+N   L + L+KR         I R+L +F+S G++G F
Sbjct: 404 LRGQGEYGFPALAAATSFAAWLNVSMLWLTLIKRGDYKPSGLLISRMLRVFVSCGILGGF 463

Query: 176 IVF 178
           + F
Sbjct: 464 LYF 466


>gi|91065086|gb|ABE03919.1| membrane protein [Aplysina aerophoba bacterial symbiont clone
           pAPKS18]
          Length = 517

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 85/151 (56%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           +ALLP LS  I+  ++  ++E ++RAIE V+   +P  A L+++   +I  L+ERGAF A
Sbjct: 286 SALLPLLSRQIEARDETGANESQSRAIELVMVLTLPAAAALMVIAHPVIAVLFERGAFKA 345

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D+   ++ L  ++  +  ++L +VL   F+AR D  T  K  ++ +V    + + L   
Sbjct: 346 VDSEASAAALRAFAAGLPAYVLIKVLAPAFFARKDPGTVLKIAVVGLVSNIAVMLALVWS 405

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
           +G  GIA A  +  WVN I L V L++R  +
Sbjct: 406 LGHVGIALATATAAWVNAIILYVVLVRRNHL 436


>gi|114329073|ref|YP_746230.1| virulence factor mviN [Granulibacter bethesdensis CGDNIH1]
 gi|114317247|gb|ABI63307.1| virulence factor mviN [Granulibacter bethesdensis CGDNIH1]
          Length = 513

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 97/186 (52%), Gaps = 2/186 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP LS  +   ++Q ++   NRA+EY +   +P    L+++ + I+  LYERGAFTA+
Sbjct: 284 ASLPVLSRLVHAGDEQGANHAMNRALEYAMTLILPAAVALIVIAQPIMAVLYERGAFTAE 343

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T L S  L+ Y+  +  F+  R++ + F+AR D  TP K  I  I +   + + L   +
Sbjct: 344 ATYLSSQSLAAYAIGLPAFVAVRIITNGFFARGDTATPVKISIFIIALNLGLNLLLMNRL 403

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS-IFISSGLMGMFIVFFKP 181
              G   A     +VN + L+ A+L RR        + R LS + +++  MG  +  F+P
Sbjct: 404 HHMGPPLASSIAAYVNVLVLS-AMLGRRGHFSADAALRRALSRMGLAALAMGAVLAVFRP 462

Query: 182 CLFNQL 187
            LF+ L
Sbjct: 463 LLFDTL 468


>gi|56695311|ref|YP_165659.1| integral membrane protein MviN [Ruegeria pomeroyi DSS-3]
 gi|56677048|gb|AAV93714.1| integral membrane protein MviN [Ruegeria pomeroyi DSS-3]
          Length = 513

 Score = 85.5 bits (210), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 94/175 (53%), Gaps = 9/175 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   + E  +RA E+ L   +P    L+ +P  ++  L++RGAFT +D
Sbjct: 286 LLPDLSRRLRAGDDTGAREAYSRAGEFSLILTLPSAMALMAIPLPLVAVLFQRGAFTPED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  ++IY   +  F+L +V    F+AR D K+P ++ ++++V+  V+A  L+P +G
Sbjct: 346 SAATAIAVAIYGLGLPAFMLQKVFQPLFFAREDTKSPFRYAVVAMVINAVLAFALYPLLG 405

Query: 124 --GYGIATAEVSWVWVNTICLAVALLKRRQIDLP-FQTIY--RILSIFISSGLMG 173
                IAT    W    T+   +AL  RR  ++  F T +  R   I ++S +MG
Sbjct: 406 WIAPAIATTVAGW----TMVAQLALGARRMGEVARFDTRFHGRAWRILMASLIMG 456


>gi|255261399|ref|ZP_05340741.1| integral membrane protein MviN [Thalassiobium sp. R2A62]
 gi|255103734|gb|EET46408.1| integral membrane protein MviN [Thalassiobium sp. R2A62]
          Length = 510

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 87/173 (50%), Gaps = 5/173 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  + +      NRA E  L   +P +  L+ +P  +I  L+ERGAFT+ D
Sbjct: 286 LLPDLSRKLRAGDHEGGKHAFNRAAEVSLTLTVPASIALIAIPVPLISILFERGAFTSDD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  ++IY   +  F++ + L   FYAR D ++P  + ++S+V+  V+AIGL   IG
Sbjct: 346 SAATAVAVAIYGLGLPAFVMQKALQPLFYAREDTRSPLNYALVSMVVNAVVAIGLATQIG 405

Query: 124 GYGIATAEVSWVWVNTICL---AVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
               A A     WV    L   A  L      D  F+   R   I ++SGLMG
Sbjct: 406 YMAAALATTLAGWVMMALLLRGARKLGDAAAFDAQFKR--RFWRILLASGLMG 456


>gi|254510372|ref|ZP_05122439.1| integral membrane protein MviN [Rhodobacteraceae bacterium KLH11]
 gi|221534083|gb|EEE37071.1| integral membrane protein MviN [Rhodobacteraceae bacterium KLH11]
          Length = 513

 Score = 85.1 bits (209), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 114/228 (50%), Gaps = 2/228 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++K+ +    +RA E+ L   IP T   +++P  ++  L++RG F+A+D
Sbjct: 286 LLPDLSRRLRADDKEGARNAFSRAGEFTLLLTIPSTVAFVIIPAPLVSVLFQRGQFSAED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  ++IY   +  F+L ++L   F+AR D K+P ++ ++++V+   +A GL+P +G
Sbjct: 346 TAATALAVAIYGIGLPAFMLQKLLQPLFFAREDTKSPFRYAVVAMVVNAALAFGLYPIVG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
               A A     W     LA+   +R   +  F   +R  +  I +  +GM  V F    
Sbjct: 406 WIAPAIAASVAGWAMVALLAIG-ARRMGNEARFDARFRHRAWRIIAASVGMGGVLFAAIY 464

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
               + +     +  L  ++S A L Y  ++  L G   LA  + +LK
Sbjct: 465 LFGWAFQIPGWRYAALFALISVAALAYF-AMGHLFGAFRLADFRKALK 511


>gi|294010814|ref|YP_003544274.1| integral membrane protein MviN [Sphingobium japonicum UT26S]
 gi|292674144|dbj|BAI95662.1| integral membrane protein MviN [Sphingobium japonicum UT26S]
          Length = 529

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 103/218 (47%), Gaps = 16/218 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +     +Q+ + +NR IE  LF  +P T   + + + I++ L++ G FT +D
Sbjct: 294 LLPTISRLLSTGQDRQAMDTQNRGIELALFLTLPATVAFITVAEPIVRGLFQYGRFTVED 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  LS +S  +  ++L +VL   +YAR D +TP ++ +LSI++  +  I L P +G
Sbjct: 354 AERCGWALSAFSIGLPSYVLVKVLTPGYYARGDTRTPVRYAMLSILINILGNIVLIPLMG 413

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G   A      VN   L   L+KR       Q   R+  + +++  MG  +       
Sbjct: 414 HVGPPLATALSSTVNVAMLYSTLVKRGHFAADGQLRRRLPRLAVAAVAMGGVL------- 466

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKG 221
               + E    P+      L GA++    +++LL+G G
Sbjct: 467 ---YAGEGVLDPW------LGGAMVQRYVALALLVGAG 495


>gi|158425536|ref|YP_001526828.1| putative virulence factor MviN-like protein [Azorhizobium
           caulinodans ORS 571]
 gi|158332425|dbj|BAF89910.1| putative virulence factor MviN-like protein [Azorhizobium
           caulinodans ORS 571]
          Length = 512

 Score = 84.7 bits (208), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 115/241 (47%), Gaps = 24/241 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+++  +   +++ ++  + R +E  +  G+P     L++P   ++ L+ RGAFT  D
Sbjct: 284 LLPEMARRLAAGDEEGAARAQARCVELAVLLGLPFVVAALLIPDLTMRALFARGAFTRGD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            I  ++ L  Y   ++ FL+ R  +S F AR D  TP +  + ++ +   +   L   + 
Sbjct: 344 AIEAAATLQAYGVGLIAFLVVRAFVSPFNARGDTATPMRASLTAVGLNVALKFALMGPLA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR----------ILSIFISSGLMG 173
             G+A A     W+N + L +   +RR   +  + ++           +L++ +  G+ G
Sbjct: 404 QVGLALATAIGGWIN-VGLLIWFARRRGFPIGDERLFGHLVRLLLCGVVLAVVLEVGVWG 462

Query: 174 MFIVFFKPCLFNQLSAETAFSPFKN--LAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           M           +L+   A S  +   LA++L+G  L YL +++  LGKGF+  L    +
Sbjct: 463 M----------GRLTEGLAGSRDEVIFLAVVLAGG-LAYLLAVAAFLGKGFVLGLAGRRR 511

Query: 232 T 232
           T
Sbjct: 512 T 512


>gi|159045374|ref|YP_001534168.1| putative virulence factor [Dinoroseobacter shibae DFL 12]
 gi|157913134|gb|ABV94567.1| putative virulence factor [Dinoroseobacter shibae DFL 12]
          Length = 534

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 68/120 (56%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +Q  +     +  NRA E  L   +P    LL +P+ ++  L+ERG FTA+D
Sbjct: 306 LLPDLSRRLQAGDTAGGQDAFNRAGEICLALTVPAAVALLCIPEALVSVLFERGRFTAED 365

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  +++Y   +  F+L +V    F+AR D ++P ++ + ++V+   IAIGL P IG
Sbjct: 366 SAATALAVAVYGVGLPAFVLQKVFQPLFFAREDTRSPLRYALWAMVVNAGIAIGLAPVIG 425


>gi|71083081|ref|YP_265800.1| virulence factor MVIN-like [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062194|gb|AAZ21197.1| Virulence factor MVIN-like [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 508

 Score = 84.0 bits (206), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 105/205 (51%), Gaps = 5/205 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS  ++ +NK + + ++N+A+E  LF  IP T  LL+  +EII +L+  G+F    
Sbjct: 284 ILPQLSKYVKSQNKDKINLIQNKALELSLFLSIPATVALLIASEEIISSLFGYGSFDELS 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  ++  +  F L +V  + F+AR++ K P    +LS+++   I++  F  IG
Sbjct: 344 VKNSAKALFYFAIGLPAFSLIKVFSTFFFARHNTKIPFYISLLSVLLNIFISVIFFKQIG 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
              I  A  +  W N + L + L K    +     I R++ I  +S +MG+F  +     
Sbjct: 404 FIIIPIATTTSSWFNALLLFIFLKKESFFNFNHVFIDRLIKILTASVIMGIFFNYIIYFF 463

Query: 184 FNQLSAETAFSPFKNLAIILSGAVL 208
            N+LS +  F      AI L GAV+
Sbjct: 464 NNELSYQENFK-----AIYLVGAVI 483


>gi|149915365|ref|ZP_01903892.1| integral membrane protein MviN [Roseobacter sp. AzwK-3b]
 gi|149810654|gb|EDM70495.1| integral membrane protein MviN [Roseobacter sp. AzwK-3b]
          Length = 512

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 72/120 (60%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++++++  + E  +RA E  L   +PC   L+ +P  ++  L+ERGAFT  D
Sbjct: 286 LLPDLSRRLKVDDQSGAREAYSRAAEISLALTVPCAVALVAVPLPLVSVLFERGAFTTDD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  ++IY   +  F+L ++L   F+AR D K+P ++ ++++++   +A+GL   IG
Sbjct: 346 TAATALAVAIYGLGLPAFVLQKILQPLFFAREDTKSPFRYAVVAMIVNAALAVGLAFVIG 405


>gi|254476820|ref|ZP_05090206.1| integral membrane protein MviN [Ruegeria sp. R11]
 gi|214031063|gb|EEB71898.1| integral membrane protein MviN [Ruegeria sp. R11]
          Length = 516

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 113/229 (49%), Gaps = 4/229 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   + +  +RA E+ L   +P TA  L +P  ++  LYERGA  A D
Sbjct: 286 LLPDLSRRLRAGDDAGARDAFSRAGEFSLLLTLPSTAAFLAVPMVLVSVLYERGATGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L +VL   ++AR D ++P  + ++++V+   +A GL P++G
Sbjct: 346 VAAIALAVAIYGAGLPAFVLQKVLQPLYFAREDTRSPFHYALVAMVINAALAFGLKPYLG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMGMFIVFFKPC 182
               A A     W    CL +   +  ++    Q  Y R L I  +S +MG  ++F    
Sbjct: 406 WIAPAIAATVAGWAMVACLWLGARRMGEVARFDQRFYDRSLRILAASAIMGA-VLFGVVQ 464

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
            F  L    ++     L +I+ GA + +   +  ++G   L  LK S++
Sbjct: 465 QFGWLFYLPSWRYLALLGLIVLGAAVYF--GVGQIIGAVRLGDLKRSVR 511


>gi|144900390|emb|CAM77254.1| virulence factor [Magnetospirillum gryphiswaldense MSR-1]
          Length = 518

 Score = 83.6 bits (205), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 79/148 (53%), Gaps = 1/148 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  I+  N + +   +NRA+E+ L   +P  A + +L   ++  L++RGAF   
Sbjct: 286 ALLPILSRQIRAGNDEAAHHSQNRALEFSLLLTLPAMAAIAVLAVPLVMVLFQRGAFGTV 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF- 121
           +T   +  L+ +S  +  ++L++ L   F+AR+D  TP K    +++   V+ + L+P  
Sbjct: 346 ETQATAGALAAFSLGLPAYVLAKCLTPAFFARHDTATPVKLAAAAMIANIVLNLALWPLG 405

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR 149
           +   GIA A     W+N   LA  L KR
Sbjct: 406 LAQVGIALATALSAWLNVGLLAWVLRKR 433


>gi|90407184|ref|ZP_01215372.1| virulence factor MviN [Psychromonas sp. CNPT3]
 gi|90311760|gb|EAS39857.1| virulence factor MviN [Psychromonas sp. CNPT3]
          Length = 274

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 6/218 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS++   ++  +  +  +  I  V   G+P    L++L + +++ L+ RG F+  D
Sbjct: 50  ILPSLSASHLQKSGDEFKKTIDWGIRMVFLLGVPAMLGLIILAEPMLRVLFMRGEFSLGD 109

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
               +  L  Y + ++ F+L +VL   +YAR D KTP KF I+++V   ++  I +FPF 
Sbjct: 110 ISHSAMSLWAYGSGLLSFMLVKVLAPAYYARQDTKTPVKFGIIAMVSNMILNIIFVFPF- 168

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A A      +N   L   L +R        T++ +L + I++ LMG  I +F P 
Sbjct: 169 GYVGLAIATALSASLNAGLLWFGLYQRGVYKKQADTVFVLLRVVIAALLMGGTIFYFNPL 228

Query: 183 LFNQLSAETAFSPFKNLAI-ILSGAVLVYLCSISLLLG 219
           L  + S  + F     LA+ I+SG  +   C  +LLLG
Sbjct: 229 LL-EWSQYSQFEATYKLALFIISGGAVYLFC--ALLLG 263


>gi|300115553|ref|YP_003762128.1| integral membrane protein MviN [Nitrosococcus watsonii C-113]
 gi|299541490|gb|ADJ29807.1| integral membrane protein MviN [Nitrosococcus watsonii C-113]
          Length = 512

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 6/218 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   + A+ +V   G P    L++L + I+ TL++ G F + D
Sbjct: 290 ILPSLSEKHARASGESFARTLDWALRWVFLIGAPAAIGLVILAEPILTTLFQYGEFESHD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPFI 122
            I+ S  L  YS  ++ F+L ++L   FYAR + +TP +  I++++   V+  + +FP +
Sbjct: 350 VIMASRSLIAYSFGLLPFILIKILAPGFYARQNTRTPVRIAIIAMIANMVLNGVLIFP-L 408

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVFFKP 181
              G+A A     W+N   L    LKR+ I  P    +   L I I+S  M   +++  P
Sbjct: 409 AHAGLALATSLSAWLNASLLFFT-LKRQGIYQPRPGWWWFGLRIIIASSFMAFTLLWLMP 467

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLG 219
            L N L+ E      + +++I   AVLVY  S+ LL+G
Sbjct: 468 SLTNWLNWEATVRTMRIMSLI-GAAVLVYFGSL-LLIG 503


>gi|149911071|ref|ZP_01899699.1| virulence factor MviN [Moritella sp. PE36]
 gi|149805897|gb|EDM65885.1| virulence factor MviN [Moritella sp. PE36]
          Length = 505

 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 92/182 (50%), Gaps = 4/182 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +  Q  +  +  +  VL  G P    +++L   +++ L+ RG F+A D
Sbjct: 282 ILPALSRTHSANSDHQFKQTMDWGVRVVLLLGAPAMMGMIVLASPMLKVLFMRGEFSADD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             + S  L  Y + ++ F+L +VL   +YAR D +TP KF I++++  MGF I + + PF
Sbjct: 342 VSMASMSLMAYGSGLLSFMLIKVLAPGYYARQDTRTPVKFGIIAMISNMGFNIILAI-PF 400

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K+    +   T   I  +F+S+GLM   + + KP
Sbjct: 401 -GYVGLALATAGSATLNAGLLYWGLHKQGVYQINTATGKVIAKLFLSAGLMAGLVQYIKP 459

Query: 182 CL 183
            +
Sbjct: 460 DM 461


>gi|328545862|ref|YP_004305971.1| Integral membrane protein MviN [Polymorphum gilvum SL003B-26A1]
 gi|326415602|gb|ADZ72665.1| Integral membrane protein MviN [Polymorphum gilvum SL003B-26A1]
          Length = 525

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  ++  ++ +     N A+E+ L   +P +  L ++P EI+  L++RGAF A  
Sbjct: 290 LLPSLTRQLRSGHEAEFQRTFNNALEFALALTLPASVALAVIPHEIVAVLFQRGAFDAAA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L+ +S  +  F+L +V    ++AR D +TP  F  +   +   +++ LFP + 
Sbjct: 350 VDGTAAALAAFSFGLPSFVLIKVFSPGYFAREDTRTPMWFAGVGAAVNVALSLALFPVLQ 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFI-SSGLMGMFIVF 178
             GIA A     WVN   L + L +R    +P  T+ R  S+ + +S +MG+ + F
Sbjct: 410 HVGIALATTIAGWVNAALLGIVLWRRGHF-VPDGTVLRRTSLLVLASLVMGVVVHF 464


>gi|308048498|ref|YP_003912064.1| integral membrane protein MviN [Ferrimonas balearica DSM 9799]
 gi|307630688|gb|ADN74990.1| integral membrane protein MviN [Ferrimonas balearica DSM 9799]
          Length = 513

 Score = 82.4 bits (202), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 100/182 (54%), Gaps = 6/182 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  + ++  +  +  VL  GIP    L++L + ++  L+ RG F+  D
Sbjct: 291 ILPALSKDKANDDPTRFTQTLDWGVRSVLLVGIPAMLGLMVLAQPMLMVLFMRGEFSITD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
           T + S  L  Y++ ++ F+L +VL   +YAR D KTP ++ I+++V  MGF +A+ + PF
Sbjct: 351 TQMASMSLLAYASGLLSFMLVKVLAPGYYARQDTKTPVRYGIIAMVANMGFNLALAI-PF 409

Query: 122 IGGY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
             GY G+A A  +   +N + L   L ++    L  QT+ +I  + ++ G+M   +++  
Sbjct: 410 --GYVGLALATSASATLNALLLYRGLRQQGVYQLSGQTLAQIARMALAGGVMAAMLLWLS 467

Query: 181 PC 182
           P 
Sbjct: 468 PS 469


>gi|126739157|ref|ZP_01754851.1| integral membrane protein MviN [Roseobacter sp. SK209-2-6]
 gi|126719774|gb|EBA16482.1| integral membrane protein MviN [Roseobacter sp. SK209-2-6]
          Length = 529

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 118/242 (48%), Gaps = 24/242 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +  E+   +    +RA E  L   IP    L+++P  ++  L+ERGAF  +D
Sbjct: 300 LLPDLSRRLAAEDTSGAKTALSRAGEVSLALTIPSAVALMVIPLPLVSVLFERGAFDFED 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG---LFP 120
           +   +  ++IY   +  F++ +VL   ++AR D ++P ++ ++++++  V+AIG   LF 
Sbjct: 360 SQATALAVAIYGLGLPAFVMQKVLQPLYFAREDTRSPFRYALIAMLVNAVVAIGCAYLFG 419

Query: 121 FIGGYGIATAEVSWVWVNTICLAV-ALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV-- 177
           F G     T    W  V  +     A+    + D  F+T  RI  I  +S +MG F+V  
Sbjct: 420 FTGA-AFGTTFAGWCMVALLLRGSGAMGDSARFDARFKT--RIWRILAASLVMGAFLVGL 476

Query: 178 --FFKPCLFNQLSAETAFSPFKNLA---IILSGAVLVYLCSISLLLGKGFLASLKYSLKT 232
               +P LF         SP + LA   ++LSG V  +  +    +G   LA  K +L+ 
Sbjct: 477 SWALEPWLFG--------SPLRYLALALLVLSGIVSYF--AFGQFIGAFRLAEFKNNLRR 526

Query: 233 DK 234
            K
Sbjct: 527 GK 528


>gi|119386662|ref|YP_917717.1| integral membrane protein MviN [Paracoccus denitrificans PD1222]
 gi|119377257|gb|ABL72021.1| integral membrane protein MviN [Paracoccus denitrificans PD1222]
          Length = 514

 Score = 82.0 bits (201), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 87/180 (48%), Gaps = 13/180 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  ++  +        +RA E+ LF  +P    L++    +I  L+ RGAF   D
Sbjct: 286 LLPDISRRLRNGDTGGGRHAYSRAAEFALFLTVPAAVALVIAAYPLISVLFRRGAFLTAD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L+IY   +  F+L +VL   ++AR D +TP +F + S+V+  V+A+GL PFIG
Sbjct: 346 VGPTALALAIYGLGLPAFVLQKVLQPLYFAREDTRTPFRFAVWSMVVNAVVALGLAPFIG 405

Query: 124 --GYGIATAEVSW-----VWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
                  T    W     +W  T     A     ++D  F+  +R+  I  +S LMG  I
Sbjct: 406 FSAAAWGTTVAGWTMAAQLWRGTRAFGEAA----ELDERFR--HRLPRICAASALMGAVI 459


>gi|84686320|ref|ZP_01014215.1| putative virulence factor, MviN [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665847|gb|EAQ12322.1| putative virulence factor, MviN [Rhodobacterales bacterium
           HTCC2654]
          Length = 513

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 87/169 (51%), Gaps = 1/169 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+LS  +Q  ++  S    +RA E  L   IP    L+++P  ++  L+ERGAFTA D+ 
Sbjct: 288 PELSRRLQAGDEGASRWSLSRAGEIALLLTIPSAVALVVIPLPLVTVLFERGAFTADDSA 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
             +  +++Y   +  F+L +VL   ++AR + KTP  F ++S+V+   +AIGL P IG  
Sbjct: 348 STAFAVAVYGLGLPAFVLQKVLQPVYFARGNTKTPFYFALVSLVVNAALAIGLAPVIGYI 407

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL-SIFISSGLMG 173
             A       W  TI L +   +  +     +  +R L  I  +S +MG
Sbjct: 408 AAAFGTTLAGWAMTIGLWIGTARMGESTRFDKRFWRKLWGILAASAVMG 456


>gi|254500439|ref|ZP_05112590.1| integral membrane protein MviN [Labrenzia alexandrii DFL-11]
 gi|222436510|gb|EEE43189.1| integral membrane protein MviN [Labrenzia alexandrii DFL-11]
          Length = 520

 Score = 82.0 bits (201), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 79/158 (50%), Gaps = 1/158 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  ++        +  NR++E+ L   +P    L ++P EI+  L++R  F    
Sbjct: 290 LLPSLTRQLRSGETAAYQKTLNRSLEFSLVLTLPAAVALAVIPDEIVSVLFQRVRFDEAA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L  +S  +  F+L++V    ++AR D KTP KF  + +V+   ++I  FP++ 
Sbjct: 350 VEGTAAALMAFSFGLPAFVLNKVFSPGYFAREDTKTPMKFAAIGMVVNVALSIAFFPYLQ 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR 161
             GIA A     WVNT  L + L KR     P  T+ R
Sbjct: 410 HVGIALATTIAGWVNTGFLVIVLWKRGHFA-PDATVLR 446


>gi|77166484|ref|YP_345009.1| virulence factor MVIN-like [Nitrosococcus oceani ATCC 19707]
 gi|254436227|ref|ZP_05049734.1| integral membrane protein MviN [Nitrosococcus oceani AFC27]
 gi|76884798|gb|ABA59479.1| Virulence factor MVIN-like protein [Nitrosococcus oceani ATCC
           19707]
 gi|207089338|gb|EDZ66610.1| integral membrane protein MviN [Nitrosococcus oceani AFC27]
          Length = 512

 Score = 81.6 bits (200), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 112/218 (51%), Gaps = 6/218 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   + A+ +V   G P    L +L + I+ TL++ G F + D
Sbjct: 290 ILPSLSEKHARASGESFARTLDWALRWVFLIGAPAAIGLAILAEPILTTLFQYGEFESHD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPFI 122
            I+ S  L  YS  ++ F+L ++L   FYAR + KTP +  I++++   V+  + +FP +
Sbjct: 350 VIMASRSLIAYSFGLLPFILIKILAPGFYARQNTKTPVRIAIIAMIANMVLNGVLIFP-L 408

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFIVFFKP 181
              G+A A     W+N   L    LKR+ I  P    ++  L I I+   M + +++  P
Sbjct: 409 AHAGLALATSLSAWLNASLLFFT-LKRQGIYQPQPGWLWFGLRILIAGSFMAVTLLWLMP 467

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLG 219
            L N L+ E A     ++ +++  AVLVY  S+ LL+G
Sbjct: 468 SLTNWLNWEAAVRT-AHIMLLIGTAVLVYFGSL-LLMG 503


>gi|260753805|ref|YP_003226698.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258553168|gb|ACV76114.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 537

 Score = 81.3 bits (199), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 104/216 (48%), Gaps = 16/216 (7%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  +  + +   +NRAIE  LF  +P    L++    +I  L + GAF+A 
Sbjct: 306 AILPSLSRQLAEDQTEAAIHTQNRAIELALFLTVPAAFGLVIASMPLISALLQHGAFSAS 365

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D+I  +  L+ +S  +  ++L ++L   F+AR D +TP +  I+++++  ++ +      
Sbjct: 366 DSIHSAQALTAFSLGLPAYVLIKILTPGFHARTDTRTPVRVAIIAMLLNLILNLLFIKPF 425

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A +     W N I L   L  R       Q   R + I I+S +M   +    PC
Sbjct: 426 GHVGLALSTAIAAWANVIMLYGLLRHRNHFACDRQLFTRTIKIIIASLVMAAGL---WPC 482

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
           L           P+ N   + +G V+  + ++SLLL
Sbjct: 483 L-----------PWLNH--MATGGVVYRIATLSLLL 505


>gi|86139311|ref|ZP_01057881.1| putative virulence factor, MviN [Roseobacter sp. MED193]
 gi|85824155|gb|EAQ44360.1| putative virulence factor, MviN [Roseobacter sp. MED193]
          Length = 529

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +  E+   +    +RA E  L   IP    L+ +P  ++  L+ERGAF+  D
Sbjct: 300 LLPDLSRRLAAEDATGAQHAFSRAGEISLALTIPSAIALVAIPLPLVSVLFERGAFSFAD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  ++IY   +  F+L +VL   ++AR D +TP +F + ++V+  V+AI     +G
Sbjct: 360 SQATALAVAIYGLGLPAFVLQKVLQPLYFAREDTRTPFRFALNAMVVNAVVAIAGAALLG 419

Query: 124 --GYGIATAEVSWVWVNTICLAV-ALLKRRQIDLPF-QTIYRILSIFISSGLMGMFI--- 176
             G  I T    W  V  +     A+ +  + D  F Q I+RIL   I++ LMG  +   
Sbjct: 420 FIGAAIGTTIAGWAMVWQLARGTGAMGQSARFDARFKQRIWRIL---IAALLMGALLWGA 476

Query: 177 -VFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               +P L+      +A   +  LA++++  ++ Y   I + +G   L+  K SL+ +KG
Sbjct: 477 AWLLEPWLY------SASIRYPALALLVTIGIVSYFA-IGVGIGAFRLSDFKASLRRNKG 529


>gi|269103425|ref|ZP_06156122.1| hypothetical protein VDA_002851 [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163323|gb|EEZ41819.1| hypothetical protein VDA_002851 [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 519

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 107/231 (46%), Gaps = 7/231 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  Q +E  +  +  VL  GIP    +++L K ++  L+ RG F   D
Sbjct: 296 ILPALSRKHVEQSGNQFAETMDWGVRMVLLLGIPAMLGMIVLAKPMLMVLFMRGEFNVYD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L   S  ++ F+L +VL   +YAR D KTP K  I+++V   V      PF G
Sbjct: 356 VNQTAMSLWAMSAGLLNFMLIKVLAPGYYARQDTKTPVKIGIIAMVSNMVFNAMFAPFFG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A      VN   L   L K     +  +T++ +  + ++ G+M   +++  P +
Sbjct: 416 YVGLAIATALSALVNASLLYRGLHKGNVYRVSRKTLWFVARLVVAGGIMVGTLLYIMPPM 475

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
              +   TA       ++I  G V+  L  I+L+LG  F     + L+TD 
Sbjct: 476 AQWVDWSTAHRALWLASLIGLGGVVYVL--IALILGVRF-----HHLRTDS 519


>gi|83945034|ref|ZP_00957400.1| putative virulence factor mvin-like transmembrane protein
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851816|gb|EAP89671.1| putative virulence factor mvin-like transmembrane protein
           [Oceanicaulis alexandrii HTCC2633]
          Length = 536

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 81/150 (54%), Gaps = 1/150 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  ++  +   +   +NRAIE  +   +P  A LL++P  ++  L++RGAF   
Sbjct: 285 ALLPALSKRLRAGDDAGAMGGQNRAIEISMALTLPAAAALLVIPDPVVAGLFQRGAFDGS 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT   +  L+IY+  +  F+L +V    F+AR D  TP KF   S+V+  ++ + LF   
Sbjct: 345 DTARTALALAIYAAGLPAFVLIKVFAPGFFAREDTLTPMKFAAASMVVNLLVGVALFFGP 404

Query: 123 GGY-GIATAEVSWVWVNTICLAVALLKRRQ 151
            GY G+A       W+N I L   L++R Q
Sbjct: 405 MGYAGLALGTTLAGWLNAILLGGTLVRRGQ 434


>gi|209542481|ref|YP_002274710.1| integral membrane protein MviN [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530158|gb|ACI50095.1| integral membrane protein MviN [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 522

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +  E+   +   +NRAI+Y +   +P    +++L + II TL++ GAFT +D
Sbjct: 285 LLPVLSRHVAAEDHDGAHGAQNRAIDYAMILTLPAALGMMVLAQPIIATLFQHGAFTPRD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +L +  L  ++  +  F+L +VL   F+AR D  TP +  + ++ + FV+ + L   + 
Sbjct: 345 AMLSAQSLRAFAIGLPAFVLIKVLAPGFFARGDTATPVRVGLFTLTLNFVLNLLLMHPLH 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI 152
             G   A      VN   L   LL+RR I
Sbjct: 405 HAGPPLASSLAAIVNVATLGF-LLRRRGI 432


>gi|162147862|ref|YP_001602323.1| putative virulence factor mviN [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786439|emb|CAP56021.1| putative virulence factor mviN [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 532

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +  E+   +   +NRAI+Y +   +P    +++L + II TL++ GAFT +D
Sbjct: 295 LLPVLSRHVAAEDHDGAHGAQNRAIDYAMILTLPAALGMMVLAQPIIATLFQHGAFTPRD 354

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +L +  L  ++  +  F+L +VL   F+AR D  TP +  + ++ + FV+ + L   + 
Sbjct: 355 AMLSAQSLRAFAIGLPAFVLIKVLAPGFFARGDTATPVRVGLFTLTLNFVLNLLLMHPLH 414

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI 152
             G   A      VN   L   LL+RR I
Sbjct: 415 HAGPPLASSLAAIVNVATLGF-LLRRRGI 442


>gi|221638213|ref|YP_002524475.1| Integral membrane protein MviN [Rhodobacter sphaeroides KD131]
 gi|221158994|gb|ACL99973.1| Integral membrane protein MviN precursor [Rhodobacter sphaeroides
           KD131]
          Length = 513

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 101/219 (46%), Gaps = 19/219 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++  S    NR  E+ L   +P    L+++   + Q L++RGAF A D
Sbjct: 286 LLPDLSRRLRAGDEAGSRASFNRGTEFALMLTVPAAVALVVIALPLTQVLFQRGAFGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   +  F+L +VL   +YAR D + P  + ++S+V+    AIGL P +G
Sbjct: 346 AWNTALALGAYGLGLPAFVLHKVLQPLYYAREDTRRPFHYAVVSMVVNLAFAIGLMPVMG 405

Query: 124 --GYGIATAEVSWV-----WVNTICLAVA--LLKRRQIDLPFQTIYRILSIFISSGLMGM 174
                +AT    WV     W  +  +  A  L  R +  LP         I +++  MG+
Sbjct: 406 FLAAALATTVSGWVMVWQLWAGSRGMGAASGLDDRLRARLP--------RIVVAALFMGL 457

Query: 175 FIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
            ++F    L   L +E  +  +  LA +++  +  Y  +
Sbjct: 458 -VLFGATGLLEPLLSEPGWR-YPGLAALVAAGIASYFGA 494


>gi|259416393|ref|ZP_05740313.1| integral membrane protein MviN [Silicibacter sp. TrichCH4B]
 gi|259347832|gb|EEW59609.1| integral membrane protein MviN [Silicibacter sp. TrichCH4B]
          Length = 515

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 90/175 (51%), Gaps = 9/175 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  + Q + +  +RA E+ L   IP     + +P  ++  LYERGA   QD
Sbjct: 286 LLPDLSRRLRAGDDQGAQDALSRAGEFSLLLTIPSAVAFIAIPLPLVSVLYERGATGPQD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L +VL   ++AR D ++P  + ++++V+  V+A+GL P  G
Sbjct: 346 AAAIAMAVAIYGAGLPAFVLQKVLQPLYFAREDTRSPFHYALVAMVVNAVLAVGLQPVFG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-----QIDLPFQTIYRILSIFISSGLMG 173
               A A     WV  + L + L  RR     Q D  FQ   R L I ++S  MG
Sbjct: 406 WLAPAIAAPVAGWV--MVLQLWLGARRMGAAAQFDARFQR--RSLRIVLASIAMG 456


>gi|56552535|ref|YP_163374.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241762225|ref|ZP_04760307.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56544109|gb|AAV90263.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373272|gb|EER62891.1| integral membrane protein MviN [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 537

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 103/216 (47%), Gaps = 16/216 (7%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  +  + +   +NRAIE  LF  +P    L++    +I  L + GAF+A 
Sbjct: 306 AILPSLSRQLAEDQTEAAIHTQNRAIELALFLTVPAAFGLVIASMPLISALLQHGAFSAS 365

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D+I  +  L+ +S  +  ++L ++L   F+AR D +TP +  I+++++  ++ +      
Sbjct: 366 DSIHSAQALTAFSLGLPAYVLIKILTPGFHARTDTRTPVRVAIIAMLLNLILNLLFIKPF 425

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A +     W N I L   L  R       Q   R + I I+S +M   +    PC
Sbjct: 426 GHVGLALSTAIAAWANVIMLYGLLRHRNHFACDRQLFTRTIKIIIASLVMAAGL---WPC 482

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
           L           P+ N   + +G V   + ++SLLL
Sbjct: 483 L-----------PWLNH--MATGGVAYRIATLSLLL 505


>gi|118591468|ref|ZP_01548865.1| hypothetical protein SIAM614_27772 [Stappia aggregata IAM 12614]
 gi|118435796|gb|EAV42440.1| hypothetical protein SIAM614_27772 [Stappia aggregata IAM 12614]
          Length = 520

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 93/175 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  ++  +        NRA+E+ L   +P    L ++P+EI+  L++R  F A  
Sbjct: 290 LLPSLTRQLRAGHMGAYQHSLNRALEFSLVLTLPAAVALAVVPQEIVSVLFQRVRFDAAA 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L+ +S  +  F+L++V    ++AR D KTP  F ++ +++   +++ LFP + 
Sbjct: 350 VEGTAAALTAFSFGLPAFVLNKVFSPGYFAREDTKTPMIFAVIGMIVNVGLSVALFPMLQ 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
             GIA A     WVNT  L + L +R      F+ + R+  + ++S LMG+ + F
Sbjct: 410 HVGIALATTLAGWVNTGLLIIVLWRRGHFQPDFKLLRRLSLVVLASLLMGVAVHF 464


>gi|148556729|ref|YP_001264311.1| integral membrane protein MviN [Sphingomonas wittichii RW1]
 gi|148501919|gb|ABQ70173.1| integral membrane protein MviN [Sphingomonas wittichii RW1]
          Length = 525

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 82/149 (55%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +   + + + + +NRAIE VL   +P TA L++    +I+ L + G FT  
Sbjct: 296 AMLPSLSRQLGGGDAKAALDTQNRAIELVLLLTLPATAALMVSATPLIRALLQHGVFTPH 355

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DTI  +  L+ +S  +  ++L +VL   FYAR D +TP +  ++++++  V+ + L   +
Sbjct: 356 DTIASARALAAFSLGLPAYVLIKVLTPGFYARADTRTPVRIALVAMLVNLVLNLVLIWPL 415

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQ 151
              G+A +     WVN + L V L +R  
Sbjct: 416 AHVGLALSTAISAWVNAVLLYVTLRRRDH 444


>gi|109899485|ref|YP_662740.1| integral membrane protein MviN [Pseudoalteromonas atlantica T6c]
 gi|109701766|gb|ABG41686.1| integral membrane protein MviN [Pseudoalteromonas atlantica T6c]
          Length = 523

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 107/214 (50%), Gaps = 9/214 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  S   + A+  V   GIP  A L++L + ++  L++RG FTA D
Sbjct: 296 ILPTLSRNHVTNDAKAFSANIDWALRMVSLLGIPAAAGLMILAEPMLIVLFKRGEFTALD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYIL----SIVMGFVIAIGLF 119
             L S  L  Y+T ++ F+L +VL   F++R D KTP K+ I     ++V   + AI   
Sbjct: 356 ATLASYSLIAYATGLLSFMLIKVLAPGFFSRQDTKTPVKYGIWCMASNMVFNLIFAI--- 412

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           PF G  G+A A      +N   L   L +     L   T+  +  + IS+ +M   ++++
Sbjct: 413 PF-GYLGLAIATSLSATMNAGLLYSKLHRLGVYKLSASTLLFLTKVLISTLIMAAGLIYY 471

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
           +P + N L  E        LAI+++GA  V+L S
Sbjct: 472 RPTIANWLMWEPMMQ-MTQLAIMIAGAGAVFLLS 504


>gi|11992020|gb|AAG42407.1|AF300471_10 virulence factor mviN [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 537

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 103/216 (47%), Gaps = 16/216 (7%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  +  + +   +NRAIE  LF  +P    L++    +I  L + GAF+A 
Sbjct: 306 AILPSLSRQLAEDQTEAAIHTQNRAIELALFLTVPAAFGLVIASMPLISALLQHGAFSAS 365

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D+I  +  L+ +S  +  ++L ++L   F+AR D +TP +  I+++++  ++ +      
Sbjct: 366 DSIHSAQALTAFSLGLPAYVLIKILTPGFHARTDTRTPVRVAIIAMLLNLILNLLFIKPF 425

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A +     W N I L   L  R       Q   R + I I+S +M   +    PC
Sbjct: 426 GHVGLALSTAIAAWANVIMLYGLLRHRNHFACDRQLFTRTIKIIIASLVMAAGL---WPC 482

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
           L           P+ N   + +G V   + ++SLLL
Sbjct: 483 L-----------PWLNH--MATGGVAYRIATLSLLL 505


>gi|126724978|ref|ZP_01740821.1| integral membrane protein MviN [Rhodobacterales bacterium HTCC2150]
 gi|126706142|gb|EBA05232.1| integral membrane protein MviN [Rhodobacterales bacterium HTCC2150]
          Length = 512

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 118/234 (50%), Gaps = 14/234 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +   + +      +RA E  L   +P    L+++P  ++  L+ERGAF A D
Sbjct: 286 LLPDLSRRLAASDTEGGQLALSRAGEVALALALPSAVALIVIPLPLVTVLFERGAFGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  + +Y+  +  F++ +V+   F+AR D K P  + ++++++   IAIGL P+IG
Sbjct: 346 SAATALAVMVYALGLPAFVMQKVMQPLFFAREDTKRPFCYALVAMIVNAGIAIGLMPWIG 405

Query: 124 GYGIATAEVSWVWVNTICLAV---ALLKRRQIDLPFQT-IYRI--LSIFISSGLMGMFIV 177
               A A     WV  I L +   ++ +  + D  F+T +++I   ++ + + L GM +V
Sbjct: 406 FMAAALATSLSAWVMVILLWIGSRSMGQAARFDRRFKTRLWKISAAAVIMGAALFGMTLV 465

Query: 178 FFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
              P L       TA   +  LAI++ G  +VY   +   +G    A LK SL+
Sbjct: 466 -LGPML------GTAGLRYIALAILVIGGSIVYFV-VGGWIGAIKFAELKSSLR 511


>gi|88801255|ref|ZP_01116791.1| integral membrane protein MviN [Reinekea sp. MED297]
 gi|88776006|gb|EAR07245.1| integral membrane protein MviN [Reinekea sp. MED297]
          Length = 506

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 2/172 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LSS     +          AI  VL  G+P    LL++P  ++  L+  G FTAQD
Sbjct: 284 LLPRLSSLHAESDGSMFERTLAWAIRLVLLIGLPAMVALLVMPDVLLSLLFGHGEFTAQD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L+ Y+  +  F+L ++L   F++R D KTP K  + ++V   V  + L   + 
Sbjct: 344 VQAASGSLAAYAIGLPAFMLIKILAPGFFSRQDTKTPVKIAVQAMVWNMVFNVLLIVPLA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMGM 174
             G+A A     W+N   LA  L K  ++  P  T+   +L I ++S +MG+
Sbjct: 404 HVGLALATSLSAWLNASLLAWHLRKDNRLP-PLHTLLPSVLRIALASTVMGV 454


>gi|126461231|ref|YP_001042345.1| integral membrane protein MviN [Rhodobacter sphaeroides ATCC 17029]
 gi|126102895|gb|ABN75573.1| integral membrane protein MviN [Rhodobacter sphaeroides ATCC 17029]
          Length = 513

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 9/161 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++  S    NR  E+ L   +P    L+++   + Q L++RGAF A D
Sbjct: 286 LLPDLSRRLRAGDEAGSRASFNRGTEFALMLTVPAAVALVVIALPLTQVLFQRGAFGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   +  F+L +VL   +YAR D + P  + ++S+V+    AIGL P +G
Sbjct: 346 AWNTALALGAYGLGLPAFVLHKVLQPLYYAREDTRRPFHYAVVSMVVNLAFAIGLMPVMG 405

Query: 124 --GYGIATAEVSWV-----WVNTICLAVA--LLKRRQIDLP 155
                +AT    WV     W  +  +  A  L +R +  LP
Sbjct: 406 FLAAALATTVSGWVMVWQLWAGSRGMGAASRLDERLRARLP 446


>gi|293606246|ref|ZP_06688609.1| integral membrane protein MviN [Achromobacter piechaudii ATCC
           43553]
 gi|292815393|gb|EFF74511.1| integral membrane protein MviN [Achromobacter piechaudii ATCC
           43553]
          Length = 519

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 78/146 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A   ++    S L +  +  VL FG+P    + +L   ++ TL+  GAF AQD
Sbjct: 293 LLPSLSAAHARDDHGGYSALLDWGLRLVLLFGLPAAVGMALLSDGLVATLFHYGAFAAQD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     +  YS  ++G L  ++L   FYA+ D++TP K  I  +++  ++ + L PF+ 
Sbjct: 353 VLQTRLAVISYSAGLIGLLAVKILAPGFYAKQDIRTPVKIAIGVLILTQLMNLVLVPFMA 412

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L + LL+R
Sbjct: 413 HAGLALAIGLGACLNALALLIGLLRR 438


>gi|85704571|ref|ZP_01035673.1| integral membrane protein MviN [Roseovarius sp. 217]
 gi|85670979|gb|EAQ25838.1| integral membrane protein MviN [Roseovarius sp. 217]
          Length = 512

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 89/173 (51%), Gaps = 5/173 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++   +    +RA E  L   IPC   L ++P +++  L+ERGAF A D
Sbjct: 286 LLPDLSRRLKAQDDTGARIALSRAGEIALALTIPCAVALTVIPIQLVSVLFERGAFGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  ++IY   +  F+L ++L   F+AR D ++P ++ ++++++  V+AIGL   IG
Sbjct: 346 SAATALAVAIYGLGLPAFVLQKILQPIFFAREDTRSPFRYALMAMLVNAVLAIGLAYLIG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI---DLPFQTIYRILSIFISSGLMG 173
               A A     WV    L+    K   +   D  F    R   I ++S LMG
Sbjct: 406 WIAAAIATSVAAWVMVAQLSGGARKFGDVARFDAQFHR--RFWRICLASALMG 456


>gi|77462354|ref|YP_351858.1| putative virulence factor, MviN [Rhodobacter sphaeroides 2.4.1]
 gi|77386772|gb|ABA77957.1| putative virulence factor, MviN [Rhodobacter sphaeroides 2.4.1]
          Length = 513

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++  S    NR  E+ L   +P    L+++   + Q L++RGAF  +D
Sbjct: 286 LLPDLSRRLRAGDEAGSRASFNRGTEFALMLTVPAAVALVVIALPLTQVLFQRGAFGPED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   +  F+L +VL   +YAR D + P  + ++S+V+    AIGL P +G
Sbjct: 346 AWNTALALGAYGLGLPAFVLHKVLQPLYYAREDTRRPFHYAVVSMVVNLAFAIGLMPVMG 405

Query: 124 --GYGIATAEVSWV-----WVNTICLAVA--LLKRRQIDLPFQTIYRILSIFISSGLMGM 174
                +AT    WV     W  +  +  A  L +R +  LP         I +++  MG+
Sbjct: 406 FLAAALATTVSGWVMVWQLWAGSRGMGAASRLDERLRARLP--------RIVVAALFMGL 457

Query: 175 FIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
            ++F    L   L +E  +  +  LA +++  +  Y  +
Sbjct: 458 -VLFGATGLLEPLLSEPGWR-YPGLAALVAAGIASYFGA 494


>gi|91762492|ref|ZP_01264457.1| Virulence factor MVIN-like [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718294|gb|EAS84944.1| Virulence factor MVIN-like [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 508

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 103/205 (50%), Gaps = 5/205 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS  ++ + K + + ++N+A+E  LF  IP T  LL+  +EII +L+  G+F    
Sbjct: 284 ILPQLSKYVKSQKKDKINLIQNKALELSLFLSIPATVALLIASEEIISSLFGYGSFDELS 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  ++  +  F L +V  + F+AR++ K P    +LS+++   I++  F  IG
Sbjct: 344 VKNSAKALFYFAIGLPAFSLIKVFSTFFFARHNTKIPFYISLLSVLLNIFISVIFFKQIG 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
              I  A     W N + L + L K    +     I R++ I  +S +MG+F  +     
Sbjct: 404 FIIIPIATTISSWFNALLLFIFLKKESFFNFNLIFIDRLVKILTTSVIMGIFFNYIIYFF 463

Query: 184 FNQLSAETAFSPFKNLAIILSGAVL 208
            N+LS +  F      AI L GAV+
Sbjct: 464 NNELSYQENFK-----AIYLVGAVI 483


>gi|221135349|ref|ZP_03561652.1| MviN protein [Glaciecola sp. HTCC2999]
          Length = 456

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 90/171 (52%), Gaps = 4/171 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  +  +  N A+  V   GIP    L++L + I+  ++ERGAFT+QD
Sbjct: 235 ILPALSRDHVAQDSTKFQQNMNWALTMVCVLGIPSCLGLMVLAEPILSVIFERGAFTSQD 294

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             +  + L  Y+  +V F+L ++    +YAR D KTP K  I++++  MGF I   + PF
Sbjct: 295 VSMAGASLLAYAAGLVSFMLIKIFAPGYYARQDTKTPVKIGIIAMIANMGFNIIFAI-PF 353

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
            G  G+A A      +N + L   L+K          ++RI+ + +S+ LM
Sbjct: 354 -GYVGLAIATSLSATLNAMLLYRGLVKAGVYQFDTTILWRIVRMLVSALLM 403


>gi|114778496|ref|ZP_01453340.1| Virulence factor MVIN-like protein [Mariprofundus ferrooxydans
           PV-1]
 gi|114551221|gb|EAU53780.1| Virulence factor MVIN-like protein [Mariprofundus ferrooxydans
           PV-1]
          Length = 532

 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 104/220 (47%), Gaps = 8/220 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  +   ++  +++     + ++ +  +P  A  L L + I+ TL+ERGAFT  
Sbjct: 304 ALLPTLSGHLSRGDQTAAADDLRAGLAWLSWITLPAVAGALYLAEPIVATLFERGAFTHA 363

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D+I  +  L  Y+  ++ F   R+L S  YA  D K P ++  +S+ +  V+A+ L  F 
Sbjct: 364 DSIATAHTLQAYAIGLIAFCWVRLLASACYAGKDAKAPMRYAAISVAVNIVLAVILMQFW 423

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
              G+A A     +VN   L   L       L   TI R+LS   +S  M      F   
Sbjct: 424 AYVGLALATSLAAFVNVGLLYARLRSSYGSLLTPATIRRLLSAIAASATM-----LFALA 478

Query: 183 LFNQLSAETAFSPFKN--LAIILSGAVLVYLCSISLLLGK 220
            F       A  P ++  LA  + GA+ V+  S +L+LG+
Sbjct: 479 AFGMFWPFPATGPMQSVWLAAAMIGAIAVFFVS-ALILGE 517


>gi|149203454|ref|ZP_01880424.1| integral membrane protein MviN [Roseovarius sp. TM1035]
 gi|149143287|gb|EDM31326.1| integral membrane protein MviN [Roseovarius sp. TM1035]
          Length = 512

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 70/120 (58%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++   +    +RA E  L   IPC   L+++P +++  L+ERGAF A D
Sbjct: 286 LLPDLSRRLKAQDDVGARMALSRAGEIALALTIPCAVALIVIPIQLVSVLFERGAFGADD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  ++IY   +  F+L ++L   F+AR D ++P ++ + ++ +  V+A+GL   IG
Sbjct: 346 SAATALAVAIYGLGLPAFVLQKILQPLFFAREDTRSPFRYAVWAMAVNGVLAVGLAMLIG 405


>gi|126732337|ref|ZP_01748137.1| integral membrane protein MviN [Sagittula stellata E-37]
 gi|126707206|gb|EBA06272.1| integral membrane protein MviN [Sagittula stellata E-37]
          Length = 517

 Score = 79.3 bits (194), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 74/137 (54%), Gaps = 4/137 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ E+        +RA E  L   +PC   L+++P  ++  L+E G    +D
Sbjct: 287 LLPDLSRRLKAEDHVGGRMAFSRAGELSLALTVPCAVALVVMPLPLVSVLFEHGRTGPED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L +VL   ++AR D ++P +F + S+V+   +AIGL P IG
Sbjct: 347 SRAMAVAVAIYGLGLPAFVLQKVLQPVYFAREDTRSPFRFAVWSMVVNAAVAIGLAPLIG 406

Query: 124 --GYGIATAEVSW--VW 136
                IAT+   W  VW
Sbjct: 407 WIAPAIATSLAGWTMVW 423


>gi|315497075|ref|YP_004085879.1| integral membrane protein mvin [Asticcacaulis excentricus CB 48]
 gi|315415087|gb|ADU11728.1| integral membrane protein MviN [Asticcacaulis excentricus CB 48]
          Length = 528

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 88/173 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS A+Q  + ++S  + + A+ + +   +P  A L+ +P  +I  LY RG F   
Sbjct: 295 ALLPTLSRAVQSGDTERSQTVMDDAVLFAMALTLPAAAALIAMPFFLIDGLYTRGEFLLH 354

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    +  L  Y   +  F+L+RVL   F+AR D   P KF ++S+V+     + LFP I
Sbjct: 355 DAQETARALLHYGWGVPAFVLARVLTPAFFARKDTYGPMKFAMVSVVVNLACGLTLFPLI 414

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMF 175
           G  G+A    +  WVN   +   L +R+   L  +    +L + ++  LMG F
Sbjct: 415 GVAGLAIGTSAASWVNVGLMWWTLNRRKTWSLGPKAAAGLLKVIMAGVLMGGF 467


>gi|317051342|ref|YP_004112458.1| integral membrane protein MviN [Desulfurispirillum indicum S5]
 gi|316946426|gb|ADU65902.1| integral membrane protein MviN [Desulfurispirillum indicum S5]
          Length = 521

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 98/192 (51%), Gaps = 5/192 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS ++   N  + + L  R I+ + F  +PC   L++   +II+ L++RG FT  
Sbjct: 293 AILPGLSRSVVDRNSGELNGLLRRGIDLINFITLPCIVGLVIAGDDIIRLLFQRGEFTEY 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D ++    L+ YS  ++ F L ++++S FY+  D KTP K    ++++  ++ + L   +
Sbjct: 353 DALMTYMALAAYSLGLLAFALVKLVVSLFYSLEDSKTPLKAAAWAMLVNILLNLALMYPL 412

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPF--QTIYRILSIFISSGLMGMFIVFFK 180
           G  G+A A  +  W N + L     +R   D+       +RIL +   SG++G  ++  K
Sbjct: 413 GHAGLALATSAASWGNFLYLWHIARQRGMTDVRLFNGETWRILLV---SGMLGAVLLVMK 469

Query: 181 PCLFNQLSAETA 192
             L   L A T 
Sbjct: 470 FALLPWLDAGTG 481


>gi|146276520|ref|YP_001166679.1| integral membrane protein MviN [Rhodobacter sphaeroides ATCC 17025]
 gi|145554761|gb|ABP69374.1| integral membrane protein MviN [Rhodobacter sphaeroides ATCC 17025]
          Length = 513

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 87/178 (48%), Gaps = 14/178 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++  S    NR  E+ L   +P    L+M+   + Q L+ERGAF  +D
Sbjct: 286 LLPDLSRRLRAGDEAGSRASFNRGTEFALMLTLPAAVALVMIALPLTQVLFERGAFGPED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  L+ Y   +  F+L +VL   +YAR D + P  + ++S+ +    A+GL P +G
Sbjct: 346 SWNTALALAAYGLGLPAFVLHKVLQPLYYAREDTRRPFYYAVVSMGVNLAFAVGLMPVLG 405

Query: 124 --GYGIATAEVSWV-----WVNTICLAVA--LLKRRQIDLPFQTIYRILSIFISSGLM 172
                +AT    WV     W  +  +  A  L +R +  LP     RI++  I  GL+
Sbjct: 406 FLAAALATTVSGWVMVWQLWAGSRGMGAATRLDERLRARLP-----RIIAASIFMGLV 458


>gi|260431486|ref|ZP_05785457.1| integral membrane protein MviN [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415314|gb|EEX08573.1| integral membrane protein MviN [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 513

 Score = 78.6 bits (192), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 81/150 (54%), Gaps = 2/150 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   +    +RA E+ L   IP T   +++P  ++  L+ERG FT +D
Sbjct: 286 LLPDLSRRLRAGDGDGARNAFSRAGEFTLLMTIPSTVAFVIIPVPLVSVLFERGQFTPED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +++Y   +  F+L ++L   F+AR D + P ++ ++++V+  V+A GL+P +G
Sbjct: 346 TAATALAVAVYGIGLPAFMLQKLLQPLFFAREDTRAPFRYAVVAMVINAVLAFGLYPLVG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQID 153
               A A  +  W   + LA+    RR  D
Sbjct: 406 WIAPAIAASAAGWGMVVLLALG--ARRMGD 433


>gi|295687466|ref|YP_003591159.1| integral membrane protein MviN [Caulobacter segnis ATCC 21756]
 gi|295429369|gb|ADG08541.1| integral membrane protein MviN [Caulobacter segnis ATCC 21756]
          Length = 543

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 87/175 (49%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP+LS A+   +++ +    ++ I   +   +P  A L+ +P  +   LY RG FTA 
Sbjct: 304 ALLPRLSRAVNSGDREDAQSAMDQGITLAMALTLPAAAALVAMPGFLSDGLYTRGQFTAF 363

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    ++ L  Y      F+L ++    F+AR D K+P +F ++S+ +  +  + LF  I
Sbjct: 364 DASQTAAALFFYGLGTPAFVLQQLYSRAFFARGDTKSPMRFALVSVAVNIIFGVVLFKMI 423

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
           G  GIA A     W+N   +AV L +  +     QT  R+  I ++S  MG  + 
Sbjct: 424 GVKGIAAATAIASWLNVAQMAVVLGRNGEYGPSAQTWSRLSRILLASLGMGALMA 478


>gi|39937038|ref|NP_949314.1| integral membrane protein MviN [Rhodopseudomonas palustris CGA009]
 gi|39650895|emb|CAE29418.1| putative virulence factor MviN-like protein, possible efflux
           protein [Rhodopseudomonas palustris CGA009]
          Length = 509

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P EI++ ++ RGAFT  D
Sbjct: 284 LLPEMSRQLTAGDDAGAKASQRRAFEFTLLFSVPFVAAFLTVPDEIMRAMFARGAFTRAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            I   + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  +    V+   L   + 
Sbjct: 344 AISAGTTLAAYAIALIPFVLIRSAVAPFYARKDTATPVKAALTGVATNVVLKFALMGSLA 403

Query: 124 GYGIATAEVSWVWVN 138
             G+A A  +  W+N
Sbjct: 404 QVGLALATAAGAWIN 418


>gi|192292866|ref|YP_001993471.1| integral membrane protein MviN [Rhodopseudomonas palustris TIE-1]
 gi|192286615|gb|ACF02996.1| integral membrane protein MviN [Rhodopseudomonas palustris TIE-1]
          Length = 509

 Score = 78.2 bits (191), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P EI++ ++ RGAFT  D
Sbjct: 284 LLPEMSRQLTAGDDAGAKASQRRAFEFTLLFSVPFVAAFLTVPDEIMRAMFARGAFTRAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            I   + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  +    V+   L   + 
Sbjct: 344 AISAGTTLAAYAIALIPFVLIRSAVAPFYARKDTATPVKAALTGVATNVVLKFALMGSLA 403

Query: 124 GYGIATAEVSWVWVN 138
             G+A A  +  W+N
Sbjct: 404 QVGLALATAAGAWIN 418


>gi|332140399|ref|YP_004426137.1| MviN protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550421|gb|AEA97139.1| MviN protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 505

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 89/176 (50%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N +  +   + A   V   GIP    L ++ + I+  +++RGAFTA+ 
Sbjct: 282 ILPTLSRNHVSKNPKAFAANIDWAFRMVCLLGIPAAVGLGVMARPILTVIFQRGAFTAET 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
            I+ S  L+ YS  ++ F+L +VL   FY+R D KTP KF I  +V   V  + L  PF 
Sbjct: 342 AIMASYSLTAYSFGLLSFMLVKVLAPGFYSRQDTKTPVKFGIWCMVANMVFNVVLAIPF- 400

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           G  G+A A      +N + L + L ++    L   ++  I  + ++S  MG  I +
Sbjct: 401 GYVGLAIATSMSATLNAVLLYITLHRQGVFALSRTSVLFIARVIVASTAMGALIYY 456


>gi|307294076|ref|ZP_07573920.1| integral membrane protein MviN [Sphingobium chlorophenolicum L-1]
 gi|306880227|gb|EFN11444.1| integral membrane protein MviN [Sphingobium chlorophenolicum L-1]
          Length = 534

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +    +Q + + +NR IE  LF  +P T   + + + I++ L++ G FT +D
Sbjct: 294 LLPTISRLLSTGQEQVAMDTQNRGIELALFLTLPATVAFITVAEPIVRGLFQYGRFTVED 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  LS +S  +  ++L +VL   +YAR D KTP ++ +LSI++  +    L P +G
Sbjct: 354 AQRCGWALSAFSIGLPSYVLVKVLTPGYYARGDTKTPVRYAMLSIIINIIGNFTLIPLLG 413

Query: 124 GYGIA 128
             G+ 
Sbjct: 414 RAGMG 418


>gi|163735276|ref|ZP_02142711.1| virulence factor MviN-like protein [Roseobacter litoralis Och 149]
 gi|161391490|gb|EDQ15824.1| virulence factor MviN-like protein [Roseobacter litoralis Och 149]
          Length = 503

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 74/139 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   +    +RA E  L   IP    L+++P  ++  L+ERGA TA D
Sbjct: 268 LLPDLSRRLKSNDDAGARIALSRAGEIALALTIPSAVALIVIPLPLVSVLFERGAATASD 327

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L +++   F+AR D + P  + ++S+V+   +AIGL P IG
Sbjct: 328 SAAIAVAVAIYGLGLPAFVLQKIMQPVFFAREDTRRPFHYALVSMVINAALAIGLAPLIG 387

Query: 124 GYGIATAEVSWVWVNTICL 142
            +  A A  S  W     L
Sbjct: 388 WFAPAIATTSAAWAMVFLL 406


>gi|157803562|ref|YP_001492111.1| virulence factor mviN [Rickettsia canadensis str. McKiel]
 gi|157784825|gb|ABV73326.1| virulence factor mviN [Rickettsia canadensis str. McKiel]
          Length = 501

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 70/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 284 LLPTLSKIYKSNDLVSAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   I + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGINLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 404 HIGIAVGTSIAAWYN 418


>gi|114564056|ref|YP_751570.1| integral membrane protein MviN [Shewanella frigidimarina NCIMB 400]
 gi|114335349|gb|ABI72731.1| integral membrane protein MviN [Shewanella frigidimarina NCIMB 400]
          Length = 524

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 108/214 (50%), Gaps = 7/214 (3%)

Query: 4   LLPKLSSAIQLENKQQS--SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           +LP LS   +  N Q S  ++  +  ++ +L  G P    L++L K ++  L+ RGAF+ 
Sbjct: 301 ILPALSQ--KHVNAQGSGFNQTMDWGVKAILLLGTPAMLGLIILAKPMLMVLFMRGAFSL 358

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D  + S  L  Y   ++ F++ +VL   +Y+R D KTP K+ I+++V   V  + +F  
Sbjct: 359 NDVEMASYSLVAYGCGLLSFMMIKVLAPGYYSRQDTKTPVKYGIIAMVSNMVFNL-IFAI 417

Query: 122 IGGY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
             GY G+A A      +N   L   L K     +  QT++    + IS+ LM + IV+F 
Sbjct: 418 PFGYVGLAIATSMSALLNAGLLYRGLHKAGVYQMSRQTLFFSFKVIISTTLMAIGIVYFM 477

Query: 181 PCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
           P     L  +T    F  + +I+ GAV +YL S+
Sbjct: 478 PQQSIWLEWQTFERMFMLIELIVGGAV-IYLLSL 510


>gi|332141929|ref|YP_004427667.1| MviN protein [Alteromonas macleodii str. 'Deep ecotype']
 gi|327551951|gb|AEA98669.1| MviN protein [Alteromonas macleodii str. 'Deep ecotype']
          Length = 505

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 89/176 (50%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N +  +   + A   V   GIP    L ++ + I+  +++RGAFTA+ 
Sbjct: 282 ILPTLSRNHVSKNPKAFAANIDWAFRMVCLLGIPAAVGLGVMARPILTVIFQRGAFTAET 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
            I+ S  L+ YS  ++ F+L +VL   FY+R D KTP KF I  ++   V  + L  PF 
Sbjct: 342 AIMASYSLTAYSFGLLSFMLVKVLAPGFYSRQDTKTPVKFGIWCMIANMVFNVVLAIPF- 400

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           G  G+A A      +N + L + L ++    L   ++  I  + ++S  MG  I +
Sbjct: 401 GYVGLAIATSMSATLNAVLLYITLHRQGVFALSRTSVLFIARVIVASTAMGALIYY 456


>gi|300024977|ref|YP_003757588.1| integral membrane protein MviN [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526798|gb|ADJ25267.1| integral membrane protein MviN [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 528

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 83/148 (56%), Gaps = 12/148 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP ++  ++  +     + +NR++E+ +   +P T  L ++P +I++ L+ERGAF  +D
Sbjct: 290 LLPDVARQLRAGDTAGVMDSQNRSLEFAMLLTVPATLALAVIPHDIVRVLFERGAFHPED 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYIL--------SIVMGFVI- 114
           T   +S L++++  +  F++ +V    ++AR D KTP ++ ++        SIV+ FV+ 
Sbjct: 350 TANTASLLAMFALGLPSFVMIKVFSPIYFAREDTKTPMRYAVISLTANTIGSIVLFFVLR 409

Query: 115 AIGLFPFIGGYGIATAEVSWVWVNTICL 142
            +G+ P +   GIA A     W+N   L
Sbjct: 410 ELGMMPQL---GIAIATTLGGWLNAYLL 434


>gi|261493885|ref|ZP_05990397.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495151|ref|ZP_05991615.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309221|gb|EEY10460.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310487|gb|EEY11678.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 524

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 86/180 (47%), Gaps = 3/180 (1%)

Query: 5   LPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++   +L   Q+    +N     +  VL  GIP    + +L + II T++ RG F  
Sbjct: 300 LSRIAKNKELTEIQRGEHFQNTMDWGVRMVLLLGIPAMIGMAVLAQPIIMTMFMRGKFGF 359

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           +D +  S  L +    +  ++L  VL + FYA  + KTP K  I++ +      +   PF
Sbjct: 360 EDVLATSYPLWVMCLGLNSYMLISVLANGFYANQNTKTPVKVGIIAALSNICFGLAFAPF 419

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
           +G  G+A A      VN   L V L K     +  +T+  +L +FI++ +MG  + +F P
Sbjct: 420 LGYIGLALASACSALVNVSLLYVNLSKNGYYKVSHKTVLFVLKLFIAACVMGALVAYFTP 479


>gi|110678516|ref|YP_681523.1| virulence factor MviN-like protein [Roseobacter denitrificans OCh
           114]
 gi|109454632|gb|ABG30837.1| virulence factor MviN-like protein [Roseobacter denitrificans OCh
           114]
          Length = 521

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 74/139 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   +    +RA E  L   IP    L+++P  ++  L+ERGA TA D
Sbjct: 286 LLPDLSRRLKANDDAGAKIALSRAGEIALALTIPSAVALIVIPLPLVSVLFERGAATASD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +  ++  ++IY   +  F+L +++   F+AR D + P  + ++S+V+   +AIGL P IG
Sbjct: 346 SAAIAVAVAIYGLGLPAFVLQKIMQPVFFAREDTRRPFYYALVSMVINAALAIGLAPLIG 405

Query: 124 GYGIATAEVSWVWVNTICL 142
            +  A A  S  W     L
Sbjct: 406 WFAPAIATTSAAWAMVFLL 424


>gi|83594867|ref|YP_428619.1| virulence factor MVIN-like [Rhodospirillum rubrum ATCC 11170]
 gi|83577781|gb|ABC24332.1| Virulence factor MVIN-like [Rhodospirillum rubrum ATCC 11170]
          Length = 513

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 91/169 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  I+  N++ +   +NRA+E+ L   +P  A L+ +   II  L+ERGAFTA D
Sbjct: 287 LLPLLSRQIKAGNEEAARWNQNRALEFSLLLTLPAAAALIAIAHPIITVLFERGAFTASD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   S  +  ++  +  ++L +V    FYAR+D  TP K    S++   V+ + L   +G
Sbjct: 347 SHATSQAMIAFAAGLPAYVLIKVFSPAFYARDDTATPVKVAAASMLTNIVLNLSLIWTLG 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             GIA       W+N + L V L +R +++L  + I R+  + +++  M
Sbjct: 407 YLGIAIGAALSSWMNALLLGVILHRRGKLNLDQRMISRLPRMVLATAAM 455


>gi|254362540|ref|ZP_04978642.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica PHL213]
 gi|153094141|gb|EDN75038.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Mannheimia haemolytica PHL213]
          Length = 510

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 86/180 (47%), Gaps = 3/180 (1%)

Query: 5   LPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++   +L   Q+    +N     +  VL  GIP    + +L + II T++ RG F  
Sbjct: 286 LSRIAKNKELTEIQRGEHFQNTMDWGVRMVLLLGIPAMIGMAVLAQPIIMTMFMRGKFGF 345

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           +D +  S  L +    +  ++L  VL + FYA  + KTP K  I++ +      +   PF
Sbjct: 346 EDVLATSYPLWVMCLGLNSYMLISVLANGFYANQNTKTPVKVGIIAALSNICFGLAFAPF 405

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
           +G  G+A A      VN   L V L K     +  +T+  +L +FI++ +MG  + +F P
Sbjct: 406 LGYIGLALASACSALVNVSLLYVNLSKNGYYKVSHKTVLFVLKLFIAACVMGALVAYFTP 465


>gi|91205511|ref|YP_537866.1| integral membrane protein MviN [Rickettsia bellii RML369-C]
 gi|91069055|gb|ABE04777.1| Integral membrane protein MviN [Rickettsia bellii RML369-C]
          Length = 505

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 73/135 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   +++++N AI   LF  +P T  +++L   II  +YERG FT+ D
Sbjct: 284 LLPELSKIYKSNDIVAATKVQNNAIRMGLFLSLPATFGIIILSHPIINVIYERGVFTSLD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA +D KTP K  + SI++   + + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANSDTKTPLKITLFSIIINTSMNLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 404 HIGIAVGTSIAAWYN 418


>gi|157827226|ref|YP_001496290.1| integral membrane protein MviN [Rickettsia bellii OSU 85-389]
 gi|157802530|gb|ABV79253.1| Integral membrane protein MviN [Rickettsia bellii OSU 85-389]
          Length = 505

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 73/135 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   +++++N AI   LF  +P T  +++L   II  +YERG FT+ D
Sbjct: 284 LLPELSKIYKSNDIVAATKVQNNAIRMGLFLSLPATFGIIILSHPIINVIYERGVFTSLD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA +D KTP K  + SI++   + + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANSDTKTPLKITLFSIIINTSMNLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 404 HIGIAVGTSIAAWYN 418


>gi|292490239|ref|YP_003525678.1| integral membrane protein MviN [Nitrosococcus halophilus Nc4]
 gi|291578834|gb|ADE13291.1| integral membrane protein MviN [Nitrosococcus halophilus Nc4]
          Length = 511

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 108/216 (50%), Gaps = 11/216 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNR----AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           +LP LS     ++ Q SSE  +R    A+ +V   G P    L +L   I+ TL++ G F
Sbjct: 289 ILPSLSE----KHAQASSESFSRTLDWALRWVFLIGTPAAVGLALLAGPILTTLFQYGEF 344

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           +  D  + S  L  YS  ++ F+L ++L   FYAR D +TP +  I+++    V+ + L 
Sbjct: 345 SDHDVTMASRSLIAYSFGLLPFILIKILAPGFYARQDTRTPVRIAIIAMFANMVLNVILI 404

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFIVF 178
             +   G+A A     W+N   L    LKR+ I  P    ++  L I I++ LM + I++
Sbjct: 405 FPLAHAGLALATSLSAWLNATLLFFT-LKRQGIYRPQPGWLWLSLRILIAAELMAISILW 463

Query: 179 FKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
             P L + L+ E   +    + +++  AV++Y  ++
Sbjct: 464 LMPPLASWLNWEV-MTRVAEITLLIGAAVILYFGTL 498


>gi|71280021|ref|YP_267923.1| integral membrane protein MviN [Colwellia psychrerythraea 34H]
 gi|71145761|gb|AAZ26234.1| integral membrane protein MviN [Colwellia psychrerythraea 34H]
          Length = 531

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 86/173 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + ++ S   +  I  +  FG P  A L++L + II  L+ RG F  Q 
Sbjct: 307 ILPSLSKLHSKNSPEEFSATLDWGIRVICLFGWPALAGLMVLAQPIIMVLFMRGEFDQQT 366

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            + VS  L  Y + ++ F+  ++L   +YAR D KTP K  I+++V   +  + L PFIG
Sbjct: 367 VLQVSMALFAYLSGLLSFMFIKILAPGYYARQDTKTPVKIGIIAMVANMIFNLMLAPFIG 426

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
             G+A A      +N   L   L  +    L  +T+  I  + +S+G+M + +
Sbjct: 427 YVGLALATSLSATLNAWLLYRGLKAQGVYQLSAKTLIFIAKLVLSAGVMALVV 479


>gi|15892821|ref|NP_360535.1| virulence factor mviN [Rickettsia conorii str. Malish 7]
 gi|15620005|gb|AAL03436.1| virulence factor mviN [Rickettsia conorii str. Malish 7]
          Length = 555

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 72/135 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI+  L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIKMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|332110476|gb|EGJ10799.1| integral membrane protein MviN [Rubrivivax benzoatilyticus JA2]
          Length = 518

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L++A   E+ Q  S++ +  +  V+   +PC   L++ PK ++  L+  GAF A+D
Sbjct: 294 LLPQLAAAKGREDAQAYSDMLDWGLRLVVMLALPCAIALIVFPKALVAVLFHYGAFDARD 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  Y   ++G +  +VL   FYAR D +TP K  +L +V   ++     P IG
Sbjct: 354 VSQTVHALMGYGVGLMGLVAIKVLAPGFYARQDTRTPVKIAVLVLVCTQLMNALFVPLIG 413

Query: 124 GYGIA 128
             G+A
Sbjct: 414 HAGLA 418


>gi|238650651|ref|YP_002916503.1| integral membrane protein MviN [Rickettsia peacockii str. Rustic]
 gi|238624749|gb|ACR47455.1| integral membrane protein MviN [Rickettsia peacockii str. Rustic]
          Length = 555

 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|34581471|ref|ZP_00142951.1| virulence factor mviN [Rickettsia sibirica 246]
 gi|28262856|gb|EAA26360.1| virulence factor mviN [Rickettsia sibirica 246]
          Length = 555

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|332172859|gb|AEE22113.1| integral membrane protein MviN [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 549

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 109/214 (50%), Gaps = 9/214 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++    S   + A+  V   GIP  A L++L + ++  L++RG FTA D
Sbjct: 322 ILPTLSRNHVTKDANAFSANIDWALRMVCLLGIPAAAGLMILAEPMLIVLFKRGEFTALD 381

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYIL----SIVMGFVIAIGLF 119
             L S  L  Y+T ++ F+L +VL   F++R D KTP K+ I     +++   + AI   
Sbjct: 382 ATLASYSLIAYATGLLSFMLIKVLAPGFFSRQDTKTPVKYGIWCMASNMLFNLIFAI--- 438

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           PF G  G+A A      +N   L   L +     +   T++ +  + I++ +M   ++++
Sbjct: 439 PF-GYLGLAIATSLSATMNAGLLYSKLHRLGVYKMSSGTLFFLAKVLIATLIMTAGLLYY 497

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
           +P + + L    A      LAI+++GA LV+L S
Sbjct: 498 RPGIDSWLGWAPAMQ-ITQLAIMIAGAGLVFLVS 530


>gi|229586929|ref|YP_002845430.1| Integral membrane protein MviN [Rickettsia africae ESF-5]
 gi|228021979|gb|ACP53687.1| Integral membrane protein MviN [Rickettsia africae ESF-5]
          Length = 555

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|67459355|ref|YP_246979.1| integral membrane protein MviN [Rickettsia felis URRWXCal2]
 gi|67004888|gb|AAY61814.1| Integral membrane protein MviN [Rickettsia felis URRWXCal2]
          Length = 556

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 333 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 392

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 393 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTGMNLLLMDSLK 452

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 453 HIGIAVGTSIAAWYN 467


>gi|84515913|ref|ZP_01003274.1| putative virulence factor, MviN [Loktanella vestfoldensis SKA53]
 gi|84510355|gb|EAQ06811.1| putative virulence factor, MviN [Loktanella vestfoldensis SKA53]
          Length = 520

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 67/120 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++   S +  NRA E  L   IP    L+++   ++  L+ERGAF A D
Sbjct: 294 LLPDLSRRLRAQDLAGSKDAFNRACEVSLALTIPAAVALVVIALPLVGVLFERGAFDAAD 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +++Y   +  F++ + L   F+AR D K P  + ++++V+   +A+GL P IG
Sbjct: 354 TSATALAVAVYGLGLPAFVMQKTLQPLFFAREDTKRPFYYALVALVLNAALAVGLSPLIG 413


>gi|157825971|ref|YP_001493691.1| virulence factor mviN [Rickettsia akari str. Hartford]
 gi|157799929|gb|ABV75183.1| virulence factor mviN [Rickettsia akari str. Hartford]
          Length = 507

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT QD
Sbjct: 284 LLPELSKIYKSNDIIAAKKIQNNAIRMGLLLSLPATFGIIILSNPIINIIYERGVFTPQD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTDMNLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA +     W N
Sbjct: 404 HIGIAVSTSIAAWYN 418


>gi|312884036|ref|ZP_07743753.1| mviN protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368494|gb|EFP96029.1| mviN protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 520

 Score = 76.3 bits (186), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 106/219 (48%), Gaps = 8/219 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++    +   +  +  V   G+P    L++L K ++  L+ RG +TAQD
Sbjct: 296 VLPALSKKHVDKSSDGFAHTMDWGVRMVCLLGVPAMLGLIVLAKPMLMVLFMRGEYTAQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y+  ++ F+L +VL   +Y+R D KTP KF I+++V+  +    L  F G
Sbjct: 356 VDNTSLSLIAYACGLLNFMLIKVLAPGYYSRQDTKTPVKFGIIAMVVNMIFNAILAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A     +VN   L   L K+    +  +TI     + I+ GLM + I +    L
Sbjct: 416 YIGLAIATSLSAFVNMALLYHGLQKQNVYSITKKTIVFFCKLIIAGGLMSLAITY----L 471

Query: 184 FNQLSAETAF---SPFKNLAIILSGAVLVYLCSISLLLG 219
            N  S    +      K+L +++    +VY+ S+ LL+G
Sbjct: 472 LNDNSVWLTWQWLERVKHLFLLIGFGAVVYVISL-LLMG 509


>gi|163744704|ref|ZP_02152064.1| integral membrane protein MviN [Oceanibulbus indolifex HEL-45]
 gi|161381522|gb|EDQ05931.1| integral membrane protein MviN [Oceanibulbus indolifex HEL-45]
          Length = 507

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 88/176 (50%), Gaps = 9/176 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   +    +RA E  L   IP    L+++P  ++  L+ERGA    D
Sbjct: 280 LLPDLSRRLRAGDNDGAQTALSRAAEISLALTIPSAVALMVIPFALVTVLFERGASGVDD 339

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  +++ + IY   +  F+L ++L   ++AR D + P  + ++++V+   +A+GL PFIG
Sbjct: 340 TAAIATAVMIYGLGLPSFVLQKILQPVYFAREDTRRPFYYAVVAMVVNAALAVGLAPFIG 399

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-----QIDLPFQTIYRILSIFISSGLMGM 174
               A A     W    CLA+    RR     + D  F    RI  I I+S  MG+
Sbjct: 400 WIAPAVATTLAGWTMFACLAIG--ARRFGGAAKFDARFHK--RIWRILIASAAMGV 451


>gi|288958107|ref|YP_003448448.1| virulence factor [Azospirillum sp. B510]
 gi|288910415|dbj|BAI71904.1| virulence factor [Azospirillum sp. B510]
          Length = 524

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 115/229 (50%), Gaps = 1/229 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP L+  +   ++       +RA+E+ L  G+P    L +    I+  L++RGAF  +
Sbjct: 286 ALLPVLARHVAAGDEGMVRHYLSRALEFSLLLGLPAAVALGVAGGPIVAVLFQRGAFGPE 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           +    +  L+ Y+  I  +++ + L + F+AR+D  TP +  ++  V   ++A+ L P++
Sbjct: 346 EAHATALALAAYAIGIPAYVIVKSLNAAFFARHDTVTPVRVAVIVTVATALLALALMPWL 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  GIA A     W++   L  A+ KR   DL  +  +    I +++  MG  ++  +  
Sbjct: 406 GHVGIALATGLTAWLDVGLLVAAMRKRGLFDLDDRLKHHAPRIAVAAVGMGGMLMAGEWL 465

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           L   L+A +    F  L +++SG  + +  +++L+LG   +  ++  L 
Sbjct: 466 LAPWLAAPSTALRFAALGMLVSGGAMAF-GTLALVLGGASVGDVRRMLS 513


>gi|239993319|ref|ZP_04713843.1| MviN protein [Alteromonas macleodii ATCC 27126]
          Length = 519

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 87/176 (49%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      N +  +   + A   V   GIP    L ++ + I+  +++RGAFTA+ 
Sbjct: 296 ILPTLSRNHVSNNPKAFAANIDWAFRMVCLLGIPAAVGLGVMARPILTVIFQRGAFTAET 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
            I+ S  L+ YS  ++ F+L ++L   FY+R D KTP KF I  +V   V  + L  PF 
Sbjct: 356 AIMASYSLTAYSFGLLSFMLVKILAPGFYSRQDTKTPVKFGIWCMVANMVFNLILAIPF- 414

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           G  G+A A      +N   L + L ++    L   ++  I  + I+S  MG  I +
Sbjct: 415 GYVGLAVATSMSATLNAALLYITLHRQGVFALSRTSVLFIARVVIASAAMGGLIYY 470


>gi|288960007|ref|YP_003450347.1| virulence factor [Azospirillum sp. B510]
 gi|288912315|dbj|BAI73803.1| virulence factor [Azospirillum sp. B510]
          Length = 516

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 78/149 (52%), Gaps = 1/149 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I+  ++  + + +NRAIE  L   +P     L+    I+  L++RGAF   D
Sbjct: 285 LLPEMSKRIKSGDEAGAVDSQNRAIELSLVMTLPAAIAFLVAGMPILSVLFQRGAFGPSD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y+  +  F++ R L++ FYAR+D  TP +  ++++ +   + + L   + 
Sbjct: 345 AAASALTLQAYALGLPAFVVIRSLVNGFYARHDTATPVRVALVAVGINVALKLVLMGPLA 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQI 152
             G+A A     WVN   LA+ LL RR +
Sbjct: 405 QVGLAVATSVGAWVNAGLLAL-LLHRRGL 432


>gi|302871733|ref|YP_003840369.1| integral membrane protein MviN [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574592|gb|ADL42383.1| integral membrane protein MviN [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 523

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 113/220 (51%), Gaps = 10/220 (4%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K++  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKEEFKKYLVLSINSLILIMVPITATVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  I ++V+  ++ I L  F
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTLTPMKNGIFAVVINIILNIVLVKF 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           +   G+A       +V+   L  +L K+  +I+L    +  I ++F +S +M + I+F K
Sbjct: 404 LKHRGLALGTSIVAYVSVFLLMRSLFKKIGKIELKSSLVVFIKALF-ASFVMAISIIFAK 462

Query: 181 PCLFNQLSAETAF-SPFKNLAI-----ILSGAVLVYLCSI 214
             +  Q+     F +   NL+I     ++S + ++YL  I
Sbjct: 463 NLI--QVKTPVTFITKVINLSIWGFCGVISYSTVIYLLKI 500


>gi|115523476|ref|YP_780387.1| integral membrane protein MviN [Rhodopseudomonas palustris BisA53]
 gi|115517423|gb|ABJ05407.1| integral membrane protein MviN [Rhodopseudomonas palustris BisA53]
          Length = 509

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   ++  +   + RA E+ L F +P  A  L +P  I++ ++ RGAFT  D
Sbjct: 284 LLPEMSRQLTSGDEAGAKASQRRAFEFTLLFSVPFVAAFLTVPDAIMRAMFARGAFTNAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  +V F+L R  ++ FYAR D  TP K  +  + +   + I L   + 
Sbjct: 344 AAAAGATLAAYAIGLVPFVLIRSAVATFYARKDTATPVKAALTGVAVNVALKIALVGSLA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A     W+N + +    + +  ++L  + + R L  F+++GL+ + +  +   L
Sbjct: 404 QVGLALATAVGAWINLLLVIGFAVHKGFLELD-RALLRSLLKFVAAGLL-LGVCLWAAAL 461

Query: 184 FNQLSAET--AFSPFKNLAIILSGAVLVYLCSISLLLG 219
           + +L      AF     L +++   V+VY  +I  L G
Sbjct: 462 WARLHLAQLPAFRDEAALGLLIGVGVVVYGATIFALFG 499


>gi|83313508|ref|YP_423772.1| hypothetical protein amb4409 [Magnetospirillum magneticum AMB-1]
 gi|82948349|dbj|BAE53213.1| Uncharacterized membrane protein, putative virulence factor
           [Magnetospirillum magneticum AMB-1]
          Length = 515

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 80/147 (54%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  ++    + +   +NRA+E  L   +P    L+++   +I+ L+ERG+F   
Sbjct: 286 ALLPTLSRQLKAGEAEAARTSQNRAMELGLALTLPAAVALMVIAAPVIRVLFERGSFGPN 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           +T   +S L  ++  +  ++L +VL+  F+AR D  TP +   +++V+  V+ + L   +
Sbjct: 346 ETAATASALVAFAIGLPAYVLVKVLVPGFFAREDTGTPVRVAGVAMVLNVVLNLSLAKPL 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
           G  G+A A     W N + LAV L +R
Sbjct: 406 GHVGMALATAIAAWANVLILAVLLARR 432


>gi|148256891|ref|YP_001241476.1| putative virulence factor MviN-like protein [Bradyrhizobium sp.
           BTAi1]
 gi|146409064|gb|ABQ37570.1| Putative virulence factor MviN-like protein [Bradyrhizobium sp.
           BTAi1]
          Length = 509

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 70/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   + + + E + RA E+ L F +P  A  L +P  I + ++ RGAFT  D
Sbjct: 284 LLPEMSRRLTANDHEGAMEQQRRAFEFTLLFSVPFVAAFLAVPDVITRAMFARGAFTKGD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F++ R  +S FYAR D  TP K  +  + +  ++ + L   + 
Sbjct: 344 AAAAGATLAAYAVGLIPFVMIRSAVSTFYARKDTATPVKASLTGLTVNVLLKVLLMGTLA 403

Query: 124 GYGIATAEVSWVWVN 138
             G+A A     W+N
Sbjct: 404 QVGLALATAVGAWIN 418


>gi|170750887|ref|YP_001757147.1| integral membrane protein MviN [Methylobacterium radiotolerans JCM
           2831]
 gi|170657409|gb|ACB26464.1| integral membrane protein MviN [Methylobacterium radiotolerans JCM
           2831]
          Length = 508

 Score = 75.1 bits (183), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 81/161 (50%), Gaps = 11/161 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P T   L +P  I+  L++RGAF+A+D
Sbjct: 284 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFTVAFLTIPGLIMAALFQRGAFSAED 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +S L+ Y   +   +L R  ++ FYAR D KTP    + +I  G  +A+ L+   G
Sbjct: 344 TARAASVLAAYGFALPAVVLVRSAVASFYARQDTKTPLWASLTAI--GVNVALKLW-LTG 400

Query: 124 GYGI-----ATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
            YG+     ATA   WV    + L + L KRR    P + +
Sbjct: 401 PYGVTGLALATAVAQWV---NLLLLLVLAKRRDWTAPGRAL 438


>gi|77359863|ref|YP_339438.1| virulence factor mviN [Pseudoalteromonas haloplanktis TAC125]
 gi|76874774|emb|CAI85995.1| virulence factor mviN [Pseudoalteromonas haloplanktis TAC125]
          Length = 512

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 78/157 (49%), Gaps = 3/157 (1%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA---QDTILVSSYLSIYSTEIVGF 81
           +  + +V+F G+P    L+++   II  L++ GAF          VS  +  YS  +V F
Sbjct: 303 DWGVRFVIFLGLPAMIGLMIISPLIITVLFDHGAFKEAGIDHVKAVSLGVMAYSVGLVSF 362

Query: 82  LLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTIC 141
           +L +VL   FYAR D KTP +  I+++V+  V  I L PFIG  G+A A       N   
Sbjct: 363 MLIKVLAPGFYARQDTKTPVRIGIITLVLNMVFNIMLAPFIGYLGLALATSMSASCNAFL 422

Query: 142 LAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           L   L K         ++Y  L  F++S +MG+ + F
Sbjct: 423 LYRQLKKENVYQFSSMSLYFTLKCFVASIVMGLLVWF 459


>gi|157828756|ref|YP_001494998.1| virulence factor mviN [Rickettsia rickettsii str. 'Sheila Smith']
 gi|157801237|gb|ABV76490.1| virulence factor mviN [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 551

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 328 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 387

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  + KTP K  + SI++   + + L   + 
Sbjct: 388 TTNTAEAISAFALGLPAFILAKILTPIFYANGNTKTPLKITLFSIIINTGMNLLLMDSLK 447

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 448 HIGIAVGTSIAAWYN 462


>gi|119470024|ref|ZP_01612829.1| virulence factor mviN [Alteromonadales bacterium TW-7]
 gi|119446734|gb|EAW28007.1| virulence factor mviN [Alteromonadales bacterium TW-7]
          Length = 512

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 74/130 (56%), Gaps = 8/130 (6%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           L KL S+ +L + Q + +     + +V+F GIP    L+++   II  L++ GAF  +D+
Sbjct: 286 LSKLHSSKKLSDFQHTLDW---GVRFVIFLGIPAMVGLMIISPLIITVLFDHGAFK-EDS 341

Query: 65  I----LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           +     VS  +  YS  +V F+L +VL   FY+R D KTP +  I+++V+  V  I L P
Sbjct: 342 VDHVKAVSLGVVAYSVGLVSFMLIKVLAPGFYSRQDTKTPVRIGIITLVLNMVFNIMLAP 401

Query: 121 FIGGYGIATA 130
           FIG  G+A A
Sbjct: 402 FIGYLGLALA 411


>gi|294676024|ref|YP_003576639.1| integral membrane protein MviN [Rhodobacter capsulatus SB 1003]
 gi|294474844|gb|ADE84232.1| integral membrane protein MviN [Rhodobacter capsulatus SB 1003]
          Length = 515

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 109/237 (45%), Gaps = 11/237 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++      + +  +R  E  LF  +P    L+++   +I  LY+RGA+  +D
Sbjct: 285 LLPVLSRHLRAGEDDLARDSFSRGAEMALFLTLPAAVALVVISTPLISVLYDRGAWRPED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+  +  L+ Y   +  F+L +VL   +YAR D + P  + ++S+ +    AIG+ P +G
Sbjct: 345 TVATALALAAYGLGLPAFVLQKVLQPLYYAREDSRRPFHYALVSMGVNAAFAIGMMPVMG 404

Query: 124 --GYGIATAEVSWVWVNTICLAVALLKRRQIDL--PFQTIYRIL-SIFISSGLMGMFIVF 178
                +AT    WV V  +        R+  D   P    +R L  I + SGLMG  +  
Sbjct: 405 FVAAALATTVSGWVMVGQLWWGA----RKMGDAARPDARFWRRLWRIGLVSGLMGAQLWV 460

Query: 179 FKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDKG 235
               L  QL A+     +  L ++    + +Y  ++   LG   L  LK  L+  +G
Sbjct: 461 TADWLAPQL-AQPGGVRWGALGLLCGSGIALYF-ALGAALGAYGLGELKGMLRRRRG 515


>gi|165933483|ref|YP_001650272.1| virulence factor [Rickettsia rickettsii str. Iowa]
 gi|165908570|gb|ABY72866.1| virulence factor [Rickettsia rickettsii str. Iowa]
          Length = 555

 Score = 74.7 bits (182), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  + KTP K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGNTKTPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|239947197|ref|ZP_04698950.1| integral membrane protein MviN [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921473|gb|EER21497.1| integral membrane protein MviN [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 551

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 328 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 387

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  + KTP K  + SI++   + + L   + 
Sbjct: 388 TTNTAEAISAFALGLPAFILAKILTPIFYANGNTKTPLKITLFSIIINTGMNLLLMDSLK 447

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 448 HIGIAVGTSIAAWYN 462


>gi|157964730|ref|YP_001499554.1| integral membrane protein MviN [Rickettsia massiliae MTU5]
 gi|157844506|gb|ABV85007.1| Integral membrane protein MviN [Rickettsia massiliae MTU5]
          Length = 555

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 70/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +  +   + +++N AI   L   +P T  +++L   II  +YERG FT+QD
Sbjct: 332 LLPELSKIYKSNDIVAAKKIQNNAIRMGLLLSLPATFGIIILSHPIINIIYERGVFTSQD 391

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D K P K  + SI++   + + L   + 
Sbjct: 392 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKAPLKITLFSIIINTGMNLLLMDSLK 451

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 452 HIGIAVGTSIAAWYN 466


>gi|15604441|ref|NP_220959.1| virulence factor MVIN (mviN) [Rickettsia prowazekii str. Madrid E]
 gi|7387926|sp|Q9ZCW4|MVIN_RICPR RecName: Full=Virulence factor mviN homolog
 gi|3861135|emb|CAA15035.1| VIRULENCE FACTOR MVIN (mviN) [Rickettsia prowazekii]
 gi|292572211|gb|ADE30126.1| Integral membrane protein MviN [Rickettsia prowazekii Rp22]
          Length = 507

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S   +  +   + +++N AI   L   +P T  +++L   I   +YERG FT QD
Sbjct: 284 LLPEMSKVYKSNDIVSAQKIQNNAIRIGLLLSLPATFGIIILSHPITNIIYERGVFTPQD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI++   + + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIINTNMNLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 404 HIGIAVGTSIAAWYN 418


>gi|51473769|ref|YP_067526.1| MviN-like protein [Rickettsia typhi str. Wilmington]
 gi|51460081|gb|AAU04044.1| MviN-like protein [Rickettsia typhi str. Wilmington]
          Length = 507

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   +  +   + +++N +I   L   +P T  +++L   I   +YERG FT QD
Sbjct: 284 LLPAMSKVYKSNDIVSAQKIQNNSIRIGLLLSLPATFGIIILSHPITHIIYERGVFTHQD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  +S ++  +  F+L+++L   FYA  D KTP K  + SI+M   + + L   + 
Sbjct: 344 TTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIMNTNMNLLLMDSLK 403

Query: 124 GYGIATAEVSWVWVN 138
             GIA       W N
Sbjct: 404 HIGIAVGTSIAAWYN 418


>gi|23014762|ref|ZP_00054563.1| COG0728: Uncharacterized membrane protein, putative virulence
           factor [Magnetospirillum magnetotacticum MS-1]
          Length = 515

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  ++      +   +NRA+E  L   +P    L+++   +I+ L+ERG+F   
Sbjct: 286 ALLPTLSRQLKAGEADAARTSQNRAMELGLALTLPAAVALMVIAAPVIRVLFERGSFGPN 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           +T   +S L  ++  +  ++L +VL+  F+AR D  TP K   +++V+  V+ + L   +
Sbjct: 346 ETAATASALVAFAIGLPAYVLVKVLVPGFFAREDTGTPVKVAGVAMVLNVVLNLSLAKPL 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
           G  G+A A     W N   LAV L +R
Sbjct: 406 GHVGMALATAIAAWANVAILAVLLARR 432


>gi|312127480|ref|YP_003992354.1| integral membrane protein mvin [Caldicellulosiruptor hydrothermalis
           108]
 gi|311777499|gb|ADQ06985.1| integral membrane protein MviN [Caldicellulosiruptor hydrothermalis
           108]
          Length = 523

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 113/220 (51%), Gaps = 10/220 (4%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K++  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKEEFKKYLVLSINSLILIMVPITAAVLVLSREIVQFVYERGAFNS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  IL++ +  V+ I L  +
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTITPMKNGILAVAINIVLNIILVKY 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           +   G+A       +V+   L  +L K+  +I+L    I  I ++F +S +M + I+F K
Sbjct: 404 LKHRGLALGTSIVAYVSVFLLMRSLFKKIGKIELKSSLIVFIKALF-ASFVMAISIIFAK 462

Query: 181 PCLFNQLSAETAF-SPFKNLAI-----ILSGAVLVYLCSI 214
             +  Q+     F +   NL+I     ++S + ++YL  I
Sbjct: 463 NLI--QVKTPVTFITKVINLSIWGFCGVISYSTVIYLLKI 500


>gi|326569890|gb|EGE19940.1| integral membrane protein MviN [Moraxella catarrhalis BC8]
          Length = 516

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 11/157 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS+    + +   +  + A   +L  GIP +  + +L   ++  L+ RG FT QD
Sbjct: 290 ILPSLSSSRAKSDDENFRQTLDWAARLILVIGIPASLAIFVLSDILMDALFVRGQFTHQD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLF- 119
            ++    L   S  I+GF+L ++    F+A  D KTP K  I+S+       V+ IGLF 
Sbjct: 350 ALMSGIALKSLSGGILGFMLIKIFAPAFFANQDTKTPVKIGIISVFANMIFSVVFIGLFY 409

Query: 120 ----PFIGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
               P  GG  +AT   S+V      L  A+L RR I
Sbjct: 410 LMKLPLHGGLALATTAASFV---NAGLLYAVLHRRGI 443


>gi|171057361|ref|YP_001789710.1| integral membrane protein MviN [Leptothrix cholodnii SP-6]
 gi|170774806|gb|ACB32945.1| integral membrane protein MviN [Leptothrix cholodnii SP-6]
          Length = 520

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 85/175 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS+A      ++ S L +  +  V+   +PC   LL+ P+ ++  LY  G F   D
Sbjct: 296 LLPQLSAAQASGESERYSALLDWGLRLVVLLALPCAVALLVFPQPLVAVLYHYGQFKPTD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  Y   ++G +  +VL   FYAR D++TP +  I  +V+  ++ + L P +G
Sbjct: 356 VNQTVIALMGYGAGLLGLVAIKVLAPGFYARQDIRTPVRIAITVLVLTQLMNLALVPLLG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
             G+A +      VN   L + L +R       +    +L I ++ G+MG+ + +
Sbjct: 416 HAGLALSIGLAALVNATWLLIGLRRRGSYRPSAEWRGFLLRIGLACGVMGVGLAW 470


>gi|326560988|gb|EGE11353.1| integral membrane protein MviN [Moraxella catarrhalis 7169]
 gi|326563772|gb|EGE14023.1| integral membrane protein MviN [Moraxella catarrhalis 46P47B1]
 gi|326566786|gb|EGE16925.1| integral membrane protein MviN [Moraxella catarrhalis 103P14B1]
 gi|326567371|gb|EGE17486.1| integral membrane protein MviN [Moraxella catarrhalis BC1]
 gi|326571502|gb|EGE21517.1| integral membrane protein MviN [Moraxella catarrhalis BC7]
 gi|326575215|gb|EGE25143.1| integral membrane protein MviN [Moraxella catarrhalis CO72]
 gi|326576699|gb|EGE26606.1| integral membrane protein MviN [Moraxella catarrhalis 101P30B1]
 gi|326577627|gb|EGE27504.1| integral membrane protein MviN [Moraxella catarrhalis O35E]
          Length = 516

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 77/157 (49%), Gaps = 11/157 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS+    + +   +  + A   +L  GIP +  + +L   ++  L+ RG FT QD
Sbjct: 290 ILPSLSSSRAKSDDENFRQTLDWAARLILVIGIPASLAIFVLSDILMDALFVRGQFTHQD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLF- 119
            ++    L   S  I+GF+L ++    F+A  D KTP K  I+S+       V+ IGLF 
Sbjct: 350 ALMSGIALKSLSGGILGFMLIKIFAPAFFANQDTKTPVKIGIISVFANMIFSVVFIGLFY 409

Query: 120 ----PFIGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
               P  GG  +AT   S+V      L  A+L RR I
Sbjct: 410 LMKLPLHGGLALATTAASFV---NAGLLYAVLHRRGI 443


>gi|296283092|ref|ZP_06861090.1| hypothetical protein CbatJ_05700 [Citromicrobium bathyomarinum
           JL354]
          Length = 534

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 80/160 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  +N+  +  +++ AIE  +   IP    L +  +  +  +++ G F+ +
Sbjct: 293 AILPTLSKFVGAKNRAGTDRIQSDAIELAMLLTIPAAVALAICAEPFVTMIFQGGRFSVE 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
              L  + L+     +  ++L +VL+  FYAR+D +TP     +S+V+   + +      
Sbjct: 353 QAALTGNVLAALVLGLPAYVLVKVLVPNFYARSDTRTPVYAAFISLVVFAAMNVATIGRF 412

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           G  G+A A V   W+N   L V L+KR    +P + + RI
Sbjct: 413 GVVGVAFASVIGAWINVGYLYVVLVKRDYYRIPLKLVGRI 452


>gi|323492572|ref|ZP_08097718.1| mviN protein [Vibrio brasiliensis LMG 20546]
 gi|323313174|gb|EGA66292.1| mviN protein [Vibrio brasiliensis LMG 20546]
          Length = 522

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 88/176 (50%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  ++  +  +  V   GIP    L++L K ++  L+ RG FT QD
Sbjct: 296 ILPALSRKHVDAHSEGFAQTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFTPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQFASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAWFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           GY G+A A     +VN   L   L K     L  +T+  +  + I+ GLM   IV+
Sbjct: 415 GYVGLAIATALSAFVNMSLLYRGLHKAGVYRLTRKTLLFVGKLIIAGGLMVAAIVW 470


>gi|262377121|ref|ZP_06070346.1| integral membrane protein MviN [Acinetobacter lwoffii SH145]
 gi|262307859|gb|EEY88997.1| integral membrane protein MviN [Acinetobacter lwoffii SH145]
          Length = 513

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +N ++   + + A + ++  G+P +  L ML   IIQ L+ERG FT +D
Sbjct: 287 ILPSLSARHTEQNPEKFRGMMDWAAKVIVMAGLPASVALFMLSTPIIQALFERGQFTFED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D +TP +  ++++       VI IG F 
Sbjct: 347 TQMTALALQCMSGGVIAFMLIKVFAPGFYAKQDTRTPVRVGLMAVAANAILNVIFIGFFK 406

Query: 121 FIG 123
            IG
Sbjct: 407 LIG 409


>gi|90422947|ref|YP_531317.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB18]
 gi|90104961|gb|ABD86998.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB18]
          Length = 509

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 109/227 (48%), Gaps = 8/227 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P  I++ ++ RGAFT  D
Sbjct: 284 LLPEMSRQLTSGDDVGAKASQRRAFEFTLLFSVPFVAAFLTVPDVIMRAMFARGAFTKAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +   + L+ Y+  +V F+L R  ++ FYAR D  TP K  +  I +   + + L   + 
Sbjct: 344 AVAAGATLAAYAIALVPFVLIRSAVAPFYARKDTATPMKAALTGIAVNVALKVALVGALA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR---QIDLPFQTIYRILSIFISSG-LMGMFIVFF 179
             G+A A     W+N + L +    R    +ID   + +   ++ F++ G L+G  +   
Sbjct: 404 QVGLALATAVGAWIN-LLLVIGFAVRAGYLEID---RALTLAIAKFVAVGLLLGAALWAT 459

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASL 226
                  L+  +A      LA+++    LVY  +I LL G  +L +L
Sbjct: 460 ARYAAPYLAQLSALRDEAALALLIGVGALVYGAAILLLFGTRWLRAL 506


>gi|146342008|ref|YP_001207056.1| putative virulence factor MviN-like protein [Bradyrhizobium sp.
           ORS278]
 gi|146194814|emb|CAL78839.1| Putative virulence factor MviN-like protein [Bradyrhizobium sp.
           ORS278]
          Length = 509

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 74/147 (50%), Gaps = 1/147 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P  I + ++ RGAFT  D
Sbjct: 284 LLPEMSRRLTAGDHDGAMAQQRRAFEFTLLFSVPFVAAFLAVPDVITRAMFARGAFTKGD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F++ R  +S FYAR D  TP K  +  + +  V+ + L   + 
Sbjct: 344 AAAAGATLAAYAVGLIPFVMIRSAVSTFYARKDTATPVKASLTGLTVNVVLKVLLMGSLA 403

Query: 124 GYGIATAEVSWVWVN-TICLAVALLKR 149
             G+A A     W+N  + L  A+ KR
Sbjct: 404 QVGLALATAVGAWINLLLVLGFAVHKR 430


>gi|222529459|ref|YP_002573341.1| integral membrane protein MviN [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456306|gb|ACM60568.1| integral membrane protein MviN [Caldicellulosiruptor bescii DSM
           6725]
          Length = 523

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K++  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKEEFKKYLVLSINSLILIMVPITAAVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  IL++ +  V+ I L  +
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTLTPMKNGILAVAINIVLNIVLVKY 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFIS 168
           +   G+A       +V+   L  +L K+  +IDL    I  + ++F S
Sbjct: 404 LKHRGLALGTSIVAYVSVFLLMRSLFKKIGKIDLKSSMIVFVKALFAS 451


>gi|85712275|ref|ZP_01043326.1| MviN-like membrane protein [Idiomarina baltica OS145]
 gi|85693902|gb|EAQ31849.1| MviN-like membrane protein [Idiomarina baltica OS145]
          Length = 520

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS    ++ Q  S   +  I  VL  G+P  A L  L + ++  L+  GAFT  D
Sbjct: 296 ILPALSSRHVDQSTQNFSATLDWGIRMVLLLGLPAMAGLFFLAEPMLMVLFMHGAFTPND 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGL-FP 120
             + S  L  YS  ++ F+L +VL + FY+R D K P KF I+++V  MG  IA  + F 
Sbjct: 356 AEMASYSLMAYSAGLLSFMLVKVLATGFYSRQDTKRPVKFGIIAMVANMGLNIAFAIPFS 415

Query: 121 FIG 123
           ++G
Sbjct: 416 YVG 418


>gi|212636475|ref|YP_002313000.1| MviN protein [Shewanella piezotolerans WP3]
 gi|212557959|gb|ACJ30413.1| MviN protein [Shewanella piezotolerans WP3]
          Length = 510

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 94/192 (48%), Gaps = 6/192 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        Q  S+  +  ++ ++  G+P    L+ML K ++  L+ RGAF+ +D
Sbjct: 287 ILPALSKRHVNAESQAFSQTMDWGVKAIILLGLPAMCGLIMLAKPMLMVLFMRGAFSYED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F+L ++L   +Y+R D KTP ++ I+++V   V  + +F    
Sbjct: 347 VEMASYSLMAYGSGLLSFMLIKILAPGYYSRQDTKTPVRYGIIAMVSNMVFNL-IFAIPF 405

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      +N   L   L K     L   TI   +  FI+  +M   I + +P 
Sbjct: 406 GYVGLAIATSMSALLNACLLYRGLHKANVYRLNTSTILFAIKTFIAGLVMAAVIYYLQPT 465

Query: 183 LFNQLSAETAFS 194
               ++A  AFS
Sbjct: 466 ----IAAWLAFS 473


>gi|260893798|ref|YP_003239895.1| integral membrane protein MviN [Ammonifex degensii KC4]
 gi|260865939|gb|ACX53045.1| integral membrane protein MviN [Ammonifex degensii KC4]
          Length = 524

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (53%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L+        ++   L +RA+ + L   +P    L++L   I+  L+ERGAF A+
Sbjct: 285 AVFPTLTHRAAEGQHEEVGRLLDRALRFNLLLTLPAAVGLMVLRYPIVSFLFERGAFDAR 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + ++ L  Y+  +VG+  + +L   FYA +D KTP K  ++++++  ++++ L   +
Sbjct: 345 ATSMTAAALLCYAVGMVGYAANILLTRGFYALHDTKTPVKLTLVTVIVNLILSLILMHPL 404

Query: 123 GGYGIATAEVSWVWVNTICL 142
              G+A A     WVNT  L
Sbjct: 405 KHAGLALANSLAAWVNTFLL 424


>gi|59711072|ref|YP_203848.1| inner membrane protein [Vibrio fischeri ES114]
 gi|59479173|gb|AAW84960.1| predicted inner membrane protein [Vibrio fischeri ES114]
          Length = 519

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 88/181 (48%), Gaps = 2/181 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           S+  +  +  V+  GIP    L++L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRKHVDAEGDGFSQTMDWGVRMVILLGIPAMLGLMVLAKPMLMVLFMRGEFSPND 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +YAR D KTP ++ I+++V        +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYARQDTKTPVRYGIIAMVTNMFFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      VN + L   L       L  +T++ +L + +S G+M   +++  P 
Sbjct: 415 GYVGLAMATALSALVNMVLLYRGLHLANVYKLSKETVFFVLKLIVSGGVMVSILLWLMPS 474

Query: 183 L 183
           +
Sbjct: 475 M 475


>gi|197334538|ref|YP_002155220.1| integral membrane protein MviN [Vibrio fischeri MJ11]
 gi|197316028|gb|ACH65475.1| integral membrane protein MviN [Vibrio fischeri MJ11]
          Length = 486

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 88/181 (48%), Gaps = 2/181 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           S+  +  +  V+  GIP    L++L K ++  L+ RG F+  D
Sbjct: 263 ILPALSRKHVDAEGDGFSQTMDWGVRMVILLGIPAMLGLMVLAKPMLMVLFMRGEFSPND 322

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +YAR D KTP ++ I+++V        +F +  
Sbjct: 323 VHQASLSLLAYASGLLNFMLIKVLAPGYYARQDTKTPVRYGIIAMVTNMFFN-AIFAYFY 381

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      VN + L   L       L  +T++ +L + +S G+M   +++  P 
Sbjct: 382 GYVGLAMATALSALVNMVLLYRGLHLANVYKLSKETVFFVLKLIVSGGVMVSILLWLMPS 441

Query: 183 L 183
           +
Sbjct: 442 M 442


>gi|124268210|ref|YP_001022214.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
 gi|124260985|gb|ABM95979.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
          Length = 521

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 77/146 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS+       ++ + L +  +  V+   +PC   L++ P+ ++  LY RGAF+A D
Sbjct: 297 LLPQLSATQAEGGSERYAALLDWGLRLVVLLALPCAVALIVFPEALVSVLYHRGAFSAFD 356

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L  Y   ++G +  +VL   FYA+ D++TP K  I+ +V+  ++ +   P +G
Sbjct: 357 VHQTVTALRGYGAGLLGLVALKVLAPGFYAKQDIRTPVKVAIVVLVLTQLLNLLFVPRLG 416

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN + L + L +R
Sbjct: 417 HAGLALSIGCGALVNALWLLIGLYRR 442


>gi|58698632|ref|ZP_00373527.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534854|gb|EAL58958.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 401

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 114/229 (49%), Gaps = 12/229 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   Q+ N +   +++N+A+   L   +P TA  +++P  I+ TL+  G F    
Sbjct: 180 LLPLISK--QVNNTENIVKIQNKALNIGLMLIMPTTAAFIIIPDIILLTLFSYGRFDHYA 237

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  +S  +  F++++VLL  F+A+ ++K P  F ++ + +  V+ + L     
Sbjct: 238 VQQTVPTLIAFSLSLPAFIINKVLLPTFFAKGNLKIPTIFSLMCLGINVVLNLLLMNKYQ 297

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W+N+I L   L   +   +    +  I+ IF+++ +M + +  F   L
Sbjct: 298 HTGIAIATSVSTWINSILLISYLTINKMYKVSQALLLNIMKIFVATAVMSIALYIFNSLL 357

Query: 184 ----FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKY 228
               F+++ A   +     LA +++ +V+VY  ++ L   +G L +LKY
Sbjct: 358 AGLFFDKMLARIVY-----LATLIALSVIVYFGTLYLTF-RGSLNNLKY 400


>gi|99080286|ref|YP_612440.1| integral membrane protein MviN [Ruegeria sp. TM1040]
 gi|99036566|gb|ABF63178.1| integral membrane protein MviN [Ruegeria sp. TM1040]
          Length = 515

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 124/236 (52%), Gaps = 12/236 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  + + + +  +RA E+ L   IP  A L+ +P  ++  LYERGA  A+D
Sbjct: 286 LLPDLSRRLRAGDDEGARDAFSRAGEFSLLLTIPAAAALIAIPVPLVSVLYERGATGAED 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L +VL   F+AR D ++P  + ++++V+  V+A+GL P +G
Sbjct: 346 VAAIAMAVAIYGAGLPAFVLQKVLQPLFFAREDTRSPFHYALVAMVVNAVLAVGLQPLVG 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-----QIDLPFQTIYRILSIFISSGLMGMFIVF 178
               A A  +  WV  + L + L  RR     Q D  FQ   R L I ++S  MG+ ++ 
Sbjct: 406 WLAPAIAAPAAGWV--MVLQLWLGSRRMGEAAQFDARFQR--RCLRIVLASVAMGVVLLG 461

Query: 179 FKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
               L + LS    +     LA+I+ GAV  +  +I  ++G   L+  + +L+  K
Sbjct: 462 AATILSDVLSLAY-WRYLALLALIVVGAVAYF--TIGQIIGAFRLSEFRSALRRGK 514


>gi|296112739|ref|YP_003626677.1| integral membrane protein MviN [Moraxella catarrhalis RH4]
 gi|295920433|gb|ADG60784.1| integral membrane protein MviN [Moraxella catarrhalis RH4]
          Length = 516

 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 76/157 (48%), Gaps = 11/157 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS+    + +   +  + A   +L  GIP +  + +L   ++  L+ RG FT QD
Sbjct: 290 ILPSLSSSRAKSDDENFRQTLDWAARLILVIGIPASLAIFVLSDILMDALFVRGQFTHQD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLF- 119
            ++    L   S  I+GF+L ++    F+A  D KTP K  I+S+       V+ IGLF 
Sbjct: 350 ALMSGIALKSLSGGILGFMLIKIFAPAFFANQDTKTPVKIGIISVFANMIFSVVFIGLFY 409

Query: 120 ----PFIGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
               P  GG  +AT   S+V      L   +L RR I
Sbjct: 410 LMKLPLHGGLALATTAASFV---NAGLLYTVLHRRGI 443


>gi|29653737|ref|NP_819429.1| virulence factor [Coxiella burnetii RSA 493]
 gi|161830513|ref|YP_001596333.1| integral membrane protein MviN [Coxiella burnetii RSA 331]
 gi|29541000|gb|AAO89943.1| virulence factor [Coxiella burnetii RSA 493]
 gi|161762380|gb|ABX78022.1| integral membrane protein MviN [Coxiella burnetii RSA 331]
          Length = 515

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 2/174 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+     ++ Q  S   + A+   +  G+P    L +L   ++ TL   GAFTA D
Sbjct: 289 VLPNLARQHSQKSAQAYSATLDWALRMAMLIGVPAAVALFILAGPLLATLIYHGAFTAHD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  +S  + GF+L ++L S FY+R +VKTP K    ++V+   +   L   + 
Sbjct: 349 VLMTRRSLWAFSVGLPGFMLVKILASAFYSRQNVKTPVKIATAAVVVNLTLNAVLIHPLA 408

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQID-LPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N + L   LL+ +    LP  T   IL +  ++G+MG+ I
Sbjct: 409 HAGLALATSLASSFNAVLLLYFLLRDKIYQPLPHWTKL-ILRLLFANGIMGLAI 461


>gi|251789872|ref|YP_003004593.1| integral membrane protein MviN [Dickeya zeae Ech1591]
 gi|247538493|gb|ACT07114.1| integral membrane protein MviN [Dickeya zeae Ech1591]
          Length = 511

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++   N Q+ S L +  +       +P T  L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSVASGNHQEYSRLLDWGLRLCFVLALPATVALGLLAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L +VL+  FYAR D+KTP K  + ++VM
Sbjct: 347 AMMTQRALVAYSIGLMGLILVKVLVPGFYARQDIKTPVKIAMATLVM 393


>gi|271500746|ref|YP_003333771.1| integral membrane protein MviN [Dickeya dadantii Ech586]
 gi|270344301|gb|ACZ77066.1| integral membrane protein MviN [Dickeya dadantii Ech586]
          Length = 511

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++   + Q+ S L +  +       +P T  L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSVASGDHQEYSRLLDWGLRLCFLLALPATVALGLLAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L +VL+  FYAR D+KTP K  I ++VM
Sbjct: 347 AMMTQRALVAYSIGLMGLILVKVLVPGFYARQDIKTPVKIGIATLVM 393


>gi|326793614|ref|YP_004311434.1| integral membrane protein MviN [Marinomonas mediterranea MMB-1]
 gi|326544378|gb|ADZ89598.1| integral membrane protein MviN [Marinomonas mediterranea MMB-1]
          Length = 549

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 90/178 (50%), Gaps = 2/178 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +   EN  +     + A+  ++   +P +  L  L + +I T++ RGA +A D
Sbjct: 325 ILPSLSRSFAAENSAKFVSTLDWALRVLVVIALPSSVALFFLAEPLIATIFYRGALSAND 384

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
             + +  L  YS  +V  +L +VL   +YAR D KTP +  I+++V   V  + L +PF 
Sbjct: 385 VQMAALSLQAYSIGLVFMMLIKVLAPGYYARQDTKTPVRIGIIAMVSNMVFNLILVWPF- 443

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           G  G+A A      +N   L   L K +      + +  + S+F++  ++G +I F++
Sbjct: 444 GHVGLALATSLSAGLNAFLLWRGLAKDKYFVWHVRWLRHVASLFMACCVLGGWIYFYQ 501


>gi|58696843|ref|ZP_00372365.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225630673|ref|YP_002727464.1| integral membrane protein MviN [Wolbachia sp. wRi]
 gi|58536953|gb|EAL60119.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592654|gb|ACN95673.1| integral membrane protein MviN [Wolbachia sp. wRi]
          Length = 498

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 114/229 (49%), Gaps = 12/229 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   Q+ N +   +++N+A+   L   +P TA  +++P  I+ TL+  G F    
Sbjct: 277 LLPLISK--QVNNTENIVKIQNKALNIGLMLIMPTTAAFIIIPDIILLTLFSYGRFDHYA 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  +S  +  F++++VLL  F+A+ ++K P  F ++ + +  V+ + L     
Sbjct: 335 VQQTVPTLIAFSLSLPAFIINKVLLPTFFAKGNLKIPTIFSLMCLGINVVLNLLLMNKYQ 394

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W+N+I L   L   +   +    +  I+ IF+++ +M + +  F   L
Sbjct: 395 HTGIAIATSVSTWINSILLISYLTINKMYKVSQALLLNIMKIFVATAVMSIALYIFNSLL 454

Query: 184 ----FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKY 228
               F+++ A   +     LA +++ +V+VY  ++ L   +G L +LKY
Sbjct: 455 AGLFFDKMLARIVY-----LATLIALSVIVYFGTLYLTF-RGSLNNLKY 497


>gi|332042014|gb|EGI78352.1| integral membrane protein MviN [Hylemonella gracilis ATCC 19624]
          Length = 539

 Score = 72.4 bits (176), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 4   LLPKLSSAIQLENKQQS----SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           L+P+L++A  + + QQ     SEL +  +  V+   +PC+  LL+  + +   LY  GAF
Sbjct: 312 LMPQLAAAKSMSDAQQGASRYSELLDWGLRLVVLLAVPCSLALLLFAQPLTAALYHYGAF 371

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           TA+D  + ++ L  +   ++G +  +VL   +YA  D++TP +  I+ +V+  ++ I L 
Sbjct: 372 TARDVQMTAAALMGWGAGLLGVVAVKVLAPGYYASQDIRTPVRIAIVVLVLTQLLNIVLV 431

Query: 120 PF 121
           P 
Sbjct: 432 PL 433


>gi|126666691|ref|ZP_01737668.1| integral membrane protein MviN [Marinobacter sp. ELB17]
 gi|126628736|gb|EAZ99356.1| integral membrane protein MviN [Marinobacter sp. ELB17]
          Length = 562

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 101/218 (46%), Gaps = 11/218 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  Q S   + A+  VL  G+P    L +L + +I TL+  G  T +D
Sbjct: 340 ILPSLSRKHTADSADQFSATLDWAVRAVLIIGVPSALALGLLAEPLIATLFHYGEVTDRD 399

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
             + +  L  YS  ++ F++ +VL   F+AR D++TP K  I+++V   V   I +FP +
Sbjct: 400 VAMSAQSLRAYSAGLLAFMVIKVLAPGFFARQDIRTPVKIGIIAMVANMVFNLILIFP-L 458

Query: 123 GGYGIATAEVSWVWVNTICLAVALLK----RRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
              G+A A     W+N   L   L      R Q   P    + +     +  L+ + +  
Sbjct: 459 AHAGLALATSLSAWLNAFLLWRGLKAIGAWRSQ---PGWGKFGLQLALANGALVAVILWL 515

Query: 179 FKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
             P   NQ  A   F   +++AI++    L Y  +++L
Sbjct: 516 NAPV--NQWLAAGGFQRSQDMAILVIAGTLAYFVTLAL 551


>gi|254485948|ref|ZP_05099153.1| integral membrane protein MviN [Roseobacter sp. GAI101]
 gi|214042817|gb|EEB83455.1| integral membrane protein MviN [Roseobacter sp. GAI101]
          Length = 530

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 86/174 (49%), Gaps = 5/174 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++Q S    +RA E  L   IP    L+++P  +   L++RGA +  D
Sbjct: 303 LLPDLSRRLKAGDEQGSHTQISRAAEVSLALTIPSAVALMVIPFTLASVLFQRGATSVDD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L ++L   +YAR D K P  F + ++V+  V+A+GL P +G
Sbjct: 363 AAAIAIAVAIYGLGLPAFVLQKILQPLYYAREDTKRPFYFAVCAMVVNVVLAVGLSPVVG 422

Query: 124 --GYGIATAEVSWVWVNTICL-AVALLKRRQIDLPFQTIYRILSIFISSGLMGM 174
                IAT    W     +   A       + D  F T  RI  I  +S +MG+
Sbjct: 423 WIAPAIATTLAGWAMFGLLAFGARGFGLAAKFDARFHT--RIWRILAASAIMGV 474


>gi|237746891|ref|ZP_04577371.1| virulence factor MviN [Oxalobacter formigenes HOxBLS]
 gi|229378242|gb|EEO28333.1| virulence factor MviN [Oxalobacter formigenes HOxBLS]
          Length = 516

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 80/159 (50%), Gaps = 2/159 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    ++++ S L +  +       +P + +L+ LP     TL+  G F++QD
Sbjct: 291 LLPSLSKAHANNDEKEYSSLLDWGLRLTFLLALPASVMLMTLPVPFTATLFHYGKFSSQD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S+ L  Y   ++G ++ R+L   FYA+ D+KTP K  +  +V+  ++ +   P   
Sbjct: 351 VFMTSNALIAYGIGLIGLIVVRILAPGFYAKQDIKTPVKIAVGVLVVTQLMNLIFVPLYA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G+A +       N   L   +L+RR I  P Q+ +RI
Sbjct: 411 HAGLALSIGIGACFNAAIL-FFMLRRRGIYRP-QSGWRI 447


>gi|330993436|ref|ZP_08317371.1| Virulence factor mviN-like protein [Gluconacetobacter sp. SXCC-1]
 gi|329759466|gb|EGG75975.1| Virulence factor mviN-like protein [Gluconacetobacter sp. SXCC-1]
          Length = 506

 Score = 72.0 bits (175), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 105/216 (48%), Gaps = 4/216 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  +   +   +   +NRA+ Y L   +P  A LL++   I+  L+  G F+A D
Sbjct: 273 LLPVLTRYLAAGDIAGAHTTQNRALSYALILTLPAAAGLLVVAAPIMMALFGHGQFSAHD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +L +  L  Y+  +  F+L +VL   F+AR D +TP    + ++V+ FV+ +    ++ 
Sbjct: 333 AVLAAQSLRAYAVGLPAFVLVKVLSPGFFARGDTRTPVLVGMGTLVLNFVLNLSFMHWLA 392

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFIS-SGLM-GMFIVFFKP 181
             G   A      VN   LA  LL RR   LP   + R L+  +  +GLM G  +V  + 
Sbjct: 393 HVGPPLASSLAAMVNAGVLAW-LLMRRGALLPDAGLARQLAGMLGCAGLMAGGLVVLGQT 451

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
            L   + A  A     ++ +++   V +YL ++ LL
Sbjct: 452 PLGGAMQAG-ALMRLVDVGVLIMLGVALYLGALQLL 486


>gi|294648774|ref|ZP_06726232.1| integral membrane protein MviN family protein [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292825344|gb|EFF84089.1| integral membrane protein MviN family protein [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 513

 Score = 71.6 bits (174), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  GIP +  L ML   IIQ L++RG FT QD
Sbjct: 287 ILPSLSARHAEQDQTKFRGMLDWAAKIIMLVGIPASIALFMLSTPIIQALFQRGEFTLQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA---IGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++    ++    IGLF 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLIAVAANAILNVLFIGLFK 406

Query: 121 FIG 123
             G
Sbjct: 407 LNG 409


>gi|296115102|ref|ZP_06833743.1| integral membrane protein MviN [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978203|gb|EFG84940.1| integral membrane protein MviN [Gluconacetobacter hansenii ATCC
           23769]
          Length = 554

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  +     Q +  + NRAIEY L   +P T  L+++ + ++ TL+  G+F+A D
Sbjct: 315 LLPVLTRHLARGEIQDAHAIHNRAIEYALVLTLPATLGLILVAEPVMMTLFGHGSFSAHD 374

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            ++ +  L  Y+  +  F++ +VL   F+AR D +TP
Sbjct: 375 AVMSAQSLRAYALGLPAFVMVKVLSPGFFARGDTRTP 411


>gi|260771785|ref|ZP_05880703.1| hypothetical protein VIB_000223 [Vibrio metschnikovii CIP 69.14]
 gi|260613077|gb|EEX38278.1| hypothetical protein VIB_000223 [Vibrio metschnikovii CIP 69.14]
          Length = 538

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 90/174 (51%), Gaps = 2/174 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      ++   ++  +  +  V+  GIP    L++L K ++  L+ RG F+A D
Sbjct: 314 ILPALSRKHVDAHQAGFAQTMDWGVRMVILLGIPAMLGLMVLAKPMLMVLFMRGEFSAHD 373

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPFI 122
               S  L  YST ++ F+L +VL   +Y+R D+KTP ++ I++++   +  AI  +PF 
Sbjct: 374 VQQASLSLFAYSTGLLNFMLIKVLAPGYYSRQDIKTPVRYGIVAMLSNIIFNAIFAWPF- 432

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
           G  G+A A     ++N   L   L ++    +  QT+  I  + I+  +M M I
Sbjct: 433 GYVGLAAATALSAFINMALLYRGLHQQGVYKVTTQTLAFIARLVIAGAVMVMAI 486


>gi|226952280|ref|ZP_03822744.1| virulence factor MviN family protein [Acinetobacter sp. ATCC 27244]
 gi|226836946|gb|EEH69329.1| virulence factor MviN family protein [Acinetobacter sp. ATCC 27244]
          Length = 513

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 67/123 (54%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  GIP +  L ML   IIQ L++RG FT QD
Sbjct: 287 ILPSLSARHAEQDQTKFRGMLDWAAKIIMLVGIPASIALFMLSTPIIQALFQRGEFTLQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA---IGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++    ++    IGLF 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLIAVAANAILNVLFIGLFK 406

Query: 121 FIG 123
             G
Sbjct: 407 LNG 409


>gi|312135269|ref|YP_004002607.1| integral membrane protein mvin [Caldicellulosiruptor owensensis OL]
 gi|311775320|gb|ADQ04807.1| integral membrane protein MviN [Caldicellulosiruptor owensensis OL]
          Length = 523

 Score = 71.6 bits (174), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 93/180 (51%), Gaps = 2/180 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K++  +    +I  ++   +P TAI+L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKEEFKKYLVLSINSLILIMVPITAIVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S     +S   +G+ +  +L   FY+  D  TP K  I  + +  ++ I L  F
Sbjct: 344 RSTYLTSGAFMFFSLGYLGYAVREILSRTFYSIQDTLTPMKNGIFVVAINVILNIVLVKF 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           +   G+A       +V+   L  +L K+  +I+L    +  I ++F +S +M + I+F K
Sbjct: 404 LKHRGLALGTSIVAYVSVFLLMRSLFKKIGKIELKSSLVVFIKALF-ASFVMAISIIFAK 462


>gi|329891102|ref|ZP_08269445.1| integral membrane protein MviN [Brevundimonas diminuta ATCC 11568]
 gi|328846403|gb|EGF95967.1| integral membrane protein MviN [Brevundimonas diminuta ATCC 11568]
          Length = 565

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLPKLS+A+  ++  Q     + A+   +   +P  A L+ +P  +I  L+ RGAF   
Sbjct: 323 ALLPKLSAAVASQDHGQQQASMDEALILSMALTLPAAAALMAMPYFLIDALFTRGAFLQI 382

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF- 121
           D +  +  L  +   +  F+L R+L   F+AR D + P  F ++S+ +   +AIGLF   
Sbjct: 383 DAVNTAHALLHFGWGVPAFVLIRILAPAFFARGDTRRPMVFALVSVAVNAALAIGLFYLG 442

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
           +G  GIA A  +  W N I LA  L +R       + ++R+  I ++S
Sbjct: 443 MGVSGIAAAVSASAWTNVILLAATLWRRGHYRPSPRAVWRLGRIALAS 490


>gi|329895214|ref|ZP_08270878.1| Proposed peptidoglycan lipid II flippase MurJ [gamma
           proteobacterium IMCC3088]
 gi|328922452|gb|EGG29794.1| Proposed peptidoglycan lipid II flippase MurJ [gamma
           proteobacterium IMCC3088]
          Length = 531

 Score = 71.6 bits (174), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 68/126 (53%), Gaps = 1/126 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N +Q+  + + A+  V+   +P T  L +L + I+ TL++ GA    D
Sbjct: 301 ILPNLSDLKAQQNSEQAKRVLDWAVRMVVLIALPATVALWILSEPILITLFQYGAMQEHD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG-LFPFI 122
             + +  +  Y+  ++ F+L +VL   FYA+ D KTP K  ++++V   V+ +  +FP +
Sbjct: 361 IAMATLSMRAYALGLLAFMLIKVLAPGFYAQKDTKTPVKIGVIAMVSNMVLNVAFVFPLM 420

Query: 123 GGYGIA 128
             Y + 
Sbjct: 421 HWYDVG 426


>gi|89053387|ref|YP_508838.1| integral membrane protein MviN [Jannaschia sp. CCS1]
 gi|88862936|gb|ABD53813.1| integral membrane protein MviN [Jannaschia sp. CCS1]
          Length = 543

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 92/178 (51%), Gaps = 14/178 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++ ++     E  +RA E  +   IP    LL++   +I  L++RGAFTA D
Sbjct: 315 LLPDLSRRLRADDDAGGREALSRAGELAMALTIPAAVALLVISVPLISVLFQRGAFTADD 374

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  LSIY+  +  F+L +VL   ++AR D + P ++ ++++ +  V+A+GL   IG
Sbjct: 375 TASTAVALSIYALGLPAFVLQKVLQPVYFAREDTRRPFQYALVAMAVNAVVAVGLSFAIG 434

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR--------QIDLPFQT-IYRILSIFISSGLM 172
               A A     WV      V LL R         Q D  F++ I+RI +  ++ GLM
Sbjct: 435 FLAAAVATTLAAWV-----MVGLLSRGRTDFGDVVQFDDRFRSKIWRICAASVAMGLM 487


>gi|307130870|ref|YP_003882886.1| putative inner membrane protein [Dickeya dadantii 3937]
 gi|306528399|gb|ADM98329.1| predicted inner membrane protein [Dickeya dadantii 3937]
          Length = 511

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++   N Q+ S L +  +       +P T  L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSVASGNHQEYSRLLDWGLRLCFLLALPATVALGLLAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L +VL+  FYAR D+KTP K  + ++ M
Sbjct: 347 ALMTQRALVAYSIGLMGLILVKVLVPGFYARQDIKTPVKIGMATLAM 393


>gi|255320657|ref|ZP_05361834.1| integral membrane protein MviN [Acinetobacter radioresistens SK82]
 gi|255302273|gb|EET81513.1| integral membrane protein MviN [Acinetobacter radioresistens SK82]
          Length = 513

 Score = 71.2 bits (173), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A   ++  GIP +  L ML   IIQ L+ERG FT +D
Sbjct: 287 ILPSLSARHAEQDQTKFRGMLDWAARVIMLVGIPASIALFMLSTPIIQALFERGEFTWED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA---IGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++    ++    IG F 
Sbjct: 347 TQMTALALQCMSAGVIAFMLIKVFAPGFYAQQDTKTPVRVGLIAVATNAILNIVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|262380710|ref|ZP_06073863.1| integral membrane protein MviN [Acinetobacter radioresistens SH164]
 gi|262297658|gb|EEY85574.1| integral membrane protein MviN [Acinetobacter radioresistens SH164]
          Length = 513

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A   ++  GIP +  L ML   IIQ L+ERG FT +D
Sbjct: 287 ILPSLSARHAEQDQTKFRGMLDWAARVIMLVGIPASIALFMLSTPIIQALFERGEFTWED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA---IGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++    ++    IG F 
Sbjct: 347 TQMTALALQCMSAGVIAFMLIKVFAPGFYAQQDTKTPVRVGLIAVATNAILNIVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|71066313|ref|YP_265040.1| MviN family virulence factor [Psychrobacter arcticus 273-4]
 gi|71039298|gb|AAZ19606.1| putative virulence factor, mviN; MOP flippase superfamily
           [Psychrobacter arcticus 273-4]
          Length = 516

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +   ++     +  + A   ++  G+P +A L +L   ++Q L+ RG FT +D
Sbjct: 290 ILPSLSKSEAQKDDVSFKKTLDWAARLIILVGVPASAALFILSDVLMQALFLRGEFTLRD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLF- 119
             + S  L   +  I+GF+L +V    F+AR D++TP K  I+S+       VI IG+F 
Sbjct: 350 AQMSSLALKSMAGGILGFMLIKVFAPAFFARQDIRTPVKIGIISVFANMIFSVIFIGIFY 409

Query: 120 ----PFIGGYGIATAEVSWV 135
               P  GG  +AT   S+V
Sbjct: 410 FLEIPLHGGLALATTGASFV 429


>gi|262374503|ref|ZP_06067777.1| integral membrane protein MviN [Acinetobacter junii SH205]
 gi|262310499|gb|EEY91589.1| integral membrane protein MviN [Acinetobacter junii SH205]
          Length = 513

 Score = 71.2 bits (173), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  GIP +  L ML   IIQ L++RG FT +D
Sbjct: 287 ILPSLSARHAEQDQAKFKSMIDWAAKIIMLVGIPASIALFMLSTPIIQALFQRGEFTLED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++       V+ IG F 
Sbjct: 347 THMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMAVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LIDWHA 412


>gi|78484838|ref|YP_390763.1| integral membrane protein MviN [Thiomicrospira crunogena XCL-2]
 gi|78363124|gb|ABB41089.1| Multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) flippase
           superfamily protein [Thiomicrospira crunogena XCL-2]
          Length = 498

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 104/216 (48%), Gaps = 15/216 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      N +   +  + A+  VL  G+P T  LL+L + ++ TL+  GAFT  D
Sbjct: 274 VLPGLSKKAATANWEGFRQDIDTALRLVLIIGVPATLGLLLLAQPLMITLFYYGAFTEND 333

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++GF+L ++L   FYAR D+KTP K  ++++V   V+ + L     
Sbjct: 334 VTMSGMSLMAYSFGLLGFILVKILAPAFYARKDMKTPVKIAVVALVTNTVMNLALIGPFA 393

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS-IFISSGLMGMFIVFFKPC 182
             G+A A     +VN   L  +L K+     P     ++   + +++ ++ +FI+   P 
Sbjct: 394 HVGLAAATSISAFVNAGLLYWSLRKQHAFS-PLPGWGKLWGQVLLANSVLVIFILVITP- 451

Query: 183 LFNQLSAETAFSPFKNLAIILS---------GAVLV 209
               +S    F  +  LA +L+         GAVLV
Sbjct: 452 ---DVSEWLVFDAWHRLAWLLTIVFGTMAVYGAVLV 484


>gi|312793647|ref|YP_004026570.1| integral membrane protein mvin [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180787|gb|ADQ40957.1| integral membrane protein MviN [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 523

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 1/168 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K +  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKDEFKKYLVLSINSLILIMVPITAAVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  IL++ +  V+ I L  +
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTITPMKNGILAVAINIVLNIVLVKY 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFIS 168
           +   G+A       +V+   L  +L K+  +I+L    I  + ++F S
Sbjct: 404 LKHKGLALGTSIVAYVSVFLLMRSLFKKIGKIELKSSMIVFVKALFAS 451


>gi|260771136|ref|ZP_05880063.1| hypothetical protein VFA_004201 [Vibrio furnissii CIP 102972]
 gi|260613733|gb|EEX38925.1| hypothetical protein VFA_004201 [Vibrio furnissii CIP 102972]
 gi|315179258|gb|ADT86172.1| MviN protein [Vibrio furnissii NCTC 11218]
          Length = 520

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    ++  +  +  V+  G+P    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAQTMDWGVRMVILLGVPAMLGLMVLAKPMLMVLFMRGEFTPDD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  YS  ++ F+L +VL   +Y+R D KTP +F I++++   V       F G
Sbjct: 356 VHMASMSLLAYSAGLLNFMLIKVLAPGYYSRQDTKTPVRFGIVAMLSNMVFNAIFGWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L K+    +  +TI  I+ + ++ G M
Sbjct: 416 YVGLAAATALSAFINMALLYRGLHKQGVYVISARTIGFIVRLLVAGGAM 464


>gi|312875855|ref|ZP_07735845.1| integral membrane protein MviN [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311797336|gb|EFR13675.1| integral membrane protein MviN [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 523

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 86/168 (51%), Gaps = 1/168 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K +  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKDEFKKYLVLSINSLILIMVPITAAVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  IL++ +  V+ I L  +
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTITPMKNGILAVAINIVLNIVLVKY 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFIS 168
           +   G+A       +V+   L  +L K+  +I+L    I  + ++F S
Sbjct: 404 LKHKGLALGTSIVAYVSVFLLMRSLFKKIGKIELKSSMIVFVKALFAS 451


>gi|261250333|ref|ZP_05942909.1| hypothetical protein VIA_000353 [Vibrio orientalis CIP 102891]
 gi|260939449|gb|EEX95435.1| hypothetical protein VIA_000353 [Vibrio orientalis CIP 102891]
          Length = 520

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 83/170 (48%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           ++  +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDAQSDGFAQTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQFASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAWFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       L  +T+  I+ + I+ GLM
Sbjct: 415 GYVGLAIATALSAFVNMSLLYRGLHLSGVYKLTRRTVLFIIKLVIAGGLM 464


>gi|312622307|ref|YP_004023920.1| integral membrane protein mvin [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202774|gb|ADQ46101.1| integral membrane protein MviN [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 523

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 87/168 (51%), Gaps = 1/168 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS     E K++  +    +I  ++   +P TA +L+L +EI+Q +YERGAF +
Sbjct: 284 AVIYPYLSRFFSSEKKEEFKKYLLLSINSLILIMVPITAAVLVLSREIVQFVYERGAFDS 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  IL++ +  V+ I L  +
Sbjct: 344 RSTYLTSGALMFFSLGYLGYAVREILSRTFYSIQDTLTPMKNGILAVAINIVLNIVLVKY 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFIS 168
           +   G+A       +V+   L  +L K+  +IDL    I  + ++F S
Sbjct: 404 LKHRGLALGTSIVAYVSVFLLMRSLFKKIGKIDLKSSMIVFVKALFAS 451


>gi|56460238|ref|YP_155519.1| MviN-like membrane protein [Idiomarina loihiensis L2TR]
 gi|56179248|gb|AAV81970.1| MviN-like membrane protein [Idiomarina loihiensis L2TR]
          Length = 520

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS    ++ +  S   +  I  VL  G+P  A L +L + ++  L+  GAF+  D
Sbjct: 296 ILPALSSRHVDKSTENFSATLDWGIRMVLLLGVPAMAGLFVLAEPMLMVLFMHGAFSPDD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL---FP 120
             + S  L  YST ++ F++ +VL + FY+R D K P K+ I+++    V  I L   F 
Sbjct: 356 ARMASYSLMAYSTGLLSFMMVKVLATGFYSRQDTKRPVKYGIIAMAANMVFNIALAIPFS 415

Query: 121 FIG 123
           ++G
Sbjct: 416 YVG 418


>gi|304320814|ref|YP_003854457.1| membrane protein [Parvularcula bermudensis HTCC2503]
 gi|303299716|gb|ADM09315.1| uncharacterized membrane protein [Parvularcula bermudensis
           HTCC2503]
          Length = 532

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 13/159 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYER------- 56
           L+P +S A++ ++++ +    NR +E  LF  +P  A L+++P  I   L++        
Sbjct: 290 LMPTISRAVKADDQKGAMRSLNRGMEIALFLSLPAAAALIVIPDLICAALFQDLAGLATR 349

Query: 57  ------GAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
                  AF   D       L I+   +  F+L ++  + F+AR D +TP  F +++I +
Sbjct: 350 AIGAGGSAFGDTDVDRTGVALMIFGWGLPAFVLQKIFAAAFFAREDTRTPMTFALVAIAI 409

Query: 111 GFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKR 149
              ++I LFP IG   +    +   W     LA  L  R
Sbjct: 410 NAALSISLFPVIGFLSVPLGTICASWTEVSLLASRLRHR 448


>gi|160871886|ref|ZP_02062018.1| integral membrane protein MviN [Rickettsiella grylli]
 gi|159120685|gb|EDP46023.1| integral membrane protein MviN [Rickettsiella grylli]
          Length = 511

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 81/153 (52%), Gaps = 3/153 (1%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           M  +LP LS     ++ +  S   N  +   L  GIP +  LL+L   +I TL+  G FT
Sbjct: 284 MTVILPHLSRQHAEKSPELFSSTLNWGLRCNLLIGIPASLTLLILSGPLIVTLFHYGKFT 343

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG-FVIAIGLF 119
            +D ++    +  YS  +  F+L ++L + FYA+ ++KTP +  I+++++  F  A+ +F
Sbjct: 344 LEDVVMTQRSVIAYSVGLQAFMLIKILAAAFYAKQNIKTPVRIGIIALIVNMFFNALLIF 403

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
           P +   G+A A     W+N + L +  LK R I
Sbjct: 404 P-LKHAGLALASSLSAWLN-VGLLLWGLKSRHI 434


>gi|332038496|gb|EGI74940.1| putative peptidoglycan lipid II flippase MurJ [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 458

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 5/110 (4%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI----LVSSYLSIYSTEIVG 80
           +  + +V+F G+P    L+++   II  L++ GAF  +D+I     VS  +  YS  +V 
Sbjct: 249 DWGVRFVIFLGLPAMVGLMIISPLIITVLFDHGAFK-EDSIDHVKAVSLGVVAYSVGLVS 307

Query: 81  FLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATA 130
           F+L +VL   FYAR D KTP +  I+++V+  V  I L PFIG  G+A A
Sbjct: 308 FMLIKVLAPGFYARQDTKTPVRIGIITLVLNMVFNIMLAPFIGYLGLALA 357


>gi|27904800|ref|NP_777926.1| virulence factor MviN [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|46396396|sp|Q89AI1|MVIN_BUCBP RecName: Full=Virulence factor mviN homolog
 gi|27904198|gb|AAO27031.1| virulence factor MviN [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 513

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 106/223 (47%), Gaps = 13/223 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++   N ++ S L N A+  V    IP   IL  L + +I  L++ GAFT  D
Sbjct: 287 LLPLLSKSVNNINIKEYSRLLNWALRLVCILVIPSIIILFTLSESLITLLFKYGAFTYND 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            I+  + +  YS  ++ F+L ++LL+ FY+  +VKTP K  I  +V+  ++ I    +  
Sbjct: 347 VIMTKNVIEFYSIGLLPFVLIKILLAGFYSIRNVKTPMKISIFILVLTQLMNIFFIKYFQ 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
               A A     W+N   L   L +  +  +P     R L    ++ ++ + ++F    L
Sbjct: 407 YTSFALAISLASWINFFLLYRKLCQ-SEFFIPSTNWLRFLLKIFAAAMVMLILLFINKNL 465

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASL 226
              LSA T    FK L        L Y+C+ S   G G+L +L
Sbjct: 466 I--LSANTHSIFFKILR-------LFYICASS---GGGYLFTL 496


>gi|209694170|ref|YP_002262098.1| virulence factor MviN homolog [Aliivibrio salmonicida LFI1238]
 gi|208008121|emb|CAQ78263.1| virulence factor MviN homolog [Aliivibrio salmonicida LFI1238]
          Length = 519

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 4/201 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           S   +  +  V+  GIP    L++L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRQHVDAKGAGFSNTMDWGVRMVILLGIPAMLGLMVLAKPMLMVLFMRGEFSPND 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y + ++ F+L ++L   +YAR D KTP ++ I+++V   V       F G
Sbjct: 356 VHNASLSLIAYGSGLLNFMLIKILAPGYYARQDTKTPVRYGIIAMVTNMVFNAIFASFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A     +VN   L   L       L  +T+  I+ + +S  +M   +++F P +
Sbjct: 416 YVGLAMATALSAFVNMALLYRGLHLANVYKLSKETMIFIVKLVLSGAIMVGVLLWFIPAM 475

Query: 184 FNQLSAETAFSPFKNLAIILS 204
              L  + A    K +A++LS
Sbjct: 476 NVWLEWDLA----KRMAMLLS 492


>gi|299133390|ref|ZP_07026585.1| integral membrane protein MviN [Afipia sp. 1NLS2]
 gi|298593527|gb|EFI53727.1| integral membrane protein MviN [Afipia sp. 1NLS2]
          Length = 519

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 58/97 (59%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+ + AIQ  ++   +  ++R +E  +   +P T  L++L + II  L++ GAFTA D
Sbjct: 286 LMPEFTHAIQNNDRSALTHAQSRGLELAVGLVLPATLGLILLSEPIIGILFQHGAFTAAD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           T+  +  LS+ +  +  ++L +VL   F+AR D +TP
Sbjct: 346 TVATAQALSVLALGLPAYVLVKVLAPAFFAREDTRTP 382


>gi|85374928|ref|YP_458990.1| putative virulence factor mvin homolog transmembrane protein
           [Erythrobacter litoralis HTCC2594]
 gi|84788011|gb|ABC64193.1| putative virulence factor mvin homolog transmembrane protein
           [Erythrobacter litoralis HTCC2594]
          Length = 526

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 4/162 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  EN++ +  +++ AIE  +   IP    L +     +  +++ G F   
Sbjct: 296 AILPTLSKFVGSENREGADRIQSDAIELSMLLTIPAAVALAICATPFVTMIFQGGRFDIA 355

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP--AKFYILSIVMGFVIAIGLFP 120
           D  +  S L+     +  ++L +VL+  FYAR D +TP  A F  L + + F +A     
Sbjct: 356 DAEVTGSVLAALVMGLPAYVLVKVLVPNFYARADTRTPVYAAFISLGVFVAFNMA--FLQ 413

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G  G+A A V   W+N   L V +  R    LP   + R+
Sbjct: 414 RYGVIGVAFASVIGAWINVCYLYVVMRLRDHYRLPLALLLRV 455


>gi|299131832|ref|ZP_07025027.1| integral membrane protein MviN [Afipia sp. 1NLS2]
 gi|298591969|gb|EFI52169.1| integral membrane protein MviN [Afipia sp. 1NLS2]
          Length = 509

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 72/146 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  I   +   +   + RA ++ L F +P  A  L +P  I++ ++ RGAFT  D
Sbjct: 284 LLPDMSRRISANDHAGAMAAQRRAFDFTLLFSVPFVAAFLTVPDVIMRAMFARGAFTKAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  I +   + + L   + 
Sbjct: 344 AAAAGATLAAYAVGLIPFVLIRSAVATFYARKDTATPVKSALTGIAVNLALKLALVGSLA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A     WVN + +    ++R
Sbjct: 404 QIGLALATAVGQWVNLLLVTGFAIRR 429


>gi|262274903|ref|ZP_06052714.1| hypothetical protein VHA_001885 [Grimontia hollisae CIP 101886]
 gi|262221466|gb|EEY72780.1| hypothetical protein VHA_001885 [Grimontia hollisae CIP 101886]
          Length = 519

 Score = 70.1 bits (170), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 102/215 (47%), Gaps = 3/215 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++    +   +  +  VL  G P    +++L K ++  L+ RG F A D
Sbjct: 296 ILPALSKKHVEQSAGHFASTMDWGVRMVLLLGGPAMVGMIVLAKPMLMVLFMRGEFGADD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   ++AR D KTP ++ I+++V   V  + +F +  
Sbjct: 356 VTAASLSLVAYTSGLLNFMLIKVLAPGYFARQDTKTPVRYGIIAMVSNMVFNL-IFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      VN   L   L K++   +  +T+   L +     LMG  + +  P 
Sbjct: 415 GYVGLAIATALSALVNAALLYRGLHKQQVYRVSRETVIFTLRLVSGVVLMGGVLYYLMPA 474

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
            F Q  A + +     LA +++     Y+ ++ +L
Sbjct: 475 -FEQWLAMSLWQRGYTLAGLIAAGAGTYVIALVVL 508


>gi|93006863|ref|YP_581300.1| integral membrane protein MviN [Psychrobacter cryohalolentis K5]
 gi|92394541|gb|ABE75816.1| integral membrane protein MviN [Psychrobacter cryohalolentis K5]
          Length = 516

 Score = 70.1 bits (170), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +   ++     +  + A   ++  G+P +A L +L   ++Q L+ RG FT +D
Sbjct: 290 ILPSLSKSEAQKDDVSFKKTIDWAARLIILVGVPASAALFILSDVLMQALFLRGEFTLRD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLF- 119
             + S  L   +  I+GF+L +V    F+AR D++TP +  I+S+       VI IG+F 
Sbjct: 350 AQMSSLALKSMAGGILGFMLIKVFAPAFFARQDIRTPVRIGIISVFANMIFSVIFIGIFY 409

Query: 120 ----PFIGGYGIATAEVSWV 135
               P  GG  +AT   S+V
Sbjct: 410 FLEIPLHGGLALATTGASFV 429


>gi|329114630|ref|ZP_08243389.1| Virulence factor MviN [Acetobacter pomorum DM001]
 gi|326696110|gb|EGE47792.1| Virulence factor MviN [Acetobacter pomorum DM001]
          Length = 516

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  +       +   +NR+IEYVL   +P  A LL+L   I+  L+  G+FT  D
Sbjct: 285 LLPVLTRHLAAGETDAAHAAQNRSIEYVLLLTLPAVAGLLVLAGPIMIVLFGHGSFTEHD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            +L +  L  Y+  +  F+L +VL   F+AR D +TP
Sbjct: 345 ALLSAQSLRAYAIGLPAFVLVKVLSPAFFARGDTRTP 381


>gi|87123003|ref|ZP_01078862.1| Virulence factor MVIN-like [Marinomonas sp. MED121]
 gi|86161720|gb|EAQ63026.1| Virulence factor MVIN-like [Marinomonas sp. MED121]
          Length = 526

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 77/164 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +   +  ++ + + +  +  VL   +P +  L +L + +I T++ RGA T  D
Sbjct: 305 ILPSLSRSFAGDESKRFTSILDWGLRTVLLIAVPSSLALYLLAEPLIATIFYRGALTVHD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  +V  +L +VL   +YAR D KTP K  I+++V   V  + L    G
Sbjct: 365 VSMAAMSLQAYSVGLVFMMLIKVLAPAYYARQDTKTPVKIGIIAMVANMVFNLILVGPFG 424

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFI 167
             G+A A     ++N   L   L  R         I   L+I +
Sbjct: 425 HVGLAMATTLSAFLNAFLLWRGLRARNLHRFSLDWIKPCLAILV 468


>gi|127512030|ref|YP_001093227.1| integral membrane protein MviN [Shewanella loihica PV-4]
 gi|126637325|gb|ABO22968.1| integral membrane protein MviN [Shewanella loihica PV-4]
          Length = 519

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 104/217 (47%), Gaps = 4/217 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           ++  +  I+ +L  G+P    L++L K ++  L+ RGAFT  D
Sbjct: 296 ILPALSKKHVNAEGDGFAKTMDWGIKAILLMGVPAMCGLIVLAKPMLMVLFMRGAFTLDD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I+++V   V   I +FPF 
Sbjct: 356 VDMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIVAMVSNMVFNLIFVFPF- 414

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A A      +N   L   L +     +P QT   +    +++ LM   +    P 
Sbjct: 415 GYVGLAIATSLSALLNASLLYRGLHRAGVYQIPRQTFVFMGKTLVAAALMIAVLYLLLPS 474

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLG 219
           +   L A +       LA ++    +VYL ++ LLLG
Sbjct: 475 IDTWL-ALSFMGRATQLAYLIGAGAVVYLLAM-LLLG 509


>gi|254450162|ref|ZP_05063599.1| integral membrane protein MviN [Octadecabacter antarcticus 238]
 gi|198264568|gb|EDY88838.1| integral membrane protein MviN [Octadecabacter antarcticus 238]
          Length = 544

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 84/176 (47%), Gaps = 5/176 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +   +        NRA E  L   IP    L+++P  +I  L+ERGAF   D
Sbjct: 317 LLPDLSRRLAAGDLDGGRNAFNRASELALALTIPAAVALIVIPVPLISVLFERGAFDTDD 376

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  + +Y   +  F+L + L   ++AR D K P  +  +++++   +AIGL  +IG
Sbjct: 377 TAATALAVMVYGLGLPAFVLQKALQPLYFARGDTKRPFYYAAVAMIVNAGVAIGLSIYIG 436

Query: 124 GYGIATAEVSWVWVNTICL---AVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
               A A     WV    L   +  +    Q D  F++  R+  I ++S LMG+ +
Sbjct: 437 YIAAALATTLAGWVMVWLLWRGSRTMGDAAQFDARFKS--RLWRIMLASVLMGVLL 490


>gi|121605895|ref|YP_983224.1| integral membrane protein MviN [Polaromonas naphthalenivorans CJ2]
 gi|120594864|gb|ABM38303.1| integral membrane protein MviN [Polaromonas naphthalenivorans CJ2]
          Length = 521

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 88/175 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    +  + S + +  +  V+   +PC   LL   + ++ TLY  GAFT +D
Sbjct: 298 LTPQLAAAKGAGDGARYSAMLDWGLRIVVLLAMPCAVALLTFSEPLVATLYHYGAFTDRD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   ++G +  +VL   FYA  ++KTP K  ++ +V+  ++ + L P+  
Sbjct: 358 VQQTTHALMGYGAGLLGLVAIKVLAPGFYASQNIKTPVKIAVVVLVITQLLNLALVPYFQ 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
             G+A A      +N + L + L++R         +   L +F +S L+ +F+++
Sbjct: 418 HAGLALAIGIGALINALALLIGLIRRGSYTPAPGWVLFGLRVFSASALLAVFLLW 472


>gi|119946879|ref|YP_944559.1| integral membrane protein MviN [Psychromonas ingrahamii 37]
 gi|119865483|gb|ABM04960.1| integral membrane protein MviN [Psychromonas ingrahamii 37]
          Length = 521

 Score = 69.7 bits (169), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 112/220 (50%), Gaps = 15/220 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS+   ++    ++  +  +  V   G P    L++L + +++ L+ RG F A D
Sbjct: 296 ILPSLSSSHVTKSIDDFAKTLDWGMRMVCILGFPAMLGLIILAEPMLRVLFMRGEFVAHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F++ ++L   +YAR D +TP K+ ++++    V+ I +F    
Sbjct: 356 VAMASMSLWAYGSGLLSFMMVKILAPGYYARQDTRTPVKYGMIAMGSNMVLNI-IFAIPY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKR----RQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           GY G+A A      +N   L   L ++    RQ D    ++  +L I I+  +M   +V 
Sbjct: 415 GYVGLAIATSISATLNAGLLWFGLYQKGIYQRQKD----SVSVLLRIIIAGLVMAAGLVA 470

Query: 179 FKPCL--FNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
           F P L  ++QLS   A    K   +I++GAVL YL ++ L
Sbjct: 471 FNPALSEWSQLSWLEA--ALKLFYLIVAGAVL-YLFALGL 507


>gi|114797264|ref|YP_759249.1| integral membrane protein MviN [Hyphomonas neptunium ATCC 15444]
 gi|114737438|gb|ABI75563.1| integral membrane protein MviN [Hyphomonas neptunium ATCC 15444]
          Length = 518

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP+LS A +  +    S   +  +   +   +P  A L++ P  +I   + RGAF   
Sbjct: 285 AILPRLSRAARAGDGAAGSRTMDEGLGLAMALTLPAAASLMVAPVFLIDAFFVRGAFLPS 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D +   + L  ++  +  F+L +VL   F+AR D KTP +F ++S+V+  ++  GLF ++
Sbjct: 345 DAVAAGAALFHFAWGVPAFVLIKVLAPPFFAREDTKTPMRFALVSVVINTLLGAGLFFWL 404

Query: 123 G--------GYGIATAEVSWV 135
                    G  IAT+  SWV
Sbjct: 405 KQSGQMGFTGLAIATSTASWV 425


>gi|254439191|ref|ZP_05052685.1| integral membrane protein MviN [Octadecabacter antarcticus 307]
 gi|198254637|gb|EDY78951.1| integral membrane protein MviN [Octadecabacter antarcticus 307]
          Length = 534

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 82/173 (47%), Gaps = 5/173 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  +   +     +  NRA E  L   IP    L+++ ++++  L++RGAF + D
Sbjct: 307 LLPDLSRRLAAGDLDGGRDAFNRAAELALALTIPAAVALIVIAQDLVSVLFQRGAFDSDD 366

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  + +Y   +  F+L + +   ++AR D K P  +  +++V    IAIGL  +IG
Sbjct: 367 AAATALAVMVYGAGLPAFVLQKAMQPLYFARGDTKRPFYYAAVAMVANAGIAIGLSMYIG 426

Query: 124 GYGIATAEVSWVWVNTICL---AVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
               A A     WV    L   +  +    Q D  F+T  R   I ++S LMG
Sbjct: 427 YIAAALATTLAGWVMVWLLWRGSRTMGDAAQFDARFKT--RFWRIMLASMLMG 477


>gi|260775154|ref|ZP_05884052.1| hypothetical protein VIC_000525 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608855|gb|EEX35017.1| hypothetical protein VIC_000525 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 520

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 82/170 (48%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    S   +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSHSDGFSHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQFASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAWFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       L  +T+  +  + ++ GLM
Sbjct: 415 GYVGLAIATALSAFVNMSLLYRGLHVAGVYKLTSRTVAFVAKLALAGGLM 464


>gi|302879193|ref|YP_003847757.1| integral membrane protein MviN [Gallionella capsiferriformans ES-2]
 gi|302581982|gb|ADL55993.1| integral membrane protein MviN [Gallionella capsiferriformans ES-2]
          Length = 512

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      +  + S+L +  +       +P    L M+   ++ T ++RGAF A D
Sbjct: 287 LLPSLSKCHASRDTVEYSKLLDWGLRLTFMLAVPSALALGMIAVPLLSTFFQRGAFLASD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            ++ S  L  YS  ++G +L ++L   FYAR D+KTP K  I++++
Sbjct: 347 VLMTSHALVGYSVGLIGMILVKILAPGFYARQDIKTPVKIGIVTLI 392


>gi|254443175|ref|ZP_05056651.1| integral membrane protein MviN [Verrucomicrobiae bacterium DG1235]
 gi|198257483|gb|EDY81791.1| integral membrane protein MviN [Verrucomicrobiae bacterium DG1235]
          Length = 506

 Score = 69.3 bits (168), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 2/172 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P L++AI    K++ +E   R I   L   +P    L +L  +II  L+E G FTA DT 
Sbjct: 287 PSLAAAIAGGRKEEFAETYKRGILLCLLLAVPSAVGLGVLASDIISLLFENGRFTAMDTA 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
             +  + I++  +  +    V    FYA  D +TP K  +++  +   +++ L    G  
Sbjct: 347 STAPLVLIFAIGMPFYSFVSVETRAFYALKDTRTPVKVAVVTFAINVGLSLALMVPYGAV 406

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMGMFI 176
           G+A A    V V TI L +A L R+ +D   Q ++   + I  S+ LMG+ +
Sbjct: 407 GLAIATNFAVIVQTILLHIA-LGRKDLDTSLQGMFGTFIKIAGSAVLMGLLV 457


>gi|258542771|ref|YP_003188204.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633849|dbj|BAH99824.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636908|dbj|BAI02877.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639961|dbj|BAI05923.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643017|dbj|BAI08972.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646072|dbj|BAI12020.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649125|dbj|BAI15066.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652112|dbj|BAI18046.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655169|dbj|BAI21096.1| integral membrane protein MviN [Acetobacter pasteurianus IFO
           3283-12]
          Length = 516

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+  +       +   +NR+IEYVL   +P  A LL+L   I+  L+  G+FT  D
Sbjct: 285 LLPVLTRHLAAGETDAAHAAQNRSIEYVLLLTLPAVAGLLVLAGPIMIVLFGHGSFTEHD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            +L +  L  Y+  +  F++ +VL   F+AR D +TP
Sbjct: 345 ALLSAQSLRAYAIGLPAFVMVKVLSPAFFARGDTRTP 381


>gi|160897625|ref|YP_001563207.1| integral membrane protein MviN [Delftia acidovorans SPH-1]
 gi|160363209|gb|ABX34822.1| integral membrane protein MviN [Delftia acidovorans SPH-1]
          Length = 573

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A   ++ ++ S + +  +  V+   +PC   LL   + ++ TL+ RGA    D
Sbjct: 350 LTPQLAAAKAADDSERYSAMLDWGLRLVVLLSVPCAVGLLTFAEPLVATLFHRGALQDSD 409

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L  Y   +VG +  +VL   +YA  D++TP K  I+ +V+  ++ + L PF+ 
Sbjct: 410 VGQIALALVGYGAGLVGLVAIKVLAPGYYASQDIRTPVKIAIVVLVITQLLNLVLVPFMA 469

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN   L   LL+R
Sbjct: 470 HTGLALSIGLAALVNAGWLLWGLLRR 495


>gi|212213113|ref|YP_002304049.1| MviN [Coxiella burnetii CbuG_Q212]
 gi|212011523|gb|ACJ18904.1| MviN [Coxiella burnetii CbuG_Q212]
          Length = 515

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 2/174 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+     ++ Q  S   + A+   +  G+P    L +L   ++ TL   GAFTA D
Sbjct: 289 VLPNLARQHSQKSAQAYSATLDWALRMAMLIGVPAAVALFILAGPLLATLIYHGAFTAHD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  +S  + GF+L ++L S FY+R +VKTP K    ++V+   +   L   + 
Sbjct: 349 VLMTRRSLWAFSVGLPGFMLVKILASAFYSRQNVKTPVKIAAAAVVVNLTLNAVLIHPLA 408

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQID-LPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N + L   LL+ +    LP  T   IL +  ++G+MG+ I
Sbjct: 409 HAGLALATSLASSFNAVLLLYFLLRDKIYQPLPHWTKL-ILRLLFANGIMGLAI 461


>gi|109947773|ref|YP_665001.1| virulence factor MviN [Helicobacter acinonychis str. Sheeba]
 gi|109714994|emb|CAK00002.1| virulence factor MviN [Helicobacter acinonychis str. Sheeba]
          Length = 486

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N  Q   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIALKNNNQDLILQRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G V ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLVASLSLMP 412

Query: 121 FIGGYGIATAE 131
           F+G  G+A A 
Sbjct: 413 FLGVLGLALAN 423


>gi|297183897|gb|ADI20019.1| hypothetical protein [uncultured gamma proteobacterium EB000_65A11]
          Length = 508

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 107/216 (49%), Gaps = 5/216 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +  + S   N A+  VL  G+P +  L++L +E+I TL+  G  T +D
Sbjct: 287 ILPGLSREHATGSAVEFSNTLNWALRMVLAIGVPSSIALIILSEELITTLFFMGEMTERD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  Y   ++G ++ +V+   +++R D  TP K+ I+++    V+ + L  ++ 
Sbjct: 347 VEMAALSLKAYGVGLLGHMIVKVMAPGYFSRQDTSTPVKYGIIALTSNMVLNLILVWYLK 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVFFKPC 182
             G+A A     ++N   L    LK+  + L     +R  L +  ++ ++ M ++FF P 
Sbjct: 407 HAGLALATSLSAFINAGLLWYG-LKKSGVLLVDDGWFRFFLQVVFANTILCMMLIFFVPS 465

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
           L   +  E  F     L +++SG  +   C ISLLL
Sbjct: 466 L--SVWFELGFWHRVGLMLLVSGIGVAVYC-ISLLL 498


>gi|197106922|ref|YP_002132299.1| virulence factor MviN-like protein [Phenylobacterium zucineum HLK1]
 gi|196480342|gb|ACG79870.1| virulence factor MviN-like protein [Phenylobacterium zucineum HLK1]
          Length = 544

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 77/147 (52%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP+LS+A+Q ++   +    ++ + + L   +P  A L+ +P  +I  L+ R  F   
Sbjct: 299 ALLPRLSAALQKDDHDDAQTAMDQGLVWALALSLPAAAALMAMPVYLIDGLFTRDEFVRA 358

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D +     L  Y+  +  F+L R+L   F+AR D KTP +F ++S+ +   + + LF  +
Sbjct: 359 DALATGQLLFHYAWGVPAFVLLRILQPAFFARQDTKTPMRFSLISVGVNIALGVALFYTV 418

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
           G +GIA A     W+    +  AL +R
Sbjct: 419 GFWGIAAATSIAAWITVFQMWAALGRR 445


>gi|153207866|ref|ZP_01946443.1| integral membrane protein MviN [Coxiella burnetii 'MSU Goat Q177']
 gi|212219170|ref|YP_002305957.1| virulence factor [Coxiella burnetii CbuK_Q154]
 gi|120576292|gb|EAX32916.1| integral membrane protein MviN [Coxiella burnetii 'MSU Goat Q177']
 gi|212013432|gb|ACJ20812.1| virulence factor [Coxiella burnetii CbuK_Q154]
          Length = 515

 Score = 68.9 bits (167), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 2/174 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+     ++ Q  S   + A+   +  G+P    L +L   ++ TL   GAFTA D
Sbjct: 289 VLPNLARQHSQKSAQAYSATLDWALRMAMLIGVPAAVALFILAGPLLATLIYHGAFTAHD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  +S  + GF+L ++L S FY+R +VKTP K    ++V+   +   L   + 
Sbjct: 349 VLMTRRSLWAFSVGLPGFMLVKILASAFYSRQNVKTPVKIAAAAVVVNLTLNAVLIHPLA 408

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQID-LPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N + L   LL+ +    LP  T   IL +  ++G+MG+ I
Sbjct: 409 HAGLALATSLASSFNAVLLLYFLLRDKIYQPLPHWTKL-ILRLLFANGIMGLAI 461


>gi|154705844|ref|YP_001425012.1| virulence factor [Coxiella burnetii Dugway 5J108-111]
 gi|165918829|ref|ZP_02218915.1| integral membrane protein MviN [Coxiella burnetii RSA 334]
 gi|154355130|gb|ABS76592.1| virulence factor [Coxiella burnetii Dugway 5J108-111]
 gi|165917461|gb|EDR36065.1| integral membrane protein MviN [Coxiella burnetii RSA 334]
          Length = 515

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 2/174 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+     ++ Q  S   + A+   +  G+P    L +L   ++ TL   GAFTA D
Sbjct: 289 VLPNLARQHSQKSAQAYSATLDWALRMAMLIGVPAAVALFILAGPLLATLIYHGAFTAHD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  +S  + GF+L ++L S FY+R +VKTP K    ++V+   +   L   + 
Sbjct: 349 VLMTRRSLWAFSVGLPGFMLVKILASAFYSRQNVKTPVKIAAAAVVVNLTLNAVLIHPLA 408

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQID-LPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N + L   LL+ +    LP  T   IL +  ++G+MG+ I
Sbjct: 409 HAGLALATSLASSFNAVLLLYFLLRDKIYQPLPHWTKL-ILRLLFANGIMGLAI 461


>gi|317011096|gb|ADU84843.1| virulence factor MviN [Helicobacter pylori SouthAfrica7]
          Length = 486

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N  Q   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIALKNNNQDLILQRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G V ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLVASLSLMP 412

Query: 121 FIGGYGIATAE 131
           F+G  G+A A 
Sbjct: 413 FLGVLGLALAN 423


>gi|50083358|ref|YP_044868.1| MviN family virulence factor [Acinetobacter sp. ADP1]
 gi|49529334|emb|CAG67046.1| putative virulence factor MviN family
           (multidrug/oligosaccharidyl-lipid/polysaccharide
           exporter superfamily) [Acinetobacter sp. ADP1]
          Length = 515

 Score = 68.9 bits (167), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +++++   + + A   ++  G+P +  L ML   IIQ L++RG FT +D
Sbjct: 287 ILPSLSMRHAEQDQEKFRGMLDWAARVIVLVGLPASIALFMLSTPIIQALFQRGEFTWED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++       VI IG F 
Sbjct: 347 TRMTALALQCMSAGVIAFMLIKVFAPGFYAQQDTKTPVRVGLIAVAANALLNVIFIGFFK 406

Query: 121 FI 122
            I
Sbjct: 407 LI 408


>gi|119505893|ref|ZP_01627957.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2080]
 gi|119458274|gb|EAW39385.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2080]
          Length = 542

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 10/146 (6%)

Query: 4   LLPKLSS----AIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           +LP LSS    A   +     +   + A+  ++   +P TA L++L K I+ TL++ GAF
Sbjct: 305 ILPNLSSQQARAKAADRDPAFAATLHWALGLIVLVALPATAALVVLAKPILTTLFQYGAF 364

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGL 118
           + +D    +  L  YS  +  F+L +VL   +YAR D+KTP +  I+++V   V+  + +
Sbjct: 365 SPEDVDKAAWSLRAYSVGLTAFMLIKVLAPGYYARQDMKTPVRIGIIAMVSNMVMNPLFI 424

Query: 119 FPF-----IGGYGIATAEVSWVWVNT 139
           FP      +G  G+A A     W+N 
Sbjct: 425 FPLMWVFDLGHVGLALATSVAAWLNA 450


>gi|148652322|ref|YP_001279415.1| integral membrane protein MviN [Psychrobacter sp. PRwf-1]
 gi|148571406|gb|ABQ93465.1| integral membrane protein MviN [Psychrobacter sp. PRwf-1]
          Length = 516

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +LP LS++   E K+     R   + A   ++  G+P    L +L   ++QTL+ RG F+
Sbjct: 290 ILPSLSTS---EAKKDDVSFRKTLDWAARLIIVVGLPAACALFVLSDVLMQTLFMRGEFS 346

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV---IAIG 117
            +D  +    L   S  I+GF+L ++    F+AR D KTP K  I++++   +   I +G
Sbjct: 347 LRDANMSGFALRSMSGGILGFMLIKIFAPAFFARQDTKTPVKIGIITVIANMIFSLIFVG 406

Query: 118 LF-----PFIGGYGIATAEVSWV 135
           LF     P  GG  +AT   S+V
Sbjct: 407 LFYLLKLPLHGGLALATTAASFV 429


>gi|302381406|ref|YP_003817229.1| integral membrane protein MviN [Brevundimonas subvibrioides ATCC
           15264]
 gi|302192034|gb|ADK99605.1| integral membrane protein MviN [Brevundimonas subvibrioides ATCC
           15264]
          Length = 531

 Score = 68.6 bits (166), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 13/241 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL+P+L+ A    + +      +  I   + F +P    L ++P  II     RGAFT+ 
Sbjct: 288 ALVPRLTRAFVSGDHEGGRRTLDDGITLSMAFTLPAAVALFVIPFFIIDATVTRGAFTSL 347

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    +  L  ++  +  F+L++VL   F+AR D + P  F ++S+V+   +  GLF + 
Sbjct: 348 DAARTADVLRQFAWGVPAFVLAKVLTPPFFAREDTRRPMIFAVISVVVTVALGSGLFFWF 407

Query: 123 ------GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
                 G  G+A A     W+N   L   L++        + + R   +  +S +M    
Sbjct: 408 SRSGVDGVLGLAIATSVSAWINVALLGGTLIREDVWAPSARFVGRFSRVLAASAVMAA-- 465

Query: 177 VFFKPCLFNQLSAETAFSPFKNLAII--LSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
           V     LF    +   F+  K +A+I  +    LVY   I L      ++ LK +LK + 
Sbjct: 466 VLIPASLFYSDLSRILFA--KEIAVIAVVGAGALVYGVCIVLFRAVS-VSELKATLKREP 522

Query: 235 G 235
           G
Sbjct: 523 G 523


>gi|222111598|ref|YP_002553862.1| integral membrane protein mvin [Acidovorax ebreus TPSY]
 gi|221731042|gb|ACM33862.1| integral membrane protein MviN [Acidovorax ebreus TPSY]
          Length = 521

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 85/176 (48%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+LS+A    + ++ S + +  +  V+   +PC   LL     ++ TL+  GA    D
Sbjct: 298 LTPQLSAAKAAGDGERYSAMLDWGLRIVVLLAVPCAVGLLTFATPLVATLFHHGALNDGD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              +S  L+ Y   ++G +  +VL   +YA  D++TP +  I+ +V   ++   L P + 
Sbjct: 358 VRQISVALAGYGAGLLGLVAIKVLAPGYYASQDIRTPVRIAIVVLVATQIMNAALVPLLA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVF 178
             G+A +      +N + L   LL+R     P +   R  L +  +S L+ +F+++
Sbjct: 418 HAGLALSIGLGALINALWLLTGLLRRGSFR-PREGWGRFALQVIAASALLAVFLLW 472


>gi|262370976|ref|ZP_06064299.1| MviN family virulence factor [Acinetobacter johnsonii SH046]
 gi|262314052|gb|EEY95096.1| MviN family virulence factor [Acinetobacter johnsonii SH046]
          Length = 515

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    ++  +   + + A + ++  G+P +  L ML   IIQ L++RG FT +D
Sbjct: 287 ILPALSTRHAEQDMSKFRGMMDWAAKVIVLVGVPASIALFMLSTPIIQALFQRGQFTLED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++++       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMAVAANAILNVVFIGFFK 406

Query: 121 FI 122
            I
Sbjct: 407 LI 408


>gi|121595314|ref|YP_987210.1| integral membrane protein MviN [Acidovorax sp. JS42]
 gi|120607394|gb|ABM43134.1| integral membrane protein MviN [Acidovorax sp. JS42]
          Length = 532

 Score = 68.6 bits (166), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 85/176 (48%), Gaps = 2/176 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+LS+A    + ++ S + +  +  V+   +PC   LL     ++ TL+  GA    D
Sbjct: 309 LTPQLSAAKAAGDGERYSAMLDWGLRIVVLLAVPCAVGLLTFATPLVATLFHHGALNDGD 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              +S  L+ Y   ++G +  +VL   +YA  D++TP +  I+ +V   ++   L P + 
Sbjct: 369 VRQISVALAGYGAGLLGLVAIKVLAPGYYASQDIRTPVRIAIVVLVATQIMNAALVPLLA 428

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVF 178
             G+A +      +N + L   LL+R     P +   R  L +  +S L+ +F+++
Sbjct: 429 HAGLALSIGLGALINALWLLTGLLRRGSFR-PREGWGRFALQVIAASALLAVFLLW 483


>gi|147674115|ref|YP_001216175.1| MviN protein [Vibrio cholerae O395]
 gi|146315998|gb|ABQ20537.1| MviN protein [Vibrio cholerae O395]
 gi|227012505|gb|ACP08715.1| MviN protein [Vibrio cholerae O395]
          Length = 525

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT+ D
Sbjct: 301 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTSSD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 361 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 420

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 421 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 469


>gi|262169979|ref|ZP_06037669.1| hypothetical protein VIJ_003242 [Vibrio cholerae RC27]
 gi|262021713|gb|EEY40424.1| hypothetical protein VIJ_003242 [Vibrio cholerae RC27]
          Length = 520

 Score = 68.6 bits (166), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT+ D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTSSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 464


>gi|322515639|ref|ZP_08068617.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Actinobacillus ureae ATCC 25976]
 gi|322118290|gb|EFX90573.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Actinobacillus ureae ATCC 25976]
          Length = 522

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 101/216 (46%), Gaps = 5/216 (2%)

Query: 5   LPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++   +++  Q++ E +   +  +  VL  GIP    + +L + ++ T++ RG F  
Sbjct: 300 LSRIAKKKEIDEAQRAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTIFMRGKFGL 359

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D +  S  L I    +  ++L  +L + FYAR + KTP K  I++ +      +   PF
Sbjct: 360 SDVVATSHALWIMCLGLNSYMLISILANGFYARQNTKTPVKIGIIATICNICFGVLAIPF 419

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      VN   L   L K     +  +T   +L + IS+ LMG  + +F P
Sbjct: 420 -GYLGLAMASALSAAVNASLLYRGLAKEGAYRITGKTALFVLKVAISACLMGALVAYFSP 478

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
            L     A T +     LA ++  A +VY  ++ +L
Sbjct: 479 SL-EGWYAMTTWMKVYWLAWLIVLAAIVYFSALFVL 513


>gi|89093566|ref|ZP_01166514.1| Virulence factor MVIN-like [Oceanospirillum sp. MED92]
 gi|89082256|gb|EAR61480.1| Virulence factor MVIN-like [Oceanospirillum sp. MED92]
          Length = 521

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++ +  S   N A++ VL  G+P    L +L + ++ TL+  GA T +D
Sbjct: 299 ILPSLSRKHAEKSSEHFSSTLNWAMQMVLLIGVPAAVALFVLAEPMLITLFHYGALTDRD 358

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV---IAIGLFP 120
             + +  L  Y+  +V F+L +VL + +++R D KTP K  I + V   V   + IG F 
Sbjct: 359 VAMAAMSLRAYACGLVAFMLIKVLATGYFSRQDTKTPVKIGIQAAVANMVFNLLLIGPFA 418

Query: 121 FIG 123
            +G
Sbjct: 419 HVG 421


>gi|254468322|ref|ZP_05081728.1| integral membrane protein MviN [beta proteobacterium KB13]
 gi|207087132|gb|EDZ64415.1| integral membrane protein MviN [beta proteobacterium KB13]
          Length = 485

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 88/177 (49%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP LSS+   +  ++ ++L N +I   L   IP    + +L   +I TL+  G F+  D 
Sbjct: 262 LPALSSSFSNKKYEEFNKLMNWSIRIGLLVSIPAAIGIAVLSIPLITTLFYYGKFSELDL 321

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
           ++    L  YS  ++G ++ +V    FY++ ++KTP +  ++++ +   + + L P+   
Sbjct: 322 VMTHKALFAYSFGLIGLIMIKVFAPVFYSQKNIKTPVRIAVITLFVTQAMNLILIPYFQH 381

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G+A A       N + L  ++ K     +   T   ++ IF+S+ LMG+ + F  P
Sbjct: 382 VGLALAISVGATFNAVMLFFSIKKMNDFKIEPATFIFLIKIFLSAFLMGVILYFINP 438


>gi|33152962|ref|NP_874315.1| MviN virulence factor [Haemophilus ducreyi 35000HP]
 gi|33149187|gb|AAP96704.1| MviN virulence factor [Haemophilus ducreyi 35000HP]
          Length = 508

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 90/186 (48%), Gaps = 7/186 (3%)

Query: 4   LLPKLSSAIQLE--NKQQSS----ELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           +LP LS   + +  N++Q +    +  +  +  V+  GIP    + +L + +I T++ RG
Sbjct: 282 VLPNLSRITKKKALNEEQRAIAFKQTLDWGVRMVVALGIPAMVGIAILAQPLIMTIFMRG 341

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
            F   D I  S  L I    +  ++L  VL + FYAR + KTP K  I++ +      + 
Sbjct: 342 KFVLADVIATSHALWIMCLGLNSYMLISVLANGFYARQNTKTPVKIGIIATIANICFGVL 401

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
             PF G  G+A A      VN   L   L+K +   L  +T+  IL + IS+  MG+ + 
Sbjct: 402 AIPF-GYLGLAMASALSAAVNASLLYYNLVKEQAYCLSKKTVIFILKVAISACAMGVLVS 460

Query: 178 FFKPCL 183
           +F P L
Sbjct: 461 YFSPTL 466


>gi|92116862|ref|YP_576591.1| integral membrane protein MviN [Nitrobacter hamburgensis X14]
 gi|91799756|gb|ABE62131.1| integral membrane protein MviN [Nitrobacter hamburgensis X14]
          Length = 508

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   + Q +   + RA ++ L F +P  A  L +P  I++ ++ RGAF+  D
Sbjct: 283 LLPEMSRRITAGDHQGAMASQRRAFDFTLLFSVPFVAAFLTVPDVIMRAMFARGAFSKAD 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F+L R  ++ FYAR +  TP K  +  + +   + I L   + 
Sbjct: 343 AAAAGATLAAYAVGLIPFVLIRSAVAAFYARKNTATPVKAALTGVAVNVALKIALVGSLA 402

Query: 124 GYGIATAEVSWVWVN 138
             G+A A     W+N
Sbjct: 403 QIGLALATAVGAWIN 417


>gi|153874756|ref|ZP_02002854.1| MviN-like protein [Beggiatoa sp. PS]
 gi|152068780|gb|EDN67146.1| MviN-like protein [Beggiatoa sp. PS]
          Length = 497

 Score = 68.2 bits (165), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 61/111 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS ++   + Q  +   + A+ +V   G+P    L++L   ++ TL+  G F+  D
Sbjct: 275 MLPDLSKSVARGDMQNYNNTLDWALRWVFIIGVPSMIGLIVLAGPMLTTLFNYGEFSDHD 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
            ++ +  L  Y+  ++GF+  +VL S F+AR D +TP K  ++++    V+
Sbjct: 335 VMMTTQSLIAYAAGLLGFVFIKVLASGFFARQDTRTPVKIAVIAMATNMVL 385


>gi|269962527|ref|ZP_06176875.1| MviN protein [Vibrio harveyi 1DA3]
 gi|269832722|gb|EEZ86833.1| MviN protein [Vibrio harveyi 1DA3]
          Length = 520

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 83/170 (48%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  S   +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDAHSEGFSHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       +  +T++ I+ + I+   M
Sbjct: 415 GYVGLAIATALSAFVNMALLYRGLHIAGVYQITKRTVFFIIRLVIAGAAM 464


>gi|118595223|ref|ZP_01552570.1| Virulence factor MVIN-like protein [Methylophilales bacterium
           HTCC2181]
 gi|118441001|gb|EAV47628.1| Virulence factor MVIN-like protein [Methylophilales bacterium
           HTCC2181]
          Length = 514

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +I   N ++ S L N  +   +    P    L +L   +I TL+  GAF+  D
Sbjct: 288 LLPSLSGSISKNNSKEYSSLVNWGLRLSILLSAPAALGLYILAAPLIATLFYYGAFSEHD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L+ YS  ++  +L +VL   FYA+ ++KTP K  I ++    ++ +    FIG
Sbjct: 348 VLMTQYALTAYSIGLIALVLIKVLAPAFYAQKNIKTPVKIAIFTLFCTQLMNMIFIGFIG 407

Query: 124 GYGIATA 130
             G+A A
Sbjct: 408 HAGLALA 414


>gi|294837228|ref|ZP_06781911.1| MviN family virulence factor [Acinetobacter sp. 6013113]
 gi|294857896|ref|ZP_06795665.1| MviN family virulence factor [Acinetobacter sp. 6013150]
          Length = 513

 Score = 68.2 bits (165), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|169797745|ref|YP_001715538.1| MviN family virulence factor [Acinetobacter baumannii AYE]
 gi|213155457|ref|YP_002317502.1| integral membrane protein MviN [Acinetobacter baumannii AB0057]
 gi|215485095|ref|YP_002327336.1| integral membrane protein MviN [Acinetobacter baumannii AB307-0294]
 gi|301347145|ref|ZP_07227886.1| integral membrane protein MviN [Acinetobacter baumannii AB056]
 gi|301510109|ref|ZP_07235346.1| integral membrane protein MviN [Acinetobacter baumannii AB058]
 gi|169150672|emb|CAM88581.1| putative virulence factor MviN family
           (multidrug/oligosaccharidyl-lipid/polysaccharide
           exporter superfamily) [Acinetobacter baumannii AYE]
 gi|213054617|gb|ACJ39519.1| integral membrane protein MviN [Acinetobacter baumannii AB0057]
 gi|213988614|gb|ACJ58913.1| integral membrane protein MviN [Acinetobacter baumannii AB307-0294]
          Length = 513

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|163782673|ref|ZP_02177670.1| hypothetical protein HG1285_17355 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882246|gb|EDP75753.1| hypothetical protein HG1285_17355 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 497

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 17/205 (8%)

Query: 18  QQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIY 74
           ++ S+ R +   A   ++   +P +A L +L +EI++ +Y RG+FT +D    +  LSIY
Sbjct: 286 RKDSDKREQLTLAFRVLILLMVPASAGLFLLSEEIVRAVYHRGSFTEEDVHFSAGALSIY 345

Query: 75  STEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSW 134
           S  +V F L + L + F+++ D KTP K  +L+ V+   +A  LF F  G+G+    +  
Sbjct: 346 SLGLVFFSLQKSLSASFFSQGDTKTPVKASLLT-VLSEGVAASLFAF--GFGLGVLGLPM 402

Query: 135 VWVNTICLAVALLKRRQIDLP-FQTIYRIL-SIFISSGLMGMFIVFFKPCLFNQLSAETA 192
               +  + ++ L RR  + P F+ +   L  +F ++ LM + +   K         ET 
Sbjct: 403 GTALSSLVGLSYLWRRSPEKPTFKPVVSTLWKVFTATLLMSVLVYVLK---------ETG 453

Query: 193 FSPFKNLAIILSGAVLVYLCSISLL 217
            SP   +   +  +V+VY  S+ LL
Sbjct: 454 RSPVFIVITTIPLSVIVYFVSLYLL 478


>gi|294842747|ref|ZP_06787430.1| MviN family virulence factor [Acinetobacter sp. 6014059]
 gi|193075961|gb|ABO10541.2| putative virulence factor MviN family [Acinetobacter baumannii ATCC
           17978]
 gi|322506259|gb|ADX01713.1| Putative virulence factor MviN family [Acinetobacter baumannii
           1656-2]
          Length = 513

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|254418162|ref|ZP_05031886.1| integral membrane protein MviN [Brevundimonas sp. BAL3]
 gi|196184339|gb|EDX79315.1| integral membrane protein MviN [Brevundimonas sp. BAL3]
          Length = 531

 Score = 68.2 bits (165), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 81/176 (46%), Gaps = 6/176 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL+P+L+ A    + +      +  +   L F +P    L ++P  II     R AFT+ 
Sbjct: 288 ALVPRLTRAFVSGDHEGGRRTMDDGLGLALAFALPAGVALFVIPFFIIDATVTRAAFTSA 347

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    +  L  ++  +  F+L +VL   F+AR D + P  F + S+++  V+   LF + 
Sbjct: 348 DAARTADVLRQFAWGVPAFVLVKVLTPPFFARQDTRRPMIFAVTSVILTVVLGSALFFWF 407

Query: 123 G--GY----GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           G  G+    G+A A     WVN   LA  L++          + R+  IF +S +M
Sbjct: 408 GSQGWDGVLGLAIATSISAWVNVALLAGTLIREDSWRPSAAFLSRLSRIFAASLIM 463


>gi|184156388|ref|YP_001844727.1| membrane protein [Acinetobacter baumannii ACICU]
 gi|260552989|ref|ZP_05825904.1| MviN family virulence factor [Acinetobacter sp. RUH2624]
 gi|260557696|ref|ZP_05829910.1| integral membrane protein MviN [Acinetobacter baumannii ATCC 19606]
 gi|183207982|gb|ACC55380.1| uncharacterized membrane protein, putative virulence factor
           [Acinetobacter baumannii ACICU]
 gi|260405231|gb|EEW98728.1| MviN family virulence factor [Acinetobacter sp. RUH2624]
 gi|260408869|gb|EEX02173.1| integral membrane protein MviN [Acinetobacter baumannii ATCC 19606]
          Length = 513

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|156934447|ref|YP_001438363.1| hypothetical protein ESA_02278 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532701|gb|ABU77527.1| hypothetical protein ESA_02278 [Cronobacter sakazakii ATCC BAA-894]
          Length = 511

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + S L +  +       +P    L +L K +  +L++ G F+  D
Sbjct: 287 LLPSLSRSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSGHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 ALMTQQALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIMTQVMNLA---FIG 403


>gi|221065680|ref|ZP_03541785.1| integral membrane protein MviN [Comamonas testosteroni KF-1]
 gi|220710703|gb|EED66071.1| integral membrane protein MviN [Comamonas testosteroni KF-1]
          Length = 521

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 74/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L+SA    + ++ S + +  +  V+   +PC   LL     ++ TL+ RGA    D
Sbjct: 298 LTPQLASARAAGDGERYSNMLDWGLRLVVLLAVPCAVGLLTFATPLVATLFHRGALHDSD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L  Y   ++G +  +VL   +YA  D++TP K  I+ +V+  ++ + L P++ 
Sbjct: 358 VGQIALALMGYGAGLLGLVAIKVLAPGYYASQDIRTPVKIAIVVLVITQLLNLVLVPWLK 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN   L + LL+R
Sbjct: 418 HTGLALSIGLAALVNATWLLIGLLRR 443


>gi|126640159|ref|YP_001083143.1| MviN family virulence factor [Acinetobacter baumannii ATCC 17978]
          Length = 419

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 193 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 252

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 253 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 312

Query: 121 FIGGYG 126
            I  + 
Sbjct: 313 LINWHA 318


>gi|301595858|ref|ZP_07240866.1| integral membrane protein MviN [Acinetobacter baumannii AB059]
          Length = 458

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|319943168|ref|ZP_08017451.1| integral membrane protein MviN [Lautropia mirabilis ATCC 51599]
 gi|319743710|gb|EFV96114.1| integral membrane protein MviN [Lautropia mirabilis ATCC 51599]
          Length = 518

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 68/146 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    N Q+ S+L +  +   L    P    L ++ K +   L+  GAF+  D
Sbjct: 290 LLPSLSQANASGNTQRYSDLLDWGLRLALLLATPAMVGLALMAKPLTALLFHYGAFSEHD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++ S  +  Y   +      R+L   F+A+ DV+TP K  +  ++   ++ + L P++ 
Sbjct: 350 LLMTSHTVRAYGAGLFALTAVRILAPGFFAKQDVRTPVKIAVTVLICTQLMNLALVPWLA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +     W+N   L   L KR
Sbjct: 410 HAGLALSISLGAWLNAGWLLRGLKKR 435


>gi|169632076|ref|YP_001705812.1| MviN family virulence factor [Acinetobacter baumannii SDF]
 gi|169150868|emb|CAO99472.1| putative virulence factor MviN family
           (multidrug/oligosaccharidyl-lipid/polysaccharide
           exporter superfamily) [Acinetobacter baumannii]
 gi|323516134|gb|ADX90515.1| uncharacterized membrane protein, putative virulence factor
           [Acinetobacter baumannii TCDC-AB0715]
          Length = 513

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|304413605|ref|ZP_07395049.1| putative virulence factor [Candidatus Regiella insecticola LSR1]
 gi|304283696|gb|EFL92090.1| putative virulence factor [Candidatus Regiella insecticola LSR1]
          Length = 514

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 57/106 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    +    S L +  +       +PCT  L ++ K +I  L++ G F+A D
Sbjct: 290 LLPSLAKSFSAGDHNAYSRLMDWGLRLCFLLALPCTMALAIIAKPLIIVLFQYGQFSAFD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            ++    L  YS  ++G ++ +VL   FY+R D+KTP +  I+S++
Sbjct: 350 ALMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVRVAIVSLI 395


>gi|37526008|ref|NP_929352.1| virulence factor MviN [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|36785438|emb|CAE14384.1| Virulence factor MviN [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 511

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N ++ ++L +  +       +PC   L ML + +  +L++ G FTA D
Sbjct: 287 LLPSLAKSFSSGNHEEYTKLMDWGLRLCFLLALPCAVALGMLAEPLTVSLFQYGNFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  Y   ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 AVMTQKALIAYCFGLMGLIIVKVLAPGFYSRRDIKTPVKIAIVTLIL 393


>gi|113971294|ref|YP_735087.1| integral membrane protein MviN [Shewanella sp. MR-4]
 gi|113885978|gb|ABI40030.1| integral membrane protein MviN [Shewanella sp. MR-4]
          Length = 519

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 4/181 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS            +  +  I+ +L  G+P    L++L + ++  L+ RGAF+ QD
Sbjct: 296 ILPALSRNHVNAEGDGFGKTMDWGIKAILLLGLPAMMGLIVLAQPMLMVLFMRGAFSIQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I++++  MGF +   + PF
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMGFNLIFAI-PF 414

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K     +   T+   L   +S+ LM + + +F P
Sbjct: 415 -GYVGLAIATSMSALLNATLLYRGLHKAGVYRISKPTMVFFLKAVVSAALMVVVLYYFLP 473

Query: 182 C 182
            
Sbjct: 474 S 474


>gi|327483480|gb|AEA77887.1| Proposed peptidoglycan lipid II flippase MurJ [Vibrio cholerae
           LMA3894-4]
          Length = 520

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 464


>gi|83648577|ref|YP_437012.1| integral membrane protein MviN [Hahella chejuensis KCTC 2396]
 gi|83636620|gb|ABC32587.1| integral membrane protein MviN [Hahella chejuensis KCTC 2396]
          Length = 522

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N +  S   + AI  VL  G+P    L+ L + +I TL++ GA T  D
Sbjct: 299 ILPSLSRKHAADNAKDFSATLDWAIRAVLLIGLPAAVALMTLAQPMIATLFQHGALTDFD 358

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  +  F+L +VL   +++R D +TP K  I ++V   V  + L   + 
Sbjct: 359 VKMSAQSLQAYSLGLTFFMLVKVLAPGYFSRQDTRTPVKIGIAAMVANMVFNLALIYPMA 418

Query: 124 GYGIATA 130
             G+A A
Sbjct: 419 HAGLALA 425


>gi|229519954|ref|ZP_04409384.1| hypothetical protein VIF_000470 [Vibrio cholerae TM 11079-80]
 gi|229343006|gb|EEO07994.1| hypothetical protein VIF_000470 [Vibrio cholerae TM 11079-80]
          Length = 506

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 282 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 342 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 401

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 402 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 450


>gi|229525332|ref|ZP_04414737.1| hypothetical protein VCA_002954 [Vibrio cholerae bv. albensis
           VL426]
 gi|229338913|gb|EEO03930.1| hypothetical protein VCA_002954 [Vibrio cholerae bv. albensis
           VL426]
          Length = 506

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 282 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 342 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 401

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 402 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 450


>gi|239503775|ref|ZP_04663085.1| uncharacterized membrane protein, putative virulence factor
           [Acinetobacter baumannii AB900]
          Length = 513

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLISVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LINWHA 412


>gi|114048532|ref|YP_739082.1| integral membrane protein MviN [Shewanella sp. MR-7]
 gi|113889974|gb|ABI44025.1| integral membrane protein MviN [Shewanella sp. MR-7]
          Length = 519

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 4/181 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS            +  +  I+ +L  G+P    L++L + ++  L+ RGAF+ QD
Sbjct: 296 ILPALSRNHVNAEGDGFGKTMDWGIKAILLLGLPAMMGLIVLAQPMLMVLFMRGAFSIQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I++++  MGF +   + PF
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMGFNLIFAI-PF 414

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K     +   T+   L   +S+ LM + + +F P
Sbjct: 415 -GYVGLAIATSMSALLNATLLYRGLHKAGVYRISKPTMVFFLKAVVSAALMVVVLYYFLP 473

Query: 182 C 182
            
Sbjct: 474 S 474


>gi|258624720|ref|ZP_05719654.1| MviN protein [Vibrio mimicus VM603]
 gi|258583007|gb|EEW07822.1| MviN protein [Vibrio mimicus VM603]
          Length = 520

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  +  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGVRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VDQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L ++    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLYRQGVYLLTSKTVWFVARLALAGAVM 464


>gi|121730024|ref|ZP_01682436.1| MviN protein [Vibrio cholerae V52]
 gi|254291958|ref|ZP_04962738.1| MviN protein [Vibrio cholerae AM-19226]
 gi|297580804|ref|ZP_06942730.1| integral membrane protein MviN [Vibrio cholerae RC385]
 gi|121628228|gb|EAX60747.1| MviN protein [Vibrio cholerae V52]
 gi|150422097|gb|EDN14064.1| MviN protein [Vibrio cholerae AM-19226]
 gi|297535220|gb|EFH74055.1| integral membrane protein MviN [Vibrio cholerae RC385]
          Length = 525

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 301 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 361 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 420

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 421 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 469


>gi|254508944|ref|ZP_05121051.1| integral membrane protein MviN [Vibrio parahaemolyticus 16]
 gi|219548119|gb|EED25137.1| integral membrane protein MviN [Vibrio parahaemolyticus 16]
          Length = 421

 Score = 67.8 bits (164), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 80/170 (47%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS           +   +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 197 ILPALSRKHVDAQSHGFAHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 256

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++    V    +F +  
Sbjct: 257 VQFASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMATNMVFN-AIFAWFY 315

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       L  +T+  I  + I+ GLM
Sbjct: 316 GYVGLAIATALSAFVNMSLLYRGLHLAGVYQLTRKTLLFITKLVIAGGLM 365


>gi|153829366|ref|ZP_01982033.1| MviN protein [Vibrio cholerae 623-39]
 gi|148875149|gb|EDL73284.1| MviN protein [Vibrio cholerae 623-39]
          Length = 525

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 301 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 361 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 420

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 421 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 469


>gi|153803717|ref|ZP_01958303.1| integral membrane protein MviN [Vibrio cholerae MZO-3]
 gi|124120747|gb|EAY39490.1| integral membrane protein MviN [Vibrio cholerae MZO-3]
          Length = 510

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 464


>gi|153826778|ref|ZP_01979445.1| MviN protein [Vibrio cholerae MZO-2]
 gi|149739429|gb|EDM53669.1| MviN protein [Vibrio cholerae MZO-2]
          Length = 458

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 234 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 293

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 294 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 353

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 354 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 402


>gi|117921576|ref|YP_870768.1| integral membrane protein MviN [Shewanella sp. ANA-3]
 gi|117613908|gb|ABK49362.1| integral membrane protein MviN [Shewanella sp. ANA-3]
          Length = 519

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 89/181 (49%), Gaps = 4/181 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS            +  +  I+ +L  G+P    L++L + ++  L+ RGAF+ QD
Sbjct: 296 ILPALSRNHVNAEGDGFGKTMDWGIKAILLLGLPAMMGLIVLAQPMLMVLFMRGAFSIQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I++++  MGF +   + PF
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMGFNLIFAI-PF 414

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K     +   T+   L   +S+ LM + + +F P
Sbjct: 415 -GYVGLAIATSMSALLNATLLYRGLHKAGVYRISKPTMVFFLKAVVSTALMVVVLYYFLP 473

Query: 182 C 182
            
Sbjct: 474 T 474


>gi|73542451|ref|YP_296971.1| virulence factor MVIN-like [Ralstonia eutropha JMP134]
 gi|72119864|gb|AAZ62127.1| Virulence factor MVIN-like [Ralstonia eutropha JMP134]
          Length = 516

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 69/146 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   +N+++ S L +  +       +PC   L +    +   L+  G F A  
Sbjct: 291 LLPSLSKASAQDNREEYSGLLDWGLRLTFLLAVPCAVGLFVFGTPLTAVLFNYGKFDAHA 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y T ++G ++ ++L   FYAR D++TP K  I+ +V+         P++G
Sbjct: 351 VEMTRQALVSYGTGLLGLIVIKILAPGFYARQDIRTPVKIAIVVLVITQACNYLFVPWMG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N + L   L++R
Sbjct: 411 HAGLALSISVGASINALLLFAGLVRR 436


>gi|262163908|ref|ZP_06031647.1| hypothetical protein VMA_000348 [Vibrio mimicus VM223]
 gi|262027436|gb|EEY46102.1| hypothetical protein VMA_000348 [Vibrio mimicus VM223]
          Length = 520

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  +  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGVRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VDQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L ++    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHRQGVYLLTSKTVWFVARLALAGAVM 464


>gi|229512429|ref|ZP_04401903.1| hypothetical protein VCB_000069 [Vibrio cholerae TMA 21]
 gi|229350579|gb|EEO15525.1| hypothetical protein VCB_000069 [Vibrio cholerae TMA 21]
          Length = 374

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 150 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 209

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 210 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 269

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 270 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 318


>gi|94501197|ref|ZP_01307719.1| integral membrane protein MviN [Oceanobacter sp. RED65]
 gi|94426624|gb|EAT11610.1| integral membrane protein MviN [Oceanobacter sp. RED65]
          Length = 525

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E+KQ      + A+  VL  G+P    L++L   ++ T++ RG  TA D
Sbjct: 303 ILPNLSQRHASEDKQHFVATLDWAVRMVLLIGVPAALALMVLSVPLMATIFYRGEITAFD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
              ++  L  Y   ++ F+L +VL   FYAR + KTP K  + ++++  V+  I +FPF 
Sbjct: 363 VEKMALSLQAYGAGLLAFMLIKVLAPGFYARQNTKTPVKIAMAAMIVNMVLNLILIFPFA 422

Query: 123 G-GYGIAT 129
             G  +AT
Sbjct: 423 HVGLAMAT 430


>gi|258620348|ref|ZP_05715386.1| MviN protein [Vibrio mimicus VM573]
 gi|258587227|gb|EEW11938.1| MviN protein [Vibrio mimicus VM573]
          Length = 520

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  +  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGVRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VDQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L ++    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHRQGVYLLTSKTVWFVARLALAGAVM 464


>gi|301062008|ref|ZP_07202720.1| integral membrane protein MviN [delta proteobacterium NaphS2]
 gi|300443890|gb|EFK07943.1| integral membrane protein MviN [delta proteobacterium NaphS2]
          Length = 524

 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 63/116 (54%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP LS     ++  Q  +     +  V F  +P  A LL+L K I+   +ERGAF A+
Sbjct: 292 AALPSLSGDAARKDFAQFQKTLAHGLRLVFFIVLPAMAGLLILGKPIVVLFFERGAFGAE 351

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
            + + +  LS Y+  +  F   RVL++ FYA  D KTP K  ++S+V+  ++++ L
Sbjct: 352 SSAMTAEALSCYTLGLWAFSGMRVLIAAFYALQDTKTPVKIAVVSLVINALLSLSL 407


>gi|209884481|ref|YP_002288338.1| integral membrane protein MviN [Oligotropha carboxidovorans OM5]
 gi|209872677|gb|ACI92473.1| integral membrane protein MviN [Oligotropha carboxidovorans OM5]
          Length = 509

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP ++  I   +   +   + RA E+ L F +P  A  L +P  I++ ++ RGAF++ D
Sbjct: 284 LLPDMARRISGGDHAGAMAAQRRAFEFTLLFSVPFVAAFLTVPDVIMRAMFARGAFSSAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  I +  V+ + L   + 
Sbjct: 344 AATAGATLAAYAVGLIPFVLIRSAVATFYARKDTATPVKSALTGIAVNLVLKLLLMGSLA 403

Query: 124 GYGIATAEVSWVWVN 138
             G+A A     WVN
Sbjct: 404 QIGLALATAIGQWVN 418


>gi|91789423|ref|YP_550375.1| integral membrane protein MviN [Polaromonas sp. JS666]
 gi|91698648|gb|ABE45477.1| integral membrane protein MviN [Polaromonas sp. JS666]
          Length = 521

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 76/146 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L++A    +  + S + +  +  V+   +PC   LL   + ++ TLY  GAFT +D
Sbjct: 298 LMPQLAAAKAAGDAAKYSAMLDWGLRIVVVLAVPCAVALLTFAQPLVATLYHYGAFTDRD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   ++G +  +VL   FYA  D++TP +  ++ +V+  ++ + L P + 
Sbjct: 358 VQQTTIALMGYGAGLLGLVAIKVLAPGFYASQDIRTPVRIAVVVLVITQLLNVALVPLLQ 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L V L++R
Sbjct: 418 HAGLALAIGIGALINALWLLVGLMRR 443


>gi|229530486|ref|ZP_04419874.1| hypothetical protein VCG_003606 [Vibrio cholerae 12129(1)]
 gi|229332259|gb|EEN97747.1| hypothetical protein VCG_003606 [Vibrio cholerae 12129(1)]
          Length = 506

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 282 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 342 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 401

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 402 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGSVM 450


>gi|262172243|ref|ZP_06039921.1| hypothetical protein VII_003070 [Vibrio mimicus MB-451]
 gi|261893319|gb|EEY39305.1| hypothetical protein VII_003070 [Vibrio mimicus MB-451]
          Length = 520

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 82/169 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  +  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGVRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VDQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L ++    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHRQGVYLLTSKTVWFVARLALAGAVM 464


>gi|229505699|ref|ZP_04395209.1| hypothetical protein VCF_000910 [Vibrio cholerae BX 330286]
 gi|229508727|ref|ZP_04398220.1| hypothetical protein VCE_000132 [Vibrio cholerae B33]
 gi|229519523|ref|ZP_04408966.1| hypothetical protein VCC_003553 [Vibrio cholerae RC9]
 gi|229608718|ref|YP_002879366.1| hypothetical protein VCD_003640 [Vibrio cholerae MJ-1236]
 gi|2631999|emb|CAA05373.1| MviN protein [Vibrio cholerae]
 gi|229344212|gb|EEO09187.1| hypothetical protein VCC_003553 [Vibrio cholerae RC9]
 gi|229354251|gb|EEO19181.1| hypothetical protein VCE_000132 [Vibrio cholerae B33]
 gi|229357922|gb|EEO22839.1| hypothetical protein VCF_000910 [Vibrio cholerae BX 330286]
 gi|229371373|gb|ACQ61796.1| hypothetical protein VCD_003640 [Vibrio cholerae MJ-1236]
          Length = 506

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 282 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 342 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 401

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G+A A     ++N     +ALL R    L  Q +Y +
Sbjct: 402 YVGLAVATSMSAFLN-----MALLYR---GLHLQGVYHL 432


>gi|163750656|ref|ZP_02157893.1| MviN protein [Shewanella benthica KT99]
 gi|161329651|gb|EDQ00642.1| MviN protein [Shewanella benthica KT99]
          Length = 519

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 89/181 (49%), Gaps = 4/181 (2%)

Query: 4   LLPKLS-SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           +LP LS   I  E K   S + +  ++ +L  G+P    L++L K ++  L+ RG FT  
Sbjct: 296 ILPALSRKHINAEGKGFESTM-DWGVKAILLLGMPAMCGLIVLAKPMLMVLFMRGEFTLH 354

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPF 121
              + S  L  Y   ++ F+L +VL   +Y+R D +TP ++ I+++V   V  + L FPF
Sbjct: 355 HVEMASYSLVAYGCGLLSFMLIKVLAPGYYSRQDTRTPVRYGIIAMVSNMVFNLILAFPF 414

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K     +  QT +  +   +S G+M   +++F P
Sbjct: 415 -GYVGLAMATSMSALLNAGLLYRGLHKAGVYRVSRQTGFFFIKALLSCGVMVGLLLYFLP 473

Query: 182 C 182
            
Sbjct: 474 S 474


>gi|323699538|ref|ZP_08111450.1| integral membrane protein MviN [Desulfovibrio sp. ND132]
 gi|323459470|gb|EGB15335.1| integral membrane protein MviN [Desulfovibrio desulfuricans ND132]
          Length = 514

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 79/171 (46%), Gaps = 3/171 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP LS        ++  E  + ++   LF  +P  A L+ L   +I  L+ERGAFT +
Sbjct: 291 AALPSLSRLAAKGEMEEYDEALSASLGLTLFISLPAAAGLIGLAGPVIGLLFERGAFTPE 350

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                ++ L  YS  +    LSR L++ FYA  D +TP K  +L +     + + L  F+
Sbjct: 351 AVTATANALVAYSAGLPFIALSRPLVAGFYALEDTRTPVKIAVLCLAANIGLGVLLMQFL 410

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQID-LPFQTIYRI--LSIFISSG 170
              G+A A  +   +N   L V L ++R    +P     RI  LS  I  G
Sbjct: 411 AHVGLALAVSASSLLNFALLYVLLARKRGTSPMPLGAALRILLLSALIGGG 461


>gi|323497794|ref|ZP_08102808.1| hypothetical protein VISI1226_17991 [Vibrio sinaloensis DSM 21326]
 gi|323317141|gb|EGA70138.1| hypothetical protein VISI1226_17991 [Vibrio sinaloensis DSM 21326]
          Length = 511

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 83/173 (47%), Gaps = 8/173 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +LP LS   +     QSS   N     +  V   GIP    L++L K ++  L+ RG F+
Sbjct: 287 ILPALS---RKHVDAQSSGFANTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFS 343

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            QD    S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F 
Sbjct: 344 PQDVQFASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFA 402

Query: 121 FIGGY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           +  GY G+A A      VN + L   L       L   T+  I  + ++ GLM
Sbjct: 403 WFYGYVGLAIATALSALVNMLLLYRGLHLAGVYRLTRTTLVFIAKLVVAGGLM 455


>gi|255743861|ref|ZP_05417817.1| hypothetical protein VCH_000156 [Vibrio cholera CIRS 101]
 gi|262156080|ref|ZP_06029199.1| hypothetical protein VIG_001301 [Vibrio cholerae INDRE 91/1]
 gi|255738492|gb|EET93881.1| hypothetical protein VCH_000156 [Vibrio cholera CIRS 101]
 gi|262030116|gb|EEY48761.1| hypothetical protein VIG_001301 [Vibrio cholerae INDRE 91/1]
          Length = 520

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G+A A     ++N     +ALL R    L  Q +Y +
Sbjct: 416 YVGLAVATSMSAFLN-----MALLYR---GLHLQGVYHL 446


>gi|186895394|ref|YP_001872506.1| integral membrane protein MviN [Yersinia pseudotuberculosis PB1/+]
 gi|186698420|gb|ACC89049.1| integral membrane protein MviN [Yersinia pseudotuberculosis PB1/+]
          Length = 511

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +I +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSANHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLIVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 TLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|37678869|ref|NP_933478.1| mviN protein [Vibrio vulnificus YJ016]
 gi|37197610|dbj|BAC93449.1| mviN protein [Vibrio vulnificus YJ016]
          Length = 520

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   +  +  V   GIP    L++L K ++  L+ RG FT QD
Sbjct: 296 ILPALSRKHVDAHSEGFAHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFTPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIVAMVTNMVFN-AIFAWFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           GY G+A A     +VN     +ALL R    L    +Y+I
Sbjct: 415 GYVGLAIATALSAFVN-----MALLYR---GLHIAGVYKI 446


>gi|320157351|ref|YP_004189730.1| putative peptidoglycan lipid II flippase MurJ [Vibrio vulnificus
           MO6-24/O]
 gi|319932663|gb|ADV87527.1| proposed peptidoglycan lipid II flippase MurJ [Vibrio vulnificus
           MO6-24/O]
          Length = 511

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   +  +  V   GIP    L++L K ++  L+ RG FT QD
Sbjct: 287 ILPALSRKHVDAHSEGFAHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFTPQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 347 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIVAMVTNMVFN-AIFAWFY 405

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           GY G+A A     +VN     +ALL R    L    +Y+I
Sbjct: 406 GYVGLAIATALSAFVN-----MALLYR---GLHIAGVYKI 437


>gi|251794002|ref|YP_003008734.1| integral membrane protein MviN [Aggregatibacter aphrophilus NJ8700]
 gi|247535401|gb|ACS98647.1| integral membrane protein MviN [Aggregatibacter aphrophilus NJ8700]
          Length = 523

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 99/208 (47%), Gaps = 6/208 (2%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           +N + + + RN     +  +L  G+P    + +L + ++  L+ RG+FT  D    S  L
Sbjct: 309 DNAKSAVDFRNTMDWGVRMILLLGVPAMIGIAVLAQPMLLVLFMRGSFTFSDVQSASYSL 368

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAE 131
             ++  ++ F+L ++L + +YAR D KTP K  I+++V      +   PF    G+A A 
Sbjct: 369 WGFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMAFNLLAIPF-SYVGLAIAS 427

Query: 132 VSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAET 191
                +N   L   L K        Q+    L +F ++ +MG  + +  P L  + +A +
Sbjct: 428 AMSATLNAFLLYRGLAKADIYHFSRQSAVFFLKVFCAAAMMGWLVWYNSPSLI-EWNAMS 486

Query: 192 AFSPFKNLAIILSGAVLVYLCSISLLLG 219
            F+    LA ++  A +VY   + LLLG
Sbjct: 487 FFTRVYWLAWLIVLAAIVY-SGMLLLLG 513


>gi|15640699|ref|NP_230329.1| MviN protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|227080861|ref|YP_002809412.1| MviN protein [Vibrio cholerae M66-2]
 gi|254851012|ref|ZP_05240362.1| integral membrane protein MviN [Vibrio cholerae MO10]
 gi|298500794|ref|ZP_07010597.1| integral membrane protein MviN [Vibrio cholerae MAK 757]
 gi|12643461|sp|O34238|MVIN_VIBCH RecName: Full=Virulence factor mviN homolog
 gi|9655119|gb|AAF93845.1| MviN protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|227008749|gb|ACP04961.1| MviN protein [Vibrio cholerae M66-2]
 gi|254846717|gb|EET25131.1| integral membrane protein MviN [Vibrio cholerae MO10]
 gi|297540575|gb|EFH76633.1| integral membrane protein MviN [Vibrio cholerae MAK 757]
          Length = 525

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 77/159 (48%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 301 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 361 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 420

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G+A A     ++N     +ALL R    L  Q +Y +
Sbjct: 421 YVGLAVATSMSAFLN-----MALLYR---GLHLQGVYHL 451


>gi|51596352|ref|YP_070543.1| virulence factor mviN, MOP superfamliy efflux pump [Yersinia
           pseudotuberculosis IP 32953]
 gi|51589634|emb|CAH21264.1| virulence factor mviN, possible MOP Superfamliy efflux pump
           [Yersinia pseudotuberculosis IP 32953]
          Length = 511

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +I +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSANHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLIVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 TLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|238755567|ref|ZP_04616905.1| Virulence factor mviN [Yersinia ruckeri ATCC 29473]
 gi|238706247|gb|EEP98626.1| Virulence factor mviN [Yersinia ruckeri ATCC 29473]
          Length = 511

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       IP    L +L K ++  L++ G F A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLAIPSAIALGILAKPLVVALFQYGKFNAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALVAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|152998227|ref|YP_001343062.1| integral membrane protein MviN [Marinomonas sp. MWYL1]
 gi|150839151|gb|ABR73127.1| integral membrane protein MviN [Marinomonas sp. MWYL1]
          Length = 522

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 73/147 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +       + SE  + A+  +L   IP +  L ML + +I T++ RG  T  D
Sbjct: 301 ILPSLSRSFSGGEASKFSETLDWALRILLLIAIPSSLALFMLAEPLIATIFYRGELTVND 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  +V  +L +VL   +YAR D +TP +  I++++   V+ + L   +G
Sbjct: 361 VHMAAQSLQAYSLGLVFMMLIKVLAPGYYARQDTRTPVRIGIIAMISNMVLNLILVWPLG 420

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR 150
             G+A A      +N   L   L K++
Sbjct: 421 HVGLALATSLSAGLNAFLLWRGLYKKQ 447


>gi|298530380|ref|ZP_07017782.1| integral membrane protein MviN [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509754|gb|EFI33658.1| integral membrane protein MviN [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 515

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 69/147 (46%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP LSS     + Q      N ++   LF  +P TA L+ L   +I  ++ RGAF   
Sbjct: 297 AALPSLSSLAGDRDMQGFKGTLNSSLSLTLFIALPSTAGLIGLSYPLIDVIFGRGAFGDD 356

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                S  L  ++  +  F   R LLS FYA  D  TP K  ++S+V+   + I L   +
Sbjct: 357 AVQATSLALVGFAVGLPAFSCVRPLLSAFYALEDTVTPVKIAVISLVLNIALGILLMQHL 416

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
              G+A A     WVN + L +AL ++
Sbjct: 417 QHLGLALAASLSSWVNVLLLGLALGRK 443


>gi|22126155|ref|NP_669578.1| virulence factor [Yersinia pestis KIM 10]
 gi|45441689|ref|NP_993228.1| hypothetical protein YP_1886 [Yersinia pestis biovar Microtus str.
           91001]
 gi|108807421|ref|YP_651337.1| hypothetical protein YPA_1425 [Yersinia pestis Antiqua]
 gi|108811683|ref|YP_647450.1| membrane protein [Yersinia pestis Nepal516]
 gi|145598375|ref|YP_001162451.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149366028|ref|ZP_01888063.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162420241|ref|YP_001606860.1| integral membrane protein MviN [Yersinia pestis Angola]
 gi|165926470|ref|ZP_02222302.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165938852|ref|ZP_02227406.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009378|ref|ZP_02230276.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210544|ref|ZP_02236579.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401439|ref|ZP_02306936.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420263|ref|ZP_02312016.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167424549|ref|ZP_02316302.1| integral membrane protein MviN [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468379|ref|ZP_02333083.1| virulence factor mviN, possible MOP Superfamliy efflux pump
           [Yersinia pestis FV-1]
 gi|218929150|ref|YP_002347025.1| hypothetical protein YPO2043 [Yersinia pestis CO92]
 gi|229894753|ref|ZP_04509933.1| predicted inner membrane protein [Yersinia pestis Pestoides A]
 gi|229898104|ref|ZP_04513253.1| predicted inner membrane protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901964|ref|ZP_04517085.1| predicted inner membrane protein [Yersinia pestis Nepal516]
 gi|270490854|ref|ZP_06207928.1| integral membrane protein MviN [Yersinia pestis KIM D27]
 gi|294503891|ref|YP_003567953.1| hypothetical protein YPZ3_1781 [Yersinia pestis Z176003]
 gi|21959118|gb|AAM85829.1|AE013830_1 putative virulence factor [Yersinia pestis KIM 10]
 gi|45436551|gb|AAS62105.1| putative membrane protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|108775331|gb|ABG17850.1| membrane protein [Yersinia pestis Nepal516]
 gi|108779334|gb|ABG13392.1| putative membrane protein [Yersinia pestis Antiqua]
 gi|115347761|emb|CAL20678.1| putative membrane protein [Yersinia pestis CO92]
 gi|145210071|gb|ABP39478.1| membrane protein [Yersinia pestis Pestoides F]
 gi|149292441|gb|EDM42515.1| putative membrane protein [Yersinia pestis CA88-4125]
 gi|162353056|gb|ABX87004.1| integral membrane protein MviN [Yersinia pestis Angola]
 gi|165913215|gb|EDR31838.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165921691|gb|EDR38888.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991933|gb|EDR44234.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207724|gb|EDR52204.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961958|gb|EDR57979.1| integral membrane protein MviN [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049135|gb|EDR60543.1| integral membrane protein MviN [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056431|gb|EDR66200.1| integral membrane protein MviN [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229680860|gb|EEO76955.1| predicted inner membrane protein [Yersinia pestis Nepal516]
 gi|229688820|gb|EEO80887.1| predicted inner membrane protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229702226|gb|EEO90245.1| predicted inner membrane protein [Yersinia pestis Pestoides A]
 gi|262361989|gb|ACY58710.1| hypothetical protein YPD4_1802 [Yersinia pestis D106004]
 gi|262365873|gb|ACY62430.1| hypothetical protein YPD8_1747 [Yersinia pestis D182038]
 gi|270339358|gb|EFA50135.1| integral membrane protein MviN [Yersinia pestis KIM D27]
 gi|294354350|gb|ADE64691.1| hypothetical protein YPZ3_1781 [Yersinia pestis Z176003]
 gi|320015280|gb|ADV98851.1| putative inner membrane protein [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 511

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +I +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSANHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLIVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 TLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|293611256|ref|ZP_06693554.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826507|gb|EFF84874.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124028|gb|ADY83551.1| putative virulence factor MviN family
           (multidrug/oligosaccharidyl-lipid/polysaccharide
           exporter superfamily) [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 516

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 290 ILPSLSARHAEQDQAKFRGMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 350 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 409

Query: 121 FIGGYG 126
            I  + 
Sbjct: 410 LIDWHA 415


>gi|153823933|ref|ZP_01976600.1| MviN protein [Vibrio cholerae B33]
 gi|126518544|gb|EAZ75767.1| MviN protein [Vibrio cholerae B33]
          Length = 275

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 10/160 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 51  ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 110

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+   +F +  
Sbjct: 111 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLN-AIFAWFY 169

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           GY G+A A     ++N     +ALL R    L  Q +Y +
Sbjct: 170 GYVGLAVATSMSAFLN-----MALLYR---GLHLQGVYHL 201


>gi|299772062|ref|YP_003734088.1| MviN family virulence factor [Acinetobacter sp. DR1]
 gi|298702150|gb|ADI92715.1| MviN family virulence factor [Acinetobacter sp. DR1]
          Length = 513

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRGMIDWAAKIIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       V+ IG F 
Sbjct: 347 TQMTALALQCMSAGVIAFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNVVFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LIDWHA 412


>gi|145589937|ref|YP_001156534.1| integral membrane protein MviN [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145048343|gb|ABP34970.1| integral membrane protein MviN [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 517

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 7/215 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    + + + EL    ++       P    L +  + +   LY  G F A D
Sbjct: 293 LLPSLSKANAKNDLEHAGELLIWGLQLTFLLAAPSAMALFLFGEPLAAVLYHYGKFNALD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L+ Y   ++G +L ++L   FY+R D++TP K  +L +V   +  +   P++G
Sbjct: 353 VLMTQRALAAYGVGLIGLILVKILAPGFYSRQDIRTPVKIGLLVLVATQLANLVFVPWLG 412

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A +  +   +N   L + L +R    LP     + L     + +    ++F+    
Sbjct: 413 HAGLALSVGTGACLNAALLWIGLHRRGA--LPSSAWMKYLGQLFLALIPFSAVLFYGANH 470

Query: 184 FNQLSAETAFSPFKNL---AIILSGAVLVYLCSIS 215
           +N ++ +    P+  +   A+ LS A LVY  +++
Sbjct: 471 YNWIALQA--QPWTRIGLVALFLSVAALVYFSALA 503


>gi|85709417|ref|ZP_01040482.1| putative virulence factor mvin-like transmembrane protein
           [Erythrobacter sp. NAP1]
 gi|85688127|gb|EAQ28131.1| putative virulence factor mvin-like transmembrane protein
           [Erythrobacter sp. NAP1]
          Length = 526

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  ENK+ +  +++ AIE  +   IP    L +  +  +  +++ G F   
Sbjct: 297 AILPTLSKFVGGENKEGADRIQSDAIELSMLLTIPAAVALAICAEAFVTMIFQGGRFDLA 356

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D       L+     +  ++L +VL+  FYAR D KTP     +S+ +     I +    
Sbjct: 357 DASATGEVLAALVLGLPAYVLVKVLVPNFYARADTKTPVVAAFISLGVFITTCILVLDTY 416

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           G  G+A A V   W+N   L + L  R    +P   + RI
Sbjct: 417 GVVGVAFASVIGAWINVAFLLIVLAARGHYRIPGVLLLRI 456


>gi|262281417|ref|ZP_06059198.1| MviN family virulence factor [Acinetobacter calcoaceticus RUH2202]
 gi|262257243|gb|EEY75980.1| MviN family virulence factor [Acinetobacter calcoaceticus RUH2202]
          Length = 513

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 66/126 (52%), Gaps = 3/126 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+    +++ +   + + A + ++  G+P +  L ML   IIQ L++RG F  +D
Sbjct: 287 ILPSLSARHAEQDQAKFRGMIDWAAKIIVLVGLPASIALFMLSTPIIQALFQRGEFDLRD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
           T + +  L   S  ++ F+L +V    FYA+ D KTP +  ++S+       VI IG F 
Sbjct: 347 TQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLISVAANAILNVIFIGFFK 406

Query: 121 FIGGYG 126
            I  + 
Sbjct: 407 LIDWHA 412


>gi|149192166|ref|ZP_01870386.1| mviN protein [Vibrio shilonii AK1]
 gi|148834006|gb|EDL51023.1| mviN protein [Vibrio shilonii AK1]
          Length = 520

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 78/157 (49%), Gaps = 2/157 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   +  +  V+  G+P    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSEGFASTMDWGVRMVILLGLPAMLGLMVLAKPMLMVLFMRGEFTPHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   +    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIVAMVSNMIFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
           GY G+A A     ++N   L   L  +R   +  QTI
Sbjct: 415 GYVGLAMATALSAFINMALLYRGLHLQRVYQISRQTI 451


>gi|242239604|ref|YP_002987785.1| integral membrane protein MviN [Dickeya dadantii Ech703]
 gi|242131661|gb|ACS85963.1| integral membrane protein MviN [Dickeya dadantii Ech703]
          Length = 511

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++   ++ + S L +  +       +P T  L +L + +   L++ G F+A D
Sbjct: 287 LLPSLSKSVASGDQVEYSRLLDWGLRLCFLLALPATVALGVLAQPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L +VL+  FYAR D+KTP K  ++++ M
Sbjct: 347 ALMTQRALVAYSVGLMGLILVKVLVPGFYARQDIKTPVKIAMVTLAM 393


>gi|317180260|dbj|BAJ58046.1| virulence factor MviN [Helicobacter pylori F32]
          Length = 486

 Score = 67.0 bits (162), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412

Query: 121 FIGGYGIATAE 131
           ++G  G+A A 
Sbjct: 413 WLGVLGLALAN 423


>gi|42520821|ref|NP_966736.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|42410561|gb|AAS14670.1| integral membrane protein MviN [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 495

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 108/223 (48%), Gaps = 11/223 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   Q++N +   +++N+A+   L   +P TA  +++P  I+ TL+  G F    
Sbjct: 277 LLPLISK--QVDNTENIVKIQNKALNIGLMLIMPTTAAFIIIPDIILLTLFSYGRFDHYA 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  +S  +  F++++VLL  F+A+ ++K P  F ++ + +  V+ + L     
Sbjct: 335 VQQTVPTLIAFSLSLPAFIINKVLLPTFFAKGNLKIPTIFSLMCLGINVVLNLLLMNEYQ 394

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W+N+I L   L   +   +    +  ++ IF+++ +M + +  F   L
Sbjct: 395 HTGIAIATSVSTWINSILLISYLTINKMYKVSQALLLNVMKIFVATAVMSIALYIFNSLL 454

Query: 184 ----FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGF 222
               F+++ A   +     L  +++ +V+VY   + L+    F
Sbjct: 455 AGLFFDKMLARIVY-----LTTLIALSVIVYFGILYLIFKGNF 492


>gi|308183037|ref|YP_003927164.1| virulence factor MviN [Helicobacter pylori PeCan4]
 gi|308065222|gb|ADO07114.1| virulence factor MviN [Helicobacter pylori PeCan4]
          Length = 486

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILQRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412

Query: 121 FIGGYGIATAE 131
           ++G  G+A A 
Sbjct: 413 WLGVLGLALAN 423


>gi|153947835|ref|YP_001401019.1| integral membrane protein MviN [Yersinia pseudotuberculosis IP
           31758]
 gi|152959330|gb|ABS46791.1| integral membrane protein MviN [Yersinia pseudotuberculosis IP
           31758]
          Length = 511

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +I +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLIVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 TLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|262395190|ref|YP_003287044.1| hypothetical protein VEA_004421 [Vibrio sp. Ex25]
 gi|262338784|gb|ACY52579.1| hypothetical protein VEA_004421 [Vibrio sp. Ex25]
          Length = 520

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 84/170 (49%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  ++  +  +  V+  G+P    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDAQSEGFAQTMDWGVRMVILLGLPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLFAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       +  +T++ I+ + I+   M
Sbjct: 415 GYVGLAIATALSAFVNMALLYRGLHIAGVYQITKRTVFFIIRLVIAGAAM 464


>gi|254463900|ref|ZP_05077311.1| integral membrane protein MviN [Rhodobacterales bacterium Y4I]
 gi|206684808|gb|EDZ45290.1| integral membrane protein MviN [Rhodobacterales bacterium Y4I]
          Length = 511

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  +   S +  +RA E+ L   +P     + +P  ++  LYERGA   +D
Sbjct: 281 LLPALSRRLRAGDGAGSQDALSRAGEFSLLLAVPSAVAFITVPLPLVSVLYERGATGPED 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L +VL   ++AR D +TP  + ++++ +   +A GL P +G
Sbjct: 341 VAAIAIAVAIYGAGLPAFMLQKVLQPLYFAREDTRTPFHYAMVAMAVNAALAFGLKPVLG 400


>gi|170024392|ref|YP_001720897.1| integral membrane protein MviN [Yersinia pseudotuberculosis YPIII]
 gi|169750926|gb|ACA68444.1| integral membrane protein MviN [Yersinia pseudotuberculosis YPIII]
          Length = 542

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +I +L++ G F+A D
Sbjct: 318 LLPSLAKSFSSANHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLIVSLFQYGKFSAFD 377

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV---IAIGLFP 120
           T++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++  V   I IG F 
Sbjct: 378 TLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLILTQVMNLIFIGPFK 437

Query: 121 FIG 123
             G
Sbjct: 438 HAG 440


>gi|86748734|ref|YP_485230.1| integral membrane protein MviN [Rhodopseudomonas palustris HaA2]
 gi|86571762|gb|ABD06319.1| integral membrane protein MviN [Rhodopseudomonas palustris HaA2]
          Length = 534

 Score = 66.6 bits (161), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 60/113 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P  I++ ++ RGAFT  D
Sbjct: 309 LLPEMSRQLTAGDDAGAKASQRRAFEFTLLFSVPFVAAFLTVPDAIMRAMFARGAFTRAD 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
            I   + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  +    V+ +
Sbjct: 369 AIAAGATLAAYAIALIPFVLIRSAVAPFYARKDTATPVKAALTGVAANVVLKV 421


>gi|331006484|ref|ZP_08329785.1| putative peptidoglycan lipid II flippase MurJ [gamma
           proteobacterium IMCC1989]
 gi|330419709|gb|EGG94074.1| putative peptidoglycan lipid II flippase MurJ [gamma
           proteobacterium IMCC1989]
          Length = 541

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 90/179 (50%), Gaps = 10/179 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E+ Q+ S+  + A+  +L   IP    L +L   I+  L+E G   A D
Sbjct: 313 ILPSLSRQFVGEDTQKFSQTIDWALRLILLIAIPAAVALFILAVPILTVLFEYGKTDASD 372

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPF- 121
             + +  L  Y+  ++ F+L +VL   +++R D KTP K  I+++ +  V  + L  PF 
Sbjct: 373 IAMSALSLQAYALGLLAFMLIKVLAPGYFSRQDTKTPVKIGIIAMAVNMVFNLILVIPFH 432

Query: 122 ----IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ--TIYRILSIFISSGLMGM 174
               IG  G+A A     W+N   L    L++R +  P    +IY ++ + +++ +MG+
Sbjct: 433 YLWQIGHVGLALATALSAWLNAGLLYRG-LRQRNVYTPISGWSIY-LIRLLVANVVMGV 489


>gi|260597438|ref|YP_003210009.1| virulence factor mviN [Cronobacter turicensis z3032]
 gi|260216615|emb|CBA29903.1| Virulence factor mviN [Cronobacter turicensis z3032]
          Length = 524

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + S L +  +       +P    L +L + +  +L++ G F+  D
Sbjct: 300 LLPSLSRSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILARPLTVSLFQYGKFSGHD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 ALMTQQALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|53803702|ref|YP_114669.1| membrane protein MviN [Methylococcus capsulatus str. Bath]
 gi|53757463|gb|AAU91754.1| membrane protein MviN [Methylococcus capsulatus str. Bath]
          Length = 513

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (56%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP L++     ++   S   + A+ +V+  G+P T  L++L K ++ TL+E   F+  
Sbjct: 284 AILPHLAAGHLDHDRDGFSRTLDWALRWVVLLGLPATLGLMILAKPLVFTLFEHDEFSDH 343

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
           DT + S  L  Y+  + G +  +VL S F AR DV+TP ++ + +I
Sbjct: 344 DTEMASRSLIAYAAGLPGAVAVKVLASGFSARRDVRTPLRYGLYAI 389


>gi|170718908|ref|YP_001784078.1| integral membrane protein MviN [Haemophilus somnus 2336]
 gi|168827037|gb|ACA32408.1| integral membrane protein MviN [Haemophilus somnus 2336]
          Length = 523

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 107/222 (48%), Gaps = 12/222 (5%)

Query: 4   LLPKLSSAI--QLENKQQSS----ELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           +LP LS     + +N ++S+    +  +  +  +L FGIP    + +L + ++  L+ RG
Sbjct: 296 ILPTLSRHYVNRTDNIEKSAVDFRQTMDWGVRMILLFGIPAMIGIAVLAQPMLLVLFMRG 355

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIA 115
            F+  D    S  L  ++  ++ F+L ++L + +YAR D +TP K  I+++V  MGF + 
Sbjct: 356 KFSFSDVQAASYSLWAFNAGLLSFMLIKILANGYYARQDTQTPVKIGIIAMVSNMGFNLL 415

Query: 116 IGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMF 175
              F +I   G+A A      +N   L   L K        Q+    + + IS+ +MGM 
Sbjct: 416 AIPFSYI---GLAIASAMSATLNAYLLYRGLAKADIYHFTRQSAVFFVKVLISAIIMGMV 472

Query: 176 IVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
           I ++ P L +     T F+    L  ++  AV+ Y   + LL
Sbjct: 473 IWYYSPAL-SLWKQMTFFTRVHWLGWLIFVAVITYFVMLILL 513


>gi|323136528|ref|ZP_08071610.1| integral membrane protein MviN [Methylocystis sp. ATCC 49242]
 gi|322398602|gb|EFY01122.1| integral membrane protein MviN [Methylocystis sp. ATCC 49242]
          Length = 511

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 85/183 (46%), Gaps = 5/183 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   + + +   ++R +   +    P       +P+ I+  L+ RG FTA D
Sbjct: 283 LLPEMSRRLAAGDVEGAHRAQSRTMALTIALAAPFFIAFDTIPELIVSGLFMRGKFTAAD 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L+ Y   ++  +L     + F AR D +TP    ++++     + + LF  +G
Sbjct: 343 AYAAGDVLAAYGGGLMALVLIASARASFQARGDTRTPMTIALIALTANVALKVALFRPLG 402

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY--RILSIFISSGLMGMFIVFFK- 180
             G+ATA    +W+N   L    + R  +D  F  ++   +L+  ++S ++ +  V+ + 
Sbjct: 403 AVGLATATSVGLWINLGALVALAIARDAMD--FDEVFGKTLLATLVASAVLTLVAVYGRA 460

Query: 181 PCL 183
           P L
Sbjct: 461 PAL 463


>gi|237731000|ref|ZP_04561481.1| virulence factor MviN [Citrobacter sp. 30_2]
 gi|226906539|gb|EEH92457.1| virulence factor MviN [Citrobacter sp. 30_2]
          Length = 511

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFSSGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 AAMTQRALVAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIMTQVMNLA---FIG 403


>gi|224824731|ref|ZP_03697838.1| integral membrane protein MviN [Lutiella nitroferrum 2002]
 gi|224603224|gb|EEG09400.1| integral membrane protein MviN [Lutiella nitroferrum 2002]
          Length = 510

 Score = 66.6 bits (161), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS         + S+L +  +   L   +P T  L +L + +I TL+  G F+A D
Sbjct: 287 LLPSLSKHAASRANDEYSKLLDWGMRLSLLLAVPATVGLAVLSQPLIATLFMYGKFSAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  Y+  ++G +L +VL   FYAR ++KTP K  I+++++
Sbjct: 347 ALMTQRALIAYAIGLLGLILVKVLAPGFYARQNIKTPVKIAIVTLLL 393


>gi|148251661|ref|YP_001236246.1| putative virulence factor MviN-like protein [Bradyrhizobium sp.
           BTAi1]
 gi|146403834|gb|ABQ32340.1| putative Virulence factor MviN-like protein [Bradyrhizobium sp.
           BTAi1]
          Length = 518

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 56/99 (56%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L+ A+   NKQ  +E+++  +E  +   +P T  L++L   II+ L+E GAFT+ D
Sbjct: 285 LVPELTRALHGGNKQALAEVQSHGLELTIGLALPATLGLMILNDPIIRLLFEHGAFTSDD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAK 102
               +  L   +  +   +L++ L   F+AR D +TP +
Sbjct: 345 ATATAHVLGWLAAALPAQVLTKALQPAFFAREDTQTPLR 383


>gi|218507473|ref|ZP_03505351.1| virulence factor transmembrane protein [Rhizobium etli Brasil 5]
          Length = 163

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 80/155 (51%), Gaps = 8/155 (5%)

Query: 81  FLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTI 140
           F+L + L   FYAR D KTP +F  +++      A+ LFP++G  GIA AE +  W++T+
Sbjct: 4   FVLIKALQPGFYAREDTKTPMRFSAIAVATNCASALTLFPYMGAPGIAVAEATAGWISTV 63

Query: 141 CLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV----FFKPCLFNQLSAETAFSPF 196
            L   LL+R  +   +    R   + +++ +MG  IV    +F P L    S     +  
Sbjct: 64  LLFTTLLRRGHLTWEWALAKRAALLIVAAAVMGAAIVVLKQYFAPWL---ASGAPLLTKI 120

Query: 197 KNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
             L ++++ ++LVY  + + L+G   L  ++ +L 
Sbjct: 121 GTLGLLIAISMLVYFAA-AFLIGGANLGMIRRNLN 154


>gi|308186386|ref|YP_003930517.1| Virulence factor mviN [Pantoea vagans C9-1]
 gi|308056896|gb|ADO09068.1| Virulence factor mviN [Pantoea vagans C9-1]
          Length = 512

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L ML   +   L++ G FTA D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGMLSGPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 ALMTQRALIAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIM 393


>gi|153838783|ref|ZP_01991450.1| integral membrane protein MviN [Vibrio parahaemolyticus AQ3810]
 gi|149747815|gb|EDM58705.1| integral membrane protein MviN [Vibrio parahaemolyticus AQ3810]
          Length = 520

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 81/170 (47%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  V   GIP    L+ L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSQNEGFAHTMDWGVRMVTLLGIPAMLGLMALAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       +  +T++ I+ + I+   M
Sbjct: 415 GYVGLAIATALSAFVNMALLYRGLHIAGVYQITKRTVFFIIRLVIAGAAM 464


>gi|304397197|ref|ZP_07379076.1| integral membrane protein MviN [Pantoea sp. aB]
 gi|304355346|gb|EFM19714.1| integral membrane protein MviN [Pantoea sp. aB]
          Length = 512

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L ML   +   L++ G FTA D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGMLSGPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 ALMTQRALIAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIMTQVMNLA---FIG 403


>gi|283833637|ref|ZP_06353378.1| integral membrane protein MviN [Citrobacter youngae ATCC 29220]
 gi|291071320|gb|EFE09429.1| integral membrane protein MviN [Citrobacter youngae ATCC 29220]
          Length = 511

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFSSGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALVAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|289422403|ref|ZP_06424247.1| integral membrane protein MviN [Peptostreptococcus anaerobius
           653-L]
 gi|289157174|gb|EFD05795.1| integral membrane protein MviN [Peptostreptococcus anaerobius
           653-L]
          Length = 519

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 82/153 (53%), Gaps = 4/153 (2%)

Query: 1   MAALLPKLSSAIQLENKQQS--SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGA 58
           +A + PKLS  + + +K  S  + ++ + I  VL   +P  A  ++L K I++ L +R A
Sbjct: 279 LAVIFPKLSK-LAVSDKMDSFITSMK-QTINVVLIALVPVVAGCIVLAKPIVEILLQRKA 336

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
           FTA DT++ ++ L IY T I+ F +  V+   FY+  D KTP    I++I +  ++ + L
Sbjct: 337 FTANDTVMTATILMIYVTGIIAFSVRDVMSRGFYSMGDSKTPMFNGIIAITLNIILDLVL 396

Query: 119 FPFIGGYGIATAEVSWVWVNTICLAVALLKRRQ 151
              +G  G+A A     ++  +   + + KR +
Sbjct: 397 IKPLGYTGLALATSISAYIALVVFIMTMKKRVE 429


>gi|284007344|emb|CBA72714.1| virulence factor [Arsenophonus nasoniae]
          Length = 297

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    + Q+   L +  +       +PC   L +L + +  +L++ G FT  D
Sbjct: 73  LLPSLAKSFSTGDHQEYQRLMDWGLRLCFLLALPCAIALAILAQPLTVSLFQYGNFTGYD 132

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  Y   ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 133 AVMTQRALIAYCVGLMGLIIVKVLAPGFYSRQDIKTPVKIAIITLIL 179


>gi|262191830|ref|ZP_06050001.1| hypothetical protein VIH_002206 [Vibrio cholerae CT 5369-93]
 gi|262032317|gb|EEY50884.1| hypothetical protein VIH_002206 [Vibrio cholerae CT 5369-93]
          Length = 224

 Score = 66.2 bits (160), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 83/169 (49%), Gaps = 2/169 (1%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           +P LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D 
Sbjct: 1   MPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSDV 60

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
              S  L  YS+ ++ F+L +VL   +Y+R D KTP ++ I+++V   V+   +F +  G
Sbjct: 61  EQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLN-AIFAWFYG 119

Query: 125 Y-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           Y G+A A     ++N   L   L  +    L  +T++ +  + ++  +M
Sbjct: 120 YVGLAVATSMSAFLNMALLYRGLHLQGVYHLTRKTVWFVARLVMAGAVM 168


>gi|264679767|ref|YP_003279676.1| integral membrane protein MviN [Comamonas testosteroni CNB-2]
 gi|262210282|gb|ACY34380.1| integral membrane protein MviN [Comamonas testosteroni CNB-2]
          Length = 521

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L+SA    + ++ S + +  +  V+   +PC   LL     ++ TL+ RGA    D
Sbjct: 298 LTPQLASAKAAGDGERYSNMLDWGLRLVVLLAVPCAVGLLTFATPLVATLFHRGALHDSD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L  Y   ++G +  +VL   +YA  D++TP K  I+ +V+  ++ + L P++ 
Sbjct: 358 VGQIALALMGYGAGLLGLVAIKVLAPGYYASQDIRTPVKIAIVVLVITQLLNLVLVPWLK 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN   L   LL+R
Sbjct: 418 HTGLALSIGLAALVNASWLLTGLLRR 443


>gi|28897306|ref|NP_796911.1| MviN protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260876269|ref|ZP_05888624.1| integral membrane protein MviN [Vibrio parahaemolyticus AN-5034]
 gi|308095130|ref|ZP_05903573.2| integral membrane protein MviN [Vibrio parahaemolyticus Peru-466]
 gi|28805515|dbj|BAC58795.1| MviN protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308088907|gb|EFO38602.1| integral membrane protein MviN [Vibrio parahaemolyticus Peru-466]
 gi|308092929|gb|EFO42624.1| integral membrane protein MviN [Vibrio parahaemolyticus AN-5034]
          Length = 520

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 81/170 (47%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  V   GIP    L+ L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSQSEGFAHTMDWGVRMVTLLGIPAMLGLMALAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       +  +T++ I+ + I+   M
Sbjct: 415 GYVGLAIATALSAFVNMALLYRGLHIAGVYQITKRTVFFIIRLVIAGAAM 464


>gi|163797116|ref|ZP_02191071.1| Virulence factor MVIN-like protein [alpha proteobacterium BAL199]
 gi|159177632|gb|EDP62185.1| Virulence factor MVIN-like protein [alpha proteobacterium BAL199]
          Length = 515

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 73/147 (49%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP L+  I+  N+ ++   +NRAIE  L   +P  A L ++   +   L+ERG F A 
Sbjct: 286 ALLPILARQIRSGNETEAGNTQNRAIEMGLLLTLPAAAALAVIADPLTAVLFERGRFVAS 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D    ++ ++ ++  +  F+L +     F+AR+D  TP K  I+ +V      + L P  
Sbjct: 346 DGDATAAAMAAFAAGLPAFVLIKAFQPGFFARHDTATPVKIAIVGVVANLAFNLVLMPLF 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
              GIA A     W+N   LA  L +R
Sbjct: 406 AHVGIALATTLAAWLNAGLLAWLLARR 432


>gi|299533939|ref|ZP_07047300.1| integral membrane protein MviN [Comamonas testosteroni S44]
 gi|298718066|gb|EFI59062.1| integral membrane protein MviN [Comamonas testosteroni S44]
          Length = 509

 Score = 66.2 bits (160), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L+SA    + ++ S + +  +  V+   +PC   LL     ++ TL+ RGA    D
Sbjct: 286 LTPQLASAKAAGDGERYSNMLDWGLRLVVLLAVPCAVGLLTFATPLVATLFHRGALHDSD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L  Y   ++G +  +VL   +YA  D++TP K  I+ +V+  ++ + L P++ 
Sbjct: 346 VGQIALALMGYGAGLLGLVAIKVLAPGYYASQDIRTPVKIAIVVLVITQLLNLVLVPWLK 405

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN   L   LL+R
Sbjct: 406 HTGLALSIGLAALVNASWLLTGLLRR 431


>gi|86148864|ref|ZP_01067121.1| mviN protein [Vibrio sp. MED222]
 gi|85833348|gb|EAQ51549.1| mviN protein [Vibrio sp. MED222]
          Length = 520

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  VL  GIP    L++L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRKHVDAQGEGFAHTMDWGVRMVLLLGIPAMLGLIVLAKPMLMVLFMRGEFSPHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQQASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMTLL 434


>gi|254796915|ref|YP_003081752.1| membrane protein, MviN family [Neorickettsia risticii str.
           Illinois]
 gi|254590151|gb|ACT69513.1| membrane protein, MviN family [Neorickettsia risticii str.
           Illinois]
          Length = 517

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 90/171 (52%), Gaps = 4/171 (2%)

Query: 9   SSAIQL-ENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGA-FTAQDTIL 66
           SS+I L  N ++  +++N+A++ V+   IP T +L+ + + I  +L+  G  F  Q    
Sbjct: 284 SSSITLTHNTEELIKMQNKALKKVITVCIPVTIMLVFMAEHITTSLFLLGGKFDLQSVKH 343

Query: 67  VSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYG 126
            +  L I +  +    L++  L  F A + +K P  F I S+V+   ++I L P     G
Sbjct: 344 TTHTLEILAFALPAHALNKSFLGPFLAFDKLKAPMSFTIASVVLNVTMSIILVPHYSYTG 403

Query: 127 IATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS-IFISSGLMGMFI 176
           IA A  +  W+NT+ + V  LKRR+I    + I R+LS +F ++ +   FI
Sbjct: 404 IAIALCTAAWLNTLLIIV-YLKRRKIFSLNEKIPRLLSTVFFAASITIFFI 453


>gi|88813007|ref|ZP_01128250.1| Virulence factor MVIN-like protein [Nitrococcus mobilis Nb-231]
 gi|88789785|gb|EAR20909.1| Virulence factor MVIN-like protein [Nitrococcus mobilis Nb-231]
          Length = 504

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 65/115 (56%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS     +++Q  S   + A+  V+   +P +  L +L   I+ TL++ GAFTA+D
Sbjct: 269 ILPRLSQEHADQSRQSFSHTLDWALRLVVVLILPASVGLALLAGPILATLFQYGAFTAED 328

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
             L S  L  Y+  ++GF+L ++L   ++AR D  TP K  + +++   V++  L
Sbjct: 329 VRLASWSLVAYALGLLGFVLVKILAPGYFARQDTVTPVKCALAALITNMVLSTSL 383


>gi|313903213|ref|ZP_07836606.1| integral membrane protein MviN [Thermaerobacter subterraneus DSM
           13965]
 gi|313466524|gb|EFR62045.1| integral membrane protein MviN [Thermaerobacter subterraneus DSM
           13965]
          Length = 586

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 91/182 (50%), Gaps = 3/182 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+++     +  +  S   NRA+  + F   P T   ++L ++I   +Y+RGAF   D
Sbjct: 285 LYPEMAEQGSQQRLRALSSTMNRALRLLTFVMAPITVGTVLLREDITALVYQRGAFDRMD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T++ ++ L  Y   +V F    +L    Y+  D +TPA   ++S+ +  V+A+ L  F+ 
Sbjct: 345 TLMTATALCFYGLGMVPFAWRELLARAMYSLGDTRTPATNGMMSMGLSIVLALVLVRFLD 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI-YRILSIFISSGLMGMFIVFFK-P 181
             GIA A     W   + L +  L+RR  DL F+++   +L   +++ +MG  I   + P
Sbjct: 405 HGGIALATALATWWAAVVL-ILRLQRRYRDLRFRSLAVGVLQAAVATAVMGGAIALLRVP 463

Query: 182 CL 183
            L
Sbjct: 464 VL 465


>gi|157374331|ref|YP_001472931.1| integral membrane protein MviN [Shewanella sediminis HAW-EB3]
 gi|157316705|gb|ABV35803.1| integral membrane protein MviN [Shewanella sediminis HAW-EB3]
          Length = 519

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 2/128 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +  +      N  ++ +L  G+P    L++L K ++  L+ RGAFT  D
Sbjct: 296 ILPALSKKHVNDEGKGFETTMNWGVKAILLLGMPAMCGLIILAKPMLMVLFMRGAFTFDD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I+++V   V  + +F    
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNMVFNV-IFAIPY 414

Query: 124 GY-GIATA 130
           GY G+A A
Sbjct: 415 GYVGLAIA 422


>gi|90580545|ref|ZP_01236350.1| virulence factor MviN [Vibrio angustum S14]
 gi|90438203|gb|EAS63389.1| virulence factor MviN [Photobacterium angustum S14]
          Length = 505

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 2/130 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++ +Q ++  +  +  VL  GIP    ++ L K ++  ++ RG F+  D
Sbjct: 282 ILPALSRKHVDKSPEQFAQTMDWGVRMVLLLGIPAMLGMITLAKPMLMVMFMRGEFSVYD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PFI 122
               ++ L + S  ++ ++L +V    +YAR D KTP K  I+++V   V   G+F PF 
Sbjct: 342 VNQTAASLWVVSAGLLNYMLIKVFAPGYYARQDTKTPVKIGIIAMVSNMVFN-GMFAPFY 400

Query: 123 GGYGIATAEV 132
           G  G++ A V
Sbjct: 401 GYVGLSIASV 410


>gi|307243807|ref|ZP_07525938.1| integral membrane protein MviN [Peptostreptococcus stomatis DSM
           17678]
 gi|306492810|gb|EFM64832.1| integral membrane protein MviN [Peptostreptococcus stomatis DSM
           17678]
          Length = 519

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 72/137 (52%), Gaps = 2/137 (1%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +A + P+LSS I  E          + +  ++   +P     ++L K+I++ L++R AFT
Sbjct: 279 LAVIYPRLSSMIVSERMDSFLNSLKKTMNVIIVALVPIIVGCIVLSKQIVEVLFQRNAFT 338

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           ++DT + +S L IY   I+ F L  VL   FY+  D KTP    I+SIV    + + L  
Sbjct: 339 SKDTTMTASILLIYVIGILAFALRDVLTRGFYSMEDSKTPMINSIISIVFNISLNLILVK 398

Query: 121 FIG--GYGIATAEVSWV 135
            +G  G  IATA  +++
Sbjct: 399 PLGYKGLAIATAVSAYI 415


>gi|213424673|ref|ZP_03357438.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. E02-1180]
          Length = 272

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 48  LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 107

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 108 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 154


>gi|146329174|ref|YP_001209759.1| virulence factor MviN family protein [Dichelobacter nodosus
           VCS1703A]
 gi|146232644|gb|ABQ13622.1| virulence factor MviN family protein [Dichelobacter nodosus
           VCS1703A]
          Length = 508

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 97/211 (45%), Gaps = 2/211 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LPKLS+     N+ Q ++    A+ + L  G   +  L+ML   I+ TL+  G F   D
Sbjct: 287 ILPKLSALKAQNNETQFTDTLIWALRWGLLIGSAASTGLVMLAPSILVTLFYGGNFLEHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++ +  L  Y    V  +L ++L   FYAR D KTP K  I+++    ++A+      G
Sbjct: 347 VLMTTMSLRAYGCAAVFLVLVKILAPAFYARQDTKTPVKAGIVAMATNIMVAVLFSRLWG 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A      VN + L    L R      F     +  I  ++ +M +F+ + +  +
Sbjct: 407 HVGLALASSVAAVVN-VALLFYFLYREGRLARFSLKRPLFQIVTANSIMALFLYYLQGSM 465

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
              LS  T        A+I+ G +++Y+ S+
Sbjct: 466 DTWLSRSTGMRVGYLGALIMIG-IVIYVISL 495


>gi|148978530|ref|ZP_01814982.1| mviN protein [Vibrionales bacterium SWAT-3]
 gi|145962319|gb|EDK27600.1| mviN protein [Vibrionales bacterium SWAT-3]
          Length = 520

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 2/170 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  VL  GIP    L++L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRKHVDAQGEGFAHTMDWGVRMVLLLGIPAMLGLIVLAKPMLMVLFMRGEFSPHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQQASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
           GY G+A A     +VN   L   L       L   T+     + +S G+M
Sbjct: 415 GYIGLAIATALSAFVNMALLYRGLHLAGVYKLTKTTLLFCAKLVVSGGVM 464


>gi|262401621|ref|ZP_06078187.1| hypothetical protein VOA_003171 [Vibrio sp. RC586]
 gi|262352038|gb|EEZ01168.1| hypothetical protein VOA_003171 [Vibrio sp. RC586]
          Length = 520

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 81/169 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHCDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  YS  ++ F+L +VL   +Y+R D KTP ++ I+++V   V+      F G
Sbjct: 356 VEQASYSLLAYSAGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNIVLNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+A A     ++N   L   L ++    L  +T++ +  + ++  +M
Sbjct: 416 YVGLAVATSMSAFLNMALLYRGLHRQGVYLLTSKTVWFVARLALAGAVM 464


>gi|218708568|ref|YP_002416189.1| virulence factor mviN homolog [Vibrio splendidus LGP32]
 gi|218321587|emb|CAV17539.1| Virulence factor mviN homolog [Vibrio splendidus LGP32]
          Length = 525

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  VL  GIP    L++L K ++  L+ RG F+  D
Sbjct: 301 ILPALSRKHVDAQGEGFAHTMDWGVRMVLLLGIPAMLGLIVLAKPMLMVLFMRGEFSPHD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 361 VQQASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 419

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 420 GYVGLAIATALSAFVNMTLL 439


>gi|323261023|gb|EGA44616.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
          Length = 292

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 68  LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 127

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 128 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 174


>gi|152979759|ref|YP_001345388.1| integral membrane protein MviN [Actinobacillus succinogenes 130Z]
 gi|150841482|gb|ABR75453.1| integral membrane protein MviN [Actinobacillus succinogenes 130Z]
          Length = 510

 Score = 65.9 bits (159), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 7/186 (3%)

Query: 4   LLPKLS--SAIQLENKQQS-SELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           +LP L+   A   +N  Q  ++ R   +  +  +L  G+P    + +L + ++ TL+ RG
Sbjct: 282 ILPTLARQHADCTDNAAQGVTDFRQTMDWGVRMILLLGVPAATGIAVLAQPMLLTLFMRG 341

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
            F   D    S  L   +T ++ F+L ++L + +YAR D KTP K  I+++V      + 
Sbjct: 342 QFMLSDVQATSHALWAINTGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMAFNLL 401

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
             PF    G+A A      +N   L   L K+       Q+    L +  ++G+MG  + 
Sbjct: 402 AIPF-SYVGLAMASAMSATLNAYLLYRGLAKQDVYHFSKQSAVFFLKVLTAAGVMGGLVW 460

Query: 178 FFKPCL 183
            F P L
Sbjct: 461 HFSPSL 466


>gi|326423724|ref|NP_759501.2| integral membrane protein MviN [Vibrio vulnificus CMCP6]
 gi|319999084|gb|AAO09028.2| integral membrane protein MviN [Vibrio vulnificus CMCP6]
          Length = 520

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   +  +  V   GIP    L++L K ++  L+ RG FT QD
Sbjct: 296 ILPALSRKHVDAHSEGFAHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFTPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I++++   V       F G
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIVAMLTNMVFNAIFAWFYG 415

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
             G+A A     +VN     +ALL R    L    +Y+I
Sbjct: 416 YVGLAIATALSAFVN-----MALLYR---GLHIAGVYKI 446


>gi|91227672|ref|ZP_01261949.1| MviN protein [Vibrio alginolyticus 12G01]
 gi|91188451|gb|EAS74745.1| MviN protein [Vibrio alginolyticus 12G01]
 gi|237880809|gb|ACR33066.1| MviN [Vibrio alginolyticus]
          Length = 520

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  ++  +  +  V+  G+P    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDAQNEGFAQTMDWGVRMVILLGLPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLFAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|84393569|ref|ZP_00992322.1| mviN protein [Vibrio splendidus 12B01]
 gi|84375778|gb|EAP92672.1| mviN protein [Vibrio splendidus 12B01]
          Length = 520

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 70/140 (50%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  VL  GIP    L++L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRKHVEAQGEGFAHTMDWGVRMVLLLGIPAMLGLIVLAKPMLTVLFMRGEFSPHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VQQASMSLVAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|224584326|ref|YP_002638124.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|224468853|gb|ACN46683.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
          Length = 524

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILSKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             ++   L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMMQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|149185514|ref|ZP_01863830.1| hypothetical protein ED21_20854 [Erythrobacter sp. SD-21]
 gi|148830734|gb|EDL49169.1| hypothetical protein ED21_20854 [Erythrobacter sp. SD-21]
          Length = 534

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (47%), Gaps = 15/173 (8%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  +NK+ +  +++ AIE  +   IP    L +     I  +++ G FT +
Sbjct: 293 AILPTLSKFVGSDNKEGADRIQSDAIELSMLLTIPAAVALAVCATPFITMIFQGGRFTME 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-----IG 117
           D     + L++    +  ++L +VL+  FYAR+D +TP   Y   I +G  +A     IG
Sbjct: 353 DAAAAGAVLAVLVLGLPAYVLVKVLVPNFYARSDTRTPV--YAAFISLGVFVASCIWNIG 410

Query: 118 L-FPFIG----GY---GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI 162
           L  P       GY   GIA A V   W+N   L   L +R    +PF  + R+
Sbjct: 411 LTLPGFTIEPLGYGVPGIAAASVIGAWINVGYLYAILARRGYYSVPFALLGRV 463


>gi|16760046|ref|NP_455663.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. CT18]
 gi|29142183|ref|NP_805525.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|25298800|pir||AC0639 virulence factor MviN [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16502340|emb|CAD08294.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137813|gb|AAO69374.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
          Length = 497

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 333 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 379


>gi|311280024|ref|YP_003942255.1| integral membrane protein MviN [Enterobacter cloacae SCF1]
 gi|308749219|gb|ADO48971.1| integral membrane protein MviN [Enterobacter cloacae SCF1]
          Length = 511

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + S L +  +       +P    + +L K +   L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYSRLMDWGLRLCFLLALPSAVAIGILAKPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|269966610|ref|ZP_06180691.1| MviN protein [Vibrio alginolyticus 40B]
 gi|269828795|gb|EEZ83048.1| MviN protein [Vibrio alginolyticus 40B]
          Length = 520

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 72/140 (51%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  ++  +  +  V+  G+P    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDAQNEGFAQTMDWGVRMVILLGLPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLFAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|156973297|ref|YP_001444204.1| hypothetical protein VIBHAR_00978 [Vibrio harveyi ATCC BAA-1116]
 gi|156524891|gb|ABU69977.1| hypothetical protein VIBHAR_00978 [Vibrio harveyi ATCC BAA-1116]
          Length = 511

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  +   +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 287 ILPALSRKHVDAHSEGFAHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 347 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 405

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 406 GYVGLAIATALSAFVNMALL 425


>gi|62179687|ref|YP_216104.1| putative virulence factor [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62127320|gb|AAX65023.1| putative virulence factor [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
          Length = 497

 Score = 65.9 bits (159), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 333 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 379


>gi|213053074|ref|ZP_03345952.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213648919|ref|ZP_03378972.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. J185]
          Length = 511

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|163803542|ref|ZP_02197411.1| 30S ribosomal protein S20 [Vibrio sp. AND4]
 gi|159172677|gb|EDP57530.1| 30S ribosomal protein S20 [Vibrio sp. AND4]
          Length = 520

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 71/140 (50%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  S   +  +  V   GIP    L++L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSHSEGFSHTMDWGVRMVTLLGIPAMLGLMVLAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I++++   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMLTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|205353092|ref|YP_002226893.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205272873|emb|CAR37802.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
          Length = 524

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|297171242|gb|ADI22249.1| uncharacterized membrane protein, putative virulence factor
           [uncultured Gemmatimonadales bacterium HF0200_36I24]
 gi|297171375|gb|ADI22379.1| uncharacterized membrane protein, putative virulence factor
           [uncultured nuHF2 cluster bacterium HF0500_02A10]
          Length = 549

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (52%), Gaps = 11/131 (8%)

Query: 2   AALLPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGA 58
           A+ LP+LS     + K+ S ELR   + A+E + F  IP T    +L    I  +Y+RG+
Sbjct: 298 ASELPELSR----QRKRPSEELRVQISSALERIHFLLIPSTVAFFILGDLFIGAIYQRGS 353

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG- 117
           F   DT +V + L+IYS  ++    SRVL + FYA  D +TPA+     + +   I +  
Sbjct: 354 FLTTDTPVVYAILAIYSLGLLASSGSRVLSTAFYAIRDTQTPARVAYFRVALSLAIGVSV 413

Query: 118 LFP---FIGGY 125
           +FP   F  GY
Sbjct: 414 MFPLDRFNSGY 424


>gi|238911010|ref|ZP_04654847.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 511

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|315634927|ref|ZP_07890209.1| integral membrane protein MviN [Aggregatibacter segnis ATCC 33393]
 gi|315476479|gb|EFU67229.1| integral membrane protein MviN [Aggregatibacter segnis ATCC 33393]
          Length = 525

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 85/179 (47%), Gaps = 6/179 (3%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           +N + + + RN     +  +L  G+P    + +L + ++  L+ RG+FT  D    S  L
Sbjct: 309 DNAKSAVDFRNTMDWGVRMILLLGVPAMIGIAVLAQPMLLVLFMRGSFTFSDVQSASYSL 368

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAE 131
             ++  ++ F+L ++L + +YAR D KTP K  I+++V      +   PF    G+A A 
Sbjct: 369 WGFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMAFNLLAIPF-SYVGLAIAS 427

Query: 132 VSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL--FNQLS 188
                +N   L   L K        Q+    L +F ++ +MG+ + +  P L  +N +S
Sbjct: 428 AMSATLNAYLLYRGLAKADVYHFSRQSAVFFLKVFCAAAMMGLLVWYNSPTLIEWNAMS 486


>gi|161503742|ref|YP_001570854.1| hypothetical protein SARI_01827 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865089|gb|ABX21712.1| hypothetical protein SARI_01827 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 533

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 309 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGVLAKPLTVSLFQYGKFTAFD 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 369 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 415


>gi|320086390|emb|CBY96163.1| Virulence factor mviN homolog [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 524

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|157960909|ref|YP_001500943.1| integral membrane protein MviN [Shewanella pealeana ATCC 700345]
 gi|157845909|gb|ABV86408.1| integral membrane protein MviN [Shewanella pealeana ATCC 700345]
          Length = 519

 Score = 65.5 bits (158), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 101/214 (47%), Gaps = 2/214 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS         + ++  +  ++ ++  G+P    L+ML K ++  L+ RGAF+  D
Sbjct: 296 ILPALSKRHVNAESVEFAKTMDWGVKAIILLGLPAMCGLIMLAKPMLMVLFMRGAFSYND 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F+L ++L   +Y+R D +TP ++ I+++V   V  + +F    
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKILAPGYYSRQDTRTPVRYGIIAMVSNMVFNL-IFAIPF 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      +N   L   L K     +   T+  ++   I++G+M + +  F P 
Sbjct: 415 GYVGLAIATSMSALLNAGLLYRGLHKANVYRVNKATVMFLVKSAIAAGVMLLVLFQFDPT 474

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
               L        +    +I+  AV  ++C + L
Sbjct: 475 TPQWLDLSFVERSYTLAKLIVFAAVAYFICLVCL 508


>gi|322714157|gb|EFZ05728.1| putative virulence protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 524

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|297183626|gb|ADI19752.1| hypothetical protein [uncultured gamma proteobacterium EB000_37F04]
          Length = 518

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 87/185 (47%), Gaps = 8/185 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   + A+  V F  +P T  L +L + ++ TL++ GAF   D
Sbjct: 291 ILPALSGQRARADDPAFAGTLSWAVRSVGFIAVPATLALAILAEPLLVTLFQYGAFGGDD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF-- 121
             + ++ L  Y+  +  F+L +VL   FYAR D+ TP +  I+++V   V+ + LF F  
Sbjct: 351 RFMAAASLRAYTLGLGAFMLVKVLAPGFYAREDMTTPVRIGIIAMVTNMVLNM-LFVFPL 409

Query: 122 -----IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
                +G  G+A A     W+N   L   L +   + L       ++ I  S+ +M + +
Sbjct: 410 MWWFEMGHVGLALATSVAAWLNATLLYRGLHRAGILVLESSAKQWLIKIMASAAVMSVLL 469

Query: 177 VFFKP 181
           +   P
Sbjct: 470 LQITP 474


>gi|16764526|ref|NP_460141.1| virulence protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56413843|ref|YP_150918.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161614609|ref|YP_001588574.1| hypothetical protein SPAB_02359 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167994032|ref|ZP_02575124.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168234094|ref|ZP_02659152.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168237250|ref|ZP_02662308.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168244767|ref|ZP_02669699.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168264039|ref|ZP_02686012.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467120|ref|ZP_02700962.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168822611|ref|ZP_02834611.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194443717|ref|YP_002040424.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447763|ref|YP_002045169.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194469012|ref|ZP_03074996.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735329|ref|YP_002114169.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197249902|ref|YP_002146873.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264386|ref|ZP_03164460.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244023|ref|YP_002215967.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389386|ref|ZP_03215997.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204930756|ref|ZP_03221629.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207857322|ref|YP_002243973.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|585533|sp|P37169|MVIN_SALTY RecName: Full=Virulence factor mviN
 gi|438252|emb|CAA81134.1| mviB [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|505363|dbj|BAA04980.1| ORF2 [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16419686|gb|AAL20100.1| putative virulence factor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|56128100|gb|AAV77606.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161363973|gb|ABX67741.1| hypothetical protein SPAB_02359 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402380|gb|ACF62602.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406067|gb|ACF66286.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194455376|gb|EDX44215.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710831|gb|ACF90052.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195630440|gb|EDX49066.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197213605|gb|ACH51002.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197242641|gb|EDY25261.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289793|gb|EDY29154.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938539|gb|ACH75872.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199601831|gb|EDZ00377.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204320215|gb|EDZ05419.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205328025|gb|EDZ14789.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331932|gb|EDZ18696.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205336443|gb|EDZ23207.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205341040|gb|EDZ27804.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205347375|gb|EDZ34006.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206709125|emb|CAR33458.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261246381|emb|CBG24190.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992943|gb|ACY87828.1| putative virulence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157711|emb|CBW17203.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312912157|dbj|BAJ36131.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321223788|gb|EFX48851.1| putative peptidoglycan lipid II flippase MurJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322616540|gb|EFY13449.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620519|gb|EFY17383.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622513|gb|EFY19358.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629664|gb|EFY26439.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632616|gb|EFY29362.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636889|gb|EFY33592.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641573|gb|EFY38211.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322644063|gb|EFY40609.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650036|gb|EFY46454.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653962|gb|EFY50285.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658494|gb|EFY54756.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322663352|gb|EFY59554.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670086|gb|EFY66226.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674850|gb|EFY70941.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676680|gb|EFY72747.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682602|gb|EFY78621.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686645|gb|EFY82624.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323129440|gb|ADX16870.1| putative virulence protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323195759|gb|EFZ80935.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198349|gb|EFZ83453.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203167|gb|EFZ88197.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209170|gb|EFZ94107.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323209674|gb|EFZ94603.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217870|gb|EGA02585.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323222159|gb|EGA06543.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224930|gb|EGA09188.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229672|gb|EGA13795.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232897|gb|EGA16993.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240632|gb|EGA24674.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242946|gb|EGA26967.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323250263|gb|EGA34152.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252638|gb|EGA36476.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258834|gb|EGA42487.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323266932|gb|EGA50417.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269973|gb|EGA53422.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326623716|gb|EGE30061.1| putative virulence protein [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 524

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|320540010|ref|ZP_08039667.1| integral membrane protein MviN [Serratia symbiotica str. Tucson]
 gi|320029933|gb|EFW11955.1| integral membrane protein MviN [Serratia symbiotica str. Tucson]
          Length = 511

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNQDEYSRLMDWGLRLCFLLALPSAIALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALVAYSVGLMGLILVKVLAPGFYSRQDIKTPVKIAIITLIM 393


>gi|289828587|ref|ZP_06546412.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 524

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|197362766|ref|YP_002142403.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197094243|emb|CAR59748.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 524

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|326628172|gb|EGE34515.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 533

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 309 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 369 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 415


>gi|152984733|ref|YP_001350534.1| integral membrane protein MviN [Pseudomonas aeruginosa PA7]
 gi|150959891|gb|ABR81916.1| integral membrane protein MviN [Pseudomonas aeruginosa PA7]
          Length = 512

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +++Q+ S L +  +       +PC+  L +L + +  +L++ G FTA D
Sbjct: 287 LLPMLSKTYSNKDRQEYSRLLDWGLRLCFLLVLPCSLALAILAEPLTVSLFQYGKFTATD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I +++
Sbjct: 347 AAMTQRALVAYSVGLLGIILVKVLAPGFYAQQNIRTPVKIAIFTLI 392


>gi|170725650|ref|YP_001759676.1| integral membrane protein MviN [Shewanella woodyi ATCC 51908]
 gi|169810997|gb|ACA85581.1| integral membrane protein MviN [Shewanella woodyi ATCC 51908]
          Length = 519

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 69/128 (53%), Gaps = 2/128 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +     ++  +  ++ +L  G+P    L++L K ++  L+ RGAFT  D
Sbjct: 296 ILPALSKKHVNDEGGGFAKTMDWGVKAILLLGMPAMCGLILLAKPMLMVLFMRGAFTVDD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I+++V   V  + +F    
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMVSNMVFNV-IFAIPF 414

Query: 124 GY-GIATA 130
           GY G+A A
Sbjct: 415 GYVGLAIA 422


>gi|226941412|ref|YP_002796486.1| MviN [Laribacter hongkongensis HLHK9]
 gi|226716339|gb|ACO75477.1| MviN [Laribacter hongkongensis HLHK9]
          Length = 522

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      N +  S L +  I   +   +PC   L ++ + +I TL+  G FTA D
Sbjct: 287 LLPSLSRHAAGGNPETFSRLLDWGIRLSVLLAVPCAVGLAVMAEPLIATLFMYGKFTAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
             +    L  Y+  ++G +L +VL   FYAR ++KTP K  ++++
Sbjct: 347 MDMTRMALLAYAVGLLGLILVKVLAPGFYARQNLKTPVKIALITL 391


>gi|226329865|ref|ZP_03805383.1| hypothetical protein PROPEN_03778 [Proteus penneri ATCC 35198]
 gi|225200660|gb|EEG83014.1| hypothetical protein PROPEN_03778 [Proteus penneri ATCC 35198]
          Length = 533

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N ++  +L +  +       +PCT  L +L   +  +L++ G F A D
Sbjct: 309 LLPSLSKSFASGNTEEYRKLMDWGLRLCFLLALPCTIGLAILSGPLTASLFQYGNFNAHD 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  Y   ++G ++ ++L   FY+R D+KTP K  I ++++
Sbjct: 369 ALMTQQALIAYCVGLMGLIIIKILAPGFYSRQDIKTPVKIAIATLIL 415


>gi|197284972|ref|YP_002150844.1| hypothetical protein PMI1101 [Proteus mirabilis HI4320]
 gi|227355374|ref|ZP_03839775.1| MVF family mouse virulence factor transporter [Proteus mirabilis
           ATCC 29906]
 gi|194682459|emb|CAR42379.1| putative membrane protein [Proteus mirabilis HI4320]
 gi|227164598|gb|EEI49469.1| MVF family mouse virulence factor transporter [Proteus mirabilis
           ATCC 29906]
          Length = 511

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N Q+  +L +  +       +PCT  L +L   +  +L++ G F   D
Sbjct: 287 LLPSLSKSFASGNTQEYQKLMDWGLRLCFLLALPCTLGLALLSGPLTISLFQYGNFNGHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  Y   ++G ++ ++L   FY+R D+KTP K  I ++++
Sbjct: 347 ALMTQQALVAYCIGLMGLIIIKILAPGFYSRQDIKTPVKIAIATLIL 393


>gi|114320011|ref|YP_741694.1| integral membrane protein MviN [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226405|gb|ABI56204.1| integral membrane protein MviN [Alkalilimnicola ehrlichii MLHE-1]
          Length = 522

 Score = 65.5 bits (158), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 5/150 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS+     + ++ S+  +  + +VL    P T  L  +   II TL+  G F   D
Sbjct: 288 LLPRLSAEHAAASPERFSQTLDWGLRWVLVLIAPATVGLSAMALPIIATLFHYGQFVELD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF-- 121
            +  +  L+ YS  + GF+L +VL    +AR D++TP +  ++S++   V+++    +  
Sbjct: 348 VMAAALSLAGYSLGLFGFVLVKVLAPGHFARQDMRTPVRCAVISLLCNMVLSVSAVLWLH 407

Query: 122 ---IGGYGIATAEVSWVWVNTICLAVALLK 148
              +G  G+A A     WVN   L  AL +
Sbjct: 408 DTGVGHVGLAMATAVAAWVNATLLYRALRR 437


>gi|261339369|ref|ZP_05967227.1| integral membrane protein MviN [Enterobacter cancerogenus ATCC
           35316]
 gi|288318170|gb|EFC57108.1| integral membrane protein MviN [Enterobacter cancerogenus ATCC
           35316]
          Length = 511

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|241766166|ref|ZP_04764071.1| integral membrane protein MviN [Acidovorax delafieldii 2AN]
 gi|241363771|gb|EER59120.1| integral membrane protein MviN [Acidovorax delafieldii 2AN]
          Length = 521

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    + Q+ S + +  +  V+   +PC   LL     ++ TL+  GA    D
Sbjct: 298 LTPQLAAAKAAGDAQRYSAMLDWGLRIVVLLAVPCAVALLTFATPLVATLFHHGALLDSD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L+ Y   ++G +  +VL   +YA  D++TP K  I+ +V+  ++   L P + 
Sbjct: 358 VGQIAIALAGYGAGLLGLVAIKVLAPGYYASQDIRTPVKIAIVVLVITQLLNAALVPLMA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN + L V LL+R
Sbjct: 418 HAGLALSIGLGALVNALWLLVGLLRR 443


>gi|213586530|ref|ZP_03368356.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
          Length = 450

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|237809691|ref|YP_002894131.1| integral membrane protein MviN [Tolumonas auensis DSM 9187]
 gi|237501952|gb|ACQ94545.1| integral membrane protein MviN [Tolumonas auensis DSM 9187]
          Length = 521

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 99/197 (50%), Gaps = 6/197 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +  + S+  +  +  VLF G+P  A +++L + I++ L+ RG F   +
Sbjct: 296 ILPSLSRRHVDADPLRFSQTMDWGVRMVLFLGLPAMAGIMVLREPILRVLFMRGEFGPHE 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPFI 122
             +    L   ++ ++  +L+RVL   F+AR D KTP ++ + S+    +  AI ++P +
Sbjct: 356 VSMAGGSLLASASGLLSLMLARVLAPGFHARQDTKTPVRYGMHSMASNMIFNAILIYP-L 414

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A +      VN I L   L +R        T   +L + +++ LM   +++    
Sbjct: 415 GYIGLALSTALSGTVNAISLFQGLYRRHIYRPGKDTAVFVLRLTVATLLMAGVLLWLN-- 472

Query: 183 LFNQLSAETAFSPFKNL 199
               LS+ TA+S ++++
Sbjct: 473 --APLSSWTAWSQWRSI 487


>gi|50121445|ref|YP_050612.1| putative virulence factor [Pectobacterium atrosepticum SCRI1043]
 gi|49611971|emb|CAG75420.1| putative virulence factor [Pectobacterium atrosepticum SCRI1043]
          Length = 511

 Score = 65.1 bits (157), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL+  FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIVVKVLVPGFYSRQDIKTPVKIAIVTLIL 393


>gi|150389129|ref|YP_001319178.1| integral membrane protein MviN [Alkaliphilus metalliredigens QYMF]
 gi|149948991|gb|ABR47519.1| integral membrane protein MviN [Alkaliphilus metalliredigens QYMF]
          Length = 533

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 79/157 (50%), Gaps = 20/157 (12%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L+     +N      +    I  +L   +P T  +++L + +IQ L+ERG FTA+
Sbjct: 299 AIFPTLAQEYGKQNISGVKNVMGHGINMILLIMVPATVGIIVLARPLIQVLFERGEFTAR 358

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG---LF 119
            T + +  L  Y   +VGF +  +L   FYA +D +TP        ++  VIA+G   +F
Sbjct: 359 GTEMTAIALGFYCVGLVGFSIRELLSKVFYAMHDTRTP--------MINGVIAVGINIIF 410

Query: 120 PFI-------GGYGIATAEVSWVWVNTICLAVALLKR 149
            F+       GG  +AT+ +S +  + + LAV L KR
Sbjct: 411 NFLLIGPLKHGGLALATS-ISGL-TSAVLLAVNLKKR 445


>gi|332186196|ref|ZP_08387941.1| integral membrane protein MviN [Sphingomonas sp. S17]
 gi|332013564|gb|EGI55624.1| integral membrane protein MviN [Sphingomonas sp. S17]
          Length = 525

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 87/172 (50%), Gaps = 4/172 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +    ++++ E +NR +E  L   +P T  L++  + I   L++ G F A +
Sbjct: 297 LLPTVSRLLGAGREKEAMETQNRGMELALLLTLPATVALIVCGQVITAALFQHGKFNATN 356

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           +   +  L+ +S  +  ++L +VL   FYAR D +TP +F   S+V+  V+ +    ++G
Sbjct: 357 SYYTAQALAAFSIGLPSYILVKVLTPGFYARADTRTPVRFATWSMVVNLVLNLIFIWWLG 416

Query: 124 GYG--IATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             G  +ATA  S   VN + L   L KR       Q   R   + +++ LMG
Sbjct: 417 HMGPPLATAIAS--TVNVVMLYRTLAKRGHFVADAQLRRRSWRMLVAALLMG 466


>gi|330501953|ref|YP_004378822.1| integral membrane protein MviN [Pseudomonas mendocina NK-01]
 gi|328916239|gb|AEB57070.1| integral membrane protein MviN [Pseudomonas mendocina NK-01]
          Length = 513

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 59/106 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +N+ +   L +  +       +PCT  L +L + ++ +L++ G FTA D
Sbjct: 287 LLPALSKTYASKNRDEYRRLLDWGLRLCFLLVLPCTLALAILAEPLVVSLFQYGKFTAND 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           +++    L  Y+  ++  +L ++L   FYA+ ++KTP +  ++S++
Sbjct: 347 SLMTQQALMAYAVGLLALILVKILAPGFYAQQNIKTPVRIAVISLL 392


>gi|227111622|ref|ZP_03825278.1| putative virulence factor [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 511

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L +VL+  FY+R D+KTP K  I ++++
Sbjct: 347 ALMTQRALIAYSVGLMGLILVKVLVPGFYSRQDIKTPVKIAIATLIL 393


>gi|192361843|ref|YP_001983673.1| integral membrane protein MviN [Cellvibrio japonicus Ueda107]
 gi|190688008|gb|ACE85686.1| integral membrane protein MviN [Cellvibrio japonicus Ueda107]
          Length = 534

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 78/153 (50%), Gaps = 6/153 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           ++P LS     ++ ++ S+  + AI +V+   +P T  L++L + I+ TL+  G   A D
Sbjct: 305 IMPSLSRQSTAQSAEKFSQTLDWAIRFVVLIALPATLALVILAEPILFTLFYHGKMAASD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF------VIAIG 117
            ++ S  L  Y+  +  F+L +VL+  ++AR D+KTP +  I +IV         V+ + 
Sbjct: 365 ILMSSYSLQAYALGLFAFMLIKVLVPGYFARQDMKTPVRTGIKAIVANILMKPVVVLPLA 424

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRR 150
            F  +G  G+A       +VN   L   L ++R
Sbjct: 425 YFFSLGHVGLALTTALAAYVNAWLLYRGLRQQR 457


>gi|330447398|ref|ZP_08311047.1| integral membrane protein MviN [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491589|dbj|GAA05544.1| integral membrane protein MviN [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 505

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 91/186 (48%), Gaps = 2/186 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++ +Q ++  +  +  VL  GIP    ++ L K ++  ++ RG F+  D
Sbjct: 282 ILPALSRKHVDKSPEQFAQTMDWGVRMVLLLGIPAMLGMITLAKPMLMVMFMRGEFSVYD 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PFI 122
               +  L + S  ++ ++L ++    +YAR D KTP K  I+++V   V   G+F PF 
Sbjct: 342 VNQTAVSLWVVSAGLLNYMLIKIFAPGYYARQDTKTPVKIGIIAMVSNMVFN-GIFAPFY 400

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G++ A V    +N   L   L       +  QT++ +L + I+   M   +++F P 
Sbjct: 401 GYVGLSIASVLSALLNASLLYRGLHIENIYRISRQTLFFVLRLAIAGVAMVSSLLWFSPT 460

Query: 183 LFNQLS 188
           +   LS
Sbjct: 461 MEQWLS 466


>gi|270262240|ref|ZP_06190512.1| virulence factor MviN [Serratia odorifera 4Rx13]
 gi|270044116|gb|EFA17208.1| virulence factor MviN [Serratia odorifera 4Rx13]
          Length = 511

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLARSFSSGNHDEYSRLMDWGLRLCFLLALPSAIALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++VM
Sbjct: 347 AAMTQRALVAYSIGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLVM 393


>gi|91794076|ref|YP_563727.1| integral membrane protein MviN [Shewanella denitrificans OS217]
 gi|91716078|gb|ABE56004.1| integral membrane protein MviN [Shewanella denitrificans OS217]
          Length = 519

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 102/223 (45%), Gaps = 19/223 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  ++ +   G+P    L++L K ++  L+ RGAF+ +D
Sbjct: 296 ILPALSRNFVNAEGEGFTRTMDWGVKAIFLLGMPAMFGLIVLAKPMLMVLFMRGAFSLED 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y   ++ F+L +VL   +Y+R+D KTP ++ I+++V   V+ + +F    
Sbjct: 356 ATMASYSLMAYGAGLLNFMLIKVLAPGYYSRHDTKTPVRYGIIAMVSNMVLNL-IFAVPF 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR--------ILSIFISSGLMGM 174
           GY G+A A        +  L   LL R    L  Q IYR        I  I  ++ +M +
Sbjct: 415 GYVGLAIATSL-----SALLNAGLLYR---GLHLQNIYRVSPETLTFIGKITAATAVMAL 466

Query: 175 FIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
            I  F P     L   T        A+I +GA L Y   + LL
Sbjct: 467 SIYCFGPVEQQWLDWHTGERLVALSALITAGA-LSYFVVLRLL 508


>gi|260222997|emb|CBA33121.1| Virulence factor mviN homolog [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 521

 Score = 65.1 bits (157), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 72/146 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L+ A   ++    S L +  +  V+   +PC+  LL   K I+  LY  GAF+A D
Sbjct: 298 LMPQLAGARAKDDAAGYSALLDWGLRIVVLLAVPCSIGLLTFSKPIVSVLYHYGAFSATD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  +   +VG +  +VL   +YA  D+KTP +  ++ ++   ++ + L P   
Sbjct: 358 VQQTTWALMGWGAGLVGIVAIKVLAPGYYASQDIKTPVRIAVVVLIATQLMNLALVPIFK 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G++ +      +N   L V L++R
Sbjct: 418 QAGLSLSISLGAMLNAGWLLVGLMRR 443


>gi|260574118|ref|ZP_05842123.1| integral membrane protein MviN [Rhodobacter sp. SW2]
 gi|259023584|gb|EEW26875.1| integral membrane protein MviN [Rhodobacter sp. SW2]
          Length = 514

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 69/134 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  + +      NR  E+ L   +P    L+++   +I+ L++RGAF   D
Sbjct: 286 LLPDLSRRLRAGDLEGGRSSFNRGAEFALMLTLPAAVALVVIALPLIEVLFQRGAFGPDD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L+ Y   +  F+L +VL   +YAR D + P  + ++++++    A+GL P +G
Sbjct: 346 TANTALALAAYGAGLPAFVLHKVLQPLYYAREDTRRPFIYAMVAMLVNAGFAVGLMPVLG 405

Query: 124 GYGIATAEVSWVWV 137
            +  A A     WV
Sbjct: 406 FFAAALATTVSAWV 419


>gi|242277526|ref|YP_002989655.1| integral membrane protein MviN [Desulfovibrio salexigens DSM 2638]
 gi|242120420|gb|ACS78116.1| integral membrane protein MviN [Desulfovibrio salexigens DSM 2638]
          Length = 506

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 83/171 (48%), Gaps = 3/171 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP L+           ++   +++  +LF  +P  A L+ L + +I  L++RGAF AQ
Sbjct: 291 AALPSLAKLYVEGQHDDFAKTLKQSVGLILFISLPAMAGLVSLAEPLIGLLFQRGAFDAQ 350

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                S  L  Y   +    +SR L+S FYA+ D +TP K  IL +++       L   I
Sbjct: 351 AVTATSQALMAYGIGLPFIAMSRPLVSAFYAQEDTRTPVKVAILCLLVNVGAGYLLMQHI 410

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQI-DLPFQTIYR--ILSIFISSG 170
              G+A A      +N + L++ + +R  +  +PF ++ +  +LS  I +G
Sbjct: 411 AHVGLALAVSISSMLNCLLLSIIMGRRTGLFPMPFGSVAKSVLLSALIGAG 461


>gi|194290626|ref|YP_002006533.1| hypothetical protein RALTA_A2541 [Cupriavidus taiwanensis LMG
           19424]
 gi|193224461|emb|CAQ70472.1| conserved hypothetical protein, mviN family [Cupriavidus
           taiwanensis LMG 19424]
          Length = 516

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 101/228 (44%), Gaps = 11/228 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +       +PC   L +    +   L+  G F A  
Sbjct: 291 LLPSLSRANASGDHAEYSSLLDWGLRLTFLLAVPCAVGLFVFGAPLTAVLFNYGKFDAHA 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G +  ++L   FYAR D++TP K  +L +V+     +   P+IG
Sbjct: 351 VEMTRQALVSYGVGLMGLISIKILAPGFYARQDIRTPVKIALLVLVITQACNVAFVPWIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM--GMFIVFFKP 181
             G+A +  +   +N + L    L+RR +  P    +  L+   +S L+  GM + F + 
Sbjct: 411 HAGLALSISAGATLNALLLFYG-LRRRGLYRPAPGWWLFLAQLTASVLLLSGMLLWFARN 469

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYS 229
             +  L A    +P   +A++ S  VL  +    +  G  +L  L+YS
Sbjct: 470 FDWIGLGA----TPLLRIALLASCLVLAAV----VYFGTLWLMGLRYS 509


>gi|91976100|ref|YP_568759.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB5]
 gi|91682556|gb|ABE38858.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB5]
          Length = 509

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 60/113 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   + + + RA E+ L F  P  A  L +P  I++ ++ RGAFT  D
Sbjct: 284 LLPEMSRQLAAGDDAGAKKSQRRAFEFTLLFSAPFVAAFLTVPDVIMRAMFARGAFTRAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
            I   + L+ Y+  ++ F+L R  ++ FYAR D  TP K  +  +    V+ +
Sbjct: 344 AIAAGATLAAYAIALIPFVLIRSAVAPFYARKDTATPVKAALTGVAANVVLKV 396


>gi|167553044|ref|ZP_02346794.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205322441|gb|EDZ10280.1| integral membrane protein MviN [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 524

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFVSGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 360 AAMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 406


>gi|328472068|gb|EGF42945.1| MviN protein [Vibrio parahaemolyticus 10329]
          Length = 520

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  V   GIP    L+ L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSQSEGFAHTMDWGVRMVTLLGIPAMLGLMALAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|293395792|ref|ZP_06640074.1| integral membrane protein MviN [Serratia odorifera DSM 4582]
 gi|291421729|gb|EFE94976.1| integral membrane protein MviN [Serratia odorifera DSM 4582]
          Length = 511

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I++++M  V+ +    FIG
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIMTQVMNLA---FIG 403


>gi|308126665|ref|ZP_05911697.2| integral membrane protein MviN [Vibrio parahaemolyticus AQ4037]
 gi|308107955|gb|EFO45495.1| integral membrane protein MviN [Vibrio parahaemolyticus AQ4037]
          Length = 520

 Score = 64.7 bits (156), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 2/140 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  V   GIP    L+ L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSQSEGFAHTMDWGVRMVTLLGIPAMLGLMALAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+ I+++V   V    +F +  
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFY 414

Query: 124 GY-GIATAEVSWVWVNTICL 142
           GY G+A A     +VN   L
Sbjct: 415 GYVGLAIATALSAFVNMALL 434


>gi|89072552|ref|ZP_01159124.1| virulence factor MviN [Photobacterium sp. SKA34]
 gi|89051656|gb|EAR57109.1| virulence factor MviN [Photobacterium sp. SKA34]
          Length = 519

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 2/130 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++ +Q ++  +  +  VL  GIP    ++ L K ++  ++ RG F+  D
Sbjct: 296 ILPALSRKHVDKSPEQFAQTMDWGVRMVLLLGIPAMLGMITLAKPMLMVMFMRGEFSVYD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PFI 122
               ++ L + S  ++ ++L ++    +YAR D KTP K  I++++   V   G+F PF 
Sbjct: 356 VNQTAASLWVVSAGLLNYMLIKIFAPGYYARQDTKTPVKIGIIAMISNMVFN-GIFAPFY 414

Query: 123 GGYGIATAEV 132
           G  G++ A V
Sbjct: 415 GYVGLSIASV 424


>gi|315126082|ref|YP_004068085.1| virulence factor mviN [Pseudoalteromonas sp. SM9913]
 gi|315014596|gb|ADT67934.1| virulence factor mviN [Pseudoalteromonas sp. SM9913]
          Length = 512

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 59/109 (54%), Gaps = 3/109 (2%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA---QDTILVSSYLSIYSTEIVGF 81
           +  +  V+F G+P    L+++   II  L++ GAF          VS  +  YS  +V F
Sbjct: 303 DWGVRLVIFLGLPAMIGLMIISPLIITVLFDHGAFKEAGIDHVKAVSLGVVAYSVGLVSF 362

Query: 82  LLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATA 130
           +L +VL   FY+R D KTP +  I+++V+  V  I L PFIG  G+A A
Sbjct: 363 MLIKVLAPGFYSRQDTKTPVRIGIVTLVLNMVFNIMLAPFIGYLGLALA 411


>gi|227329330|ref|ZP_03833354.1| putative virulence factor [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 511

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL+  FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLMGLIVVKVLVPGFYSRQDIKTPVKIAIVTLIL 393


>gi|103487497|ref|YP_617058.1| integral membrane protein MviN [Sphingopyxis alaskensis RB2256]
 gi|98977574|gb|ABF53725.1| integral membrane protein MviN [Sphingopyxis alaskensis RB2256]
          Length = 525

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 77/162 (47%), Gaps = 4/162 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +  E++  +  L++ A+E  +   +P    L +    I    Y  GA++A 
Sbjct: 296 AILPALSRFVAREDRDGAFRLQSNAVELSMLLTVPAAVALFVAGPAITSAFYVGGAYSAA 355

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D +   + +      +  ++L +VL+  F+AR D +TP      S+V+   + + L P +
Sbjct: 356 DGLATGAVVGGLVIGLPAYVLVKVLVPNFFARKDTRTPVWTAAASLVINIALNLLLIPPL 415

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS 164
           G  G+A A     W N   L  A+L R+ +   F    ++LS
Sbjct: 416 GIVGLALAGSLAAWCNVTML-YAILHRKGL---FHLTGQVLS 453


>gi|238788536|ref|ZP_04632329.1| Virulence factor mviN [Yersinia frederiksenii ATCC 33641]
 gi|238723449|gb|EEQ15096.1| Virulence factor mviN [Yersinia frederiksenii ATCC 33641]
          Length = 511

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S+L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSKLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 AMMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|157146235|ref|YP_001453553.1| hypothetical protein CKO_01992 [Citrobacter koseri ATCC BAA-895]
 gi|157083440|gb|ABV13118.1| hypothetical protein CKO_01992 [Citrobacter koseri ATCC BAA-895]
          Length = 497

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP +  I++++M
Sbjct: 333 ASMTQRALVAYSVGLIGLIVVKVLAPGFYSRQDIKTPVRIAIVTLIM 379


>gi|92112612|ref|YP_572540.1| integral membrane protein MviN [Chromohalobacter salexigens DSM
           3043]
 gi|91795702|gb|ABE57841.1| integral membrane protein MviN [Chromohalobacter salexigens DSM
           3043]
          Length = 530

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 81/161 (50%), Gaps = 10/161 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++ +  +++ + A+  VL  G+P    L++L + ++ +L+  GA T  D
Sbjct: 307 ILPALSKRHAEQSPEHFAKMLDWALRAVLLIGLPAGLALILLAEPLLVSLFHYGAMTDHD 366

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++ +  L  Y+  ++ F+L +VL   ++AR D KTP K  + +++   V  + L   + 
Sbjct: 367 IVMAARSLRAYALGLLPFMLIKVLAPGYFARQDTKTPVKIGVFAMLANMVFNLLLIWPLA 426

Query: 124 GYGIATAEVSWVWVNTICLAVAL----LKRRQIDLPFQTIY 160
             G+A A        + C    L    LKRR + L FQ+ +
Sbjct: 427 HAGLALATAL-----SACFNAGLLGWGLKRRGV-LQFQSGW 461


>gi|300310724|ref|YP_003774816.1| virulence factor transmembrane protein [Herbaspirillum seropedicae
           SmR1]
 gi|300073509|gb|ADJ62908.1| virulence factor transmembrane protein [Herbaspirillum seropedicae
           SmR1]
          Length = 517

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 11/157 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A   ++ ++ S L +  +       +P    L  L + +  TL+  G F A  
Sbjct: 291 LLPSLSNAHAAQDMEEYSSLLDWGLRLTFMLAMPSAVALATLSEPLTATLFHYGRFDALS 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF---- 119
             +    L  Y   ++G ++ ++L   FYA+ D++TP     + I +G +IA  L     
Sbjct: 351 VTMTGHALVAYGVGLIGLVMVKILAPGFYAKQDIRTP-----VIIAVGVLIATQLMNSVF 405

Query: 120 -PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
            P     G+A +      +N +CL +  L+RRQI +P
Sbjct: 406 VPLFAHAGLALSIGLGACLNALCLFIG-LRRRQIYVP 441


>gi|255322246|ref|ZP_05363392.1| integral membrane protein MviN [Campylobacter showae RM3277]
 gi|255300619|gb|EET79890.1| integral membrane protein MviN [Campylobacter showae RM3277]
          Length = 466

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIE--YVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           AL PK++  I+  N+ ++ +   ++ E  Y L F      I+L  P  II+ L+ERG+FT
Sbjct: 284 ALFPKITRQIKAGNEAEALKWMRKSFEILYFLLFAAAIGGIILAQP--IIKLLFERGSFT 341

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           A DT   +S L+ Y   ++ F L+++     YA    K  +K  ++++V   V+A+ L  
Sbjct: 342 ASDTAATASVLAAYMIGLLPFGLAKLFSLWLYAHLQQKLASKIAVITLVFNLVLAVALMQ 401

Query: 121 FIGGYGIATAE 131
             G +G+A A 
Sbjct: 402 IYGAFGLALAS 412


>gi|317047684|ref|YP_004115332.1| integral membrane protein MviN [Pantoea sp. At-9b]
 gi|316949301|gb|ADU68776.1| integral membrane protein MviN [Pantoea sp. At-9b]
          Length = 512

 Score = 64.7 bits (156), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L   +   L++ G FTA D
Sbjct: 287 LLPSLAKSFASNNHDEYSRLMDWGLRLCFLLALPSAVALGILSGPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++VM
Sbjct: 347 AAMTQRALIAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLVM 393


>gi|206889185|ref|YP_002248932.1| integral membrane protein MviN [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741123|gb|ACI20180.1| integral membrane protein MviN [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 518

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 100/214 (46%), Gaps = 9/214 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  +    K   ++    +++++ F  IP T  L+ML + II TL++RG F   
Sbjct: 287 AVLPTLSQHVAEGKKDIFTKDFTFSLKFLFFLTIPSTLGLMMLKEPIINTLFQRGVFDIT 346

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            TI  +  L  YS  I+G + SR + + FY+  D KTP      +++   +++I L   +
Sbjct: 347 ATINTAQALLFYSIGIIGTVGSRTITATFYSIQDTKTPVICAATAMLTNVIVSIALMNSM 406

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-----RILSIFISSGLMGMFIV 177
              G+A A      V    L    +KR+   + F +I        ++ FIS  +  + I 
Sbjct: 407 QHKGLALAYSVAATVQFFMLGY-FIKRKIPQISFNSIISSFLKSFVAAFISVSIAKL-IC 464

Query: 178 FFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYL 211
              P L+  L +E  F  F  LA  +S A   YL
Sbjct: 465 EINPSLW--LHSEKMFLKFIWLACAISVAAFFYL 496


>gi|24375038|ref|NP_719081.1| MviN protein [Shewanella oneidensis MR-1]
 gi|24349781|gb|AAN56525.1|AE015789_12 MviN protein [Shewanella oneidensis MR-1]
          Length = 519

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 97/212 (45%), Gaps = 3/212 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS            +  +  I+ +L  G+P    L++L + ++  L+ RGAFT  D
Sbjct: 296 ILPALSRNHVNAEGDGFGKTMDWGIKAILLLGLPAMMGLIVLAQPMLMVLFMRGAFTIND 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I++++   V  + +F    
Sbjct: 356 VQMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMVFNL-IFAIPF 414

Query: 124 GY-GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           GY G+A A      +N   L   L K     +   T+   L   +S+ LM + + +  P 
Sbjct: 415 GYVGLAVATSMSALLNATLLYRGLHKAGVYRITKPTMVFFLKAVVSTALMVVVLYYLLPS 474

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
               L    A      + +I+ GA + YL  +
Sbjct: 475 QSQWLEWGLALRAKALIGLIVVGA-MTYLVGL 505


>gi|316935540|ref|YP_004110522.1| integral membrane protein MviN [Rhodopseudomonas palustris DX-1]
 gi|315603254|gb|ADU45789.1| integral membrane protein MviN [Rhodopseudomonas palustris DX-1]
          Length = 509

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   + RA E+ L F +P  A  L +P  I++ L+ RGAF++ D
Sbjct: 284 LLPEMSRQLTAGDDSGARASQRRAFEFALLFSVPFVAAFLTVPDVIMRALFARGAFSSAD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +   + L+ Y+  +V  ++ R  ++ FYAR D  TP K  ++ I +  V+   L   + 
Sbjct: 344 ALAAGATLAAYAAALVPAVMIRSAVAPFYARKDTATPVKAALIGIGVNVVLKFLLMGPLA 403

Query: 124 GYGIATAEVSWVWVN 138
             G+A A  +  W+N
Sbjct: 404 QVGLALATAAGTWIN 418


>gi|209965902|ref|YP_002298817.1| integral membrane protein MviN [Rhodospirillum centenum SW]
 gi|209959368|gb|ACJ00005.1| integral membrane protein MviN [Rhodospirillum centenum SW]
          Length = 513

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 85/167 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP L+  +Q  +  +     +R +E+ L  G+P    L  +P+ I+  L++RG+F   
Sbjct: 286 ALLPTLARHVQAGDADRVRHYMSRGLEFGLLLGLPAAVALAAIPEPILTALFQRGSFGPA 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT   +  L  Y+  I  +++S+V  + F++R D +TP K  ++++     +A+ L P +
Sbjct: 346 DTAATALALQAYAIGIPAYVVSKVFNAAFFSRQDTRTPVKAAVVTLATNTGLALALSPVL 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
           G  GIA A     ++N   L   L +R  + L  Q   R   I +++
Sbjct: 406 GHVGIALASGVAAFLNVGLLGWGLHRRGHLALDAQVRRRAPRIALAA 452


>gi|317121538|ref|YP_004101541.1| integral membrane protein MviN [Thermaerobacter marianensis DSM
           12885]
 gi|315591518|gb|ADU50814.1| integral membrane protein MviN [Thermaerobacter marianensis DSM
           12885]
          Length = 541

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 99/211 (46%), Gaps = 3/211 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L+  I    +Q      NR++  + F   P  A L++L  E+ + ++ERGAF   DT 
Sbjct: 287 PELAIRIARGERQSFGAALNRSLRMLTFTLAPIVAGLILLRVEVTRLVFERGAFDFHDTQ 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L  Y   +VG+    +L    Y+  D  TPA    +++ +  V+ + L  F+   
Sbjct: 347 LTAFALLFYQLGLVGYAWRELLARALYSLGDTWTPASTAAVAMGLNIVLNLILVRFLAHG 406

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVFFKPCLF 184
           GIA A  + +W   + L V  ++RR   + ++ + +  L    ++ +M + +   +  +F
Sbjct: 407 GIALAASAAMWWGALVLMVR-IRRRAGQISYRAVGKGALQALAATTVMAVGVELGRRLIF 465

Query: 185 NQLS-AETAFSPFKNLAIILSGAVLVYLCSI 214
             L+ A  A  P   + +    AVL  L ++
Sbjct: 466 GDLARAALAGEPVGFVPLAAEVAVLTLLGAV 496


>gi|257454286|ref|ZP_05619552.1| integral membrane protein MviN [Enhydrobacter aerosaccus SK60]
 gi|257448303|gb|EEV23280.1| integral membrane protein MviN [Enhydrobacter aerosaccus SK60]
          Length = 528

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS +I  ++ QQ     + A    +  G+P +  L M+    + +L+E G F  QD
Sbjct: 298 ILPSLSKSIASDDHQQFGHTLDWATRLTVLVGVPASIALGMISNVFMISLFEHGEFVRQD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI---GLF 119
            ++    L   S  I+ F+L ++    F+AR+D + P K  ++S++   V+++   GLF
Sbjct: 358 AMMSGLALQCLSGGILAFMLIKIFAPAFFARHDSRIPVKVGVISVIANVVLSLILAGLF 416


>gi|261821363|ref|YP_003259469.1| integral membrane protein MviN [Pectobacterium wasabiae WPP163]
 gi|261605376|gb|ACX87862.1| integral membrane protein MviN [Pectobacterium wasabiae WPP163]
          Length = 511

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL+  FY+R D+KTP K  ++++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIVVKVLVPGFYSRQDIKTPVKIAMVTLIL 393


>gi|332161467|ref|YP_004298044.1| hypothetical protein YE105_C1845 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318605445|emb|CBY26943.1| proposed peptidoglycan lipid II flippase MurJ [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665697|gb|ADZ42341.1| hypothetical protein YE105_C1845 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863565|emb|CBX73679.1| virulence factor mviN homolog [Yersinia enterocolitica W22703]
          Length = 511

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S+L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSKLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIIVKVLAPGFYSRQNIKTPVKIAIITLII 393


>gi|239814462|ref|YP_002943372.1| integral membrane protein MviN [Variovorax paradoxus S110]
 gi|239801039|gb|ACS18106.1| integral membrane protein MviN [Variovorax paradoxus S110]
          Length = 517

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 69/146 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L+ A   ++  + S L +  +  V+    PC   LL+  K ++  L+  GA+  +D
Sbjct: 294 LMPQLAGARAAKDDARYSSLLDLGLRLVVLLSAPCAVALLLFAKPLVAVLFHNGAYQGED 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   ++G +  +VL   +YAR D +TP    +  +V+  V+ + L P + 
Sbjct: 354 VQRTTVALMGYGVGLIGLVAIKVLAPGYYARQDTRTPMLIAVGVLVLTQVLNVFLVPVLQ 413

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
              +         VN I L V L++R
Sbjct: 414 HAALTLTIAIGALVNAIWLLVGLIRR 439


>gi|297171680|gb|ADI22674.1| uncharacterized membrane protein, putative virulence factor
           [uncultured Gemmatimonadales bacterium HF0500_22O06]
          Length = 509

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 65/115 (56%), Gaps = 1/115 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+ LP+LS  +++E +Q  +   + A+  V FF IP  A+ L+L   ++  +++ GAF +
Sbjct: 284 ASELPELSR-MRVEEEQILASRVSTALRRVSFFVIPSAAVYLVLGDVVVAAVFQTGAFGS 342

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
            +T++    L  Y+  +     SRVL S FYA  D KTPAK   + IV+  VI +
Sbjct: 343 VETLVTWGVLGAYAIGLPASASSRVLSSAFYALRDTKTPAKIAYIRIVVSIVIGL 397


>gi|218549203|ref|YP_002382994.1| hypothetical protein EFER_1860 [Escherichia fergusonii ATCC 35469]
 gi|218356744|emb|CAQ89372.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia fergusonii ATCC 35469]
          Length = 525

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N ++ + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 301 LLPSLSKSFASGNHEEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 360

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 361 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 407


>gi|324113864|gb|EGC07838.1| integral membrane protein MviN [Escherichia fergusonii B253]
 gi|325497622|gb|EGC95481.1| hypothetical protein ECD227_1719 [Escherichia fergusonii ECD227]
          Length = 512

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N ++ + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 288 LLPSLSKSFASGNHEEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 348 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 394


>gi|319779513|ref|YP_004130426.1| peptidoglycan lipid II flippase MurJ [Taylorella equigenitalis
           MCE9]
 gi|317109537|gb|ADU92283.1| peptidoglycan lipid II flippase MurJ [Taylorella equigenitalis
           MCE9]
          Length = 543

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  I   +K+    L N  ++     GIPC   + +L   +I TL+  GAF   D
Sbjct: 291 LLPSLSETIAKGDKESYVRLLNWGLKLTFLLGIPCIVGMALLGDGLISTLFNYGAFGHDD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    +  Y+  ++G L  ++L   +YA+ ++KTP K  I  +++     + L P   
Sbjct: 351 VRMTKYAVIAYAVGLLGILCVKILAPGYYAQQNIKTPVKVAIAVLIVTQFFNLLLVPIFN 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N+  L + L +R
Sbjct: 411 HAGLALSIGMGAILNSTLLYIGLRRR 436


>gi|238762983|ref|ZP_04623950.1| Virulence factor mviN [Yersinia kristensenii ATCC 33638]
 gi|238698741|gb|EEP91491.1| Virulence factor mviN [Yersinia kristensenii ATCC 33638]
          Length = 511

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S+L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSKLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLII 393


>gi|327393463|dbj|BAK10885.1| virulence factor MviN [Pantoea ananatis AJ13355]
          Length = 512

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L ML   +   L++ G FTA D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGMLSGPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIV 393


>gi|85059225|ref|YP_454927.1| putative virulence factor [Sodalis glossinidius str. 'morsitans']
 gi|84779745|dbj|BAE74522.1| putative virulence factor [Sodalis glossinidius str. 'morsitans']
          Length = 513

 Score = 64.3 bits (155), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + S L +  +       +P    L +L   +   L++ G F+A D
Sbjct: 287 LLPSLSRSFTRGNHDEYSRLLDWGLRLCFMLALPSAVALGILAHPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  +VG +L +VL   FY+R D+KTP +  +++++M
Sbjct: 347 ALMTQRALIAYSVGLVGLILVKVLAPGFYSRQDIKTPVRMAMITLLM 393


>gi|300716210|ref|YP_003741013.1| Virulence factor MviN, possible MOP superfamliy efflux pump
           [Erwinia billingiae Eb661]
 gi|299062046|emb|CAX59162.1| Virulence factor MviN, possible MOP superfamliy efflux pump
           [Erwinia billingiae Eb661]
          Length = 512

 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +PC   L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFVLALPCAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R ++KTP +  I +++M
Sbjct: 347 ASMTQRALVAYSVGLMGIIVVKVLAPGFYSRQNIKTPVRIAIATLIM 393


>gi|123442650|ref|YP_001006627.1| hypothetical protein YE2409 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089611|emb|CAL12460.1| putative membrane protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 511

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S+L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSKLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIV 393


>gi|291617012|ref|YP_003519754.1| MviN [Pantoea ananatis LMG 20103]
 gi|291152042|gb|ADD76626.1| MviN [Pantoea ananatis LMG 20103]
          Length = 528

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L ML   +   L++ G FTA D
Sbjct: 303 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGMLSGPLTVALFQYGKFTAFD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 363 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIV 409


>gi|94677020|ref|YP_588727.1| integral membrane protein MviN [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|94220170|gb|ABF14329.1| integral membrane protein MviN [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 508

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 4   LLPKLS-SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           LLP LS S ++  N ++ S L +  +       +P +  L++L K I   L++   F+A 
Sbjct: 286 LLPLLSHSVVKSNNAEEYSCLLDWGLRICFLLALPSSVALVILAKPITVVLFQYDQFSAF 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           D ++    L  YS  ++G +L +VL   FY+R D+KTP +  I+S+++
Sbjct: 346 DVMMTQRALQAYSVGLIGIMLVKVLAPGFYSRQDIKTPVQLAIISLII 393


>gi|121998617|ref|YP_001003404.1| integral membrane protein MviN [Halorhodospira halophila SL1]
 gi|121590022|gb|ABM62602.1| integral membrane protein MviN [Halorhodospira halophila SL1]
          Length = 529

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS+       ++ S   +  +  VL    P TA L++L   I+ TL++ GAF  +D
Sbjct: 289 LLPRLSAEHAGSEPERFSRTLDWGLRLVLLVVAPATAGLIVLAGPILATLFQYGAFGPED 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            +  S  L+ YS  + GF+L +VL   +++R D+KTP
Sbjct: 349 VVAASWSLAAYSLGLFGFVLVKVLTPGYFSREDMKTP 385


>gi|134300929|ref|YP_001114425.1| integral membrane protein MviN [Desulfotomaculum reducens MI-1]
 gi|134053629|gb|ABO51600.1| integral membrane protein MviN [Desulfotomaculum reducens MI-1]
          Length = 523

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 75/147 (51%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A  P +++      +Q+ ++   RAI  V+ F +P    L++L   +I+ L+E G F A+
Sbjct: 285 AFYPTITTLAAQGKQQELADTVLRAIRMVILFALPAGVGLMVLATPVIKLLFEHGQFGAR 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + +  L  Y+  +VG   + +L   FYA+ D +TP K   +++ +  + ++ L   +
Sbjct: 345 ATEMTAIALFFYAIGLVGQAANIILTRAFYAQQDTRTPVKLMFVTVTVNLIFSLLLIGPL 404

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
              G+A A      +NT+ LA  L KR
Sbjct: 405 KHGGLALANSIASLINTVMLAWFLNKR 431


>gi|291613496|ref|YP_003523653.1| integral membrane protein MviN [Sideroxydans lithotrophicus ES-1]
 gi|291583608|gb|ADE11266.1| integral membrane protein MviN [Sideroxydans lithotrophicus ES-1]
          Length = 514

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      +  + S L +  +  V    +P    L M+   ++ T ++ GAF A D
Sbjct: 287 LLPSLSRHHADNSTAEYSRLLDWGLRLVFMLTLPAALALGMIAVPLLATFFQHGAFVAND 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            ++  + L  YS  ++G +  +VL   FYAR D++TP K  I ++V
Sbjct: 347 VLMTRNALVGYSVGLIGLIAVKVLAPGFYARQDIRTPVKIGIATLV 392


>gi|225849585|ref|YP_002729819.1| integral membrane protein MviN [Persephonella marina EX-H1]
 gi|225646227|gb|ACO04413.1| integral membrane protein MviN [Persephonella marina EX-H1]
          Length = 504

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 66/131 (50%), Gaps = 2/131 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALL  LS     ++        N  I+  +F  IP T  +++L KEIIQ L  RG F   
Sbjct: 284 ALLVSLSRYFSEKDMDGFYRDLNNGIKLAIFISIPATVGMIVLGKEIIQLLLMRGEFRES 343

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP--AKFYILSIVMGFVIAIGLFP 120
           DT++    L  YS  + G+ L+R   S F+A  D+KTP  +  + L + + F + +G   
Sbjct: 344 DTLMTYYALVGYSIGLTGYALTRPFKSAFFAVGDMKTPLNSTVFGLGVSIIFAVLLGFLM 403

Query: 121 FIGGYGIATAE 131
             G +G+ATA 
Sbjct: 404 KWGVFGLATAS 414


>gi|113869020|ref|YP_727509.1| hypothetical protein H16_A3066 [Ralstonia eutropha H16]
 gi|113527796|emb|CAJ94141.1| hypothetical membrane protein in MviN family [Ralstonia eutropha
           H16]
          Length = 536

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 11/228 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +       +PC   L +    +   L+  G F A  
Sbjct: 311 LLPSLSKANASGDHAEYSSLLDWGLRLTFLLAVPCAVGLFVFGAPLTAVLFNYGKFDAHA 370

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G +  ++L   FYAR D++TP K  +L +V+         P+IG
Sbjct: 371 VEMTRQALVSYGVGLMGLISIKILAPGFYARQDIRTPVKIALLVLVITQACNYAFVPWIG 430

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM--GMFIVFFKP 181
             G+A +  +   +N + L    L+RR +  P    +  L+   +S L+  GM + F + 
Sbjct: 431 HAGLALSISAGATINALLLFFG-LRRRGLYRPAPGWWLFLAQLCASVLLLSGMLLWFARN 489

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYS 229
             +  L A    +P   +A++ S  VL  +    +  G  +L  L+YS
Sbjct: 490 FDWIGLGA----TPLLRIALLASCLVLAAV----VYFGTLWLMGLRYS 529


>gi|329297217|ref|ZP_08254553.1| integral membrane protein MviN [Plautia stali symbiont]
          Length = 512

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L   +   L++ G FTA D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILSGPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL S FY+R D+KTP K  I +++M
Sbjct: 347 AAMTQRALIAYSVGLMGLIVVKVLASGFYSRQDIKTPVKIAIATLIM 393


>gi|113460561|ref|YP_718625.1| virulence factor [Haemophilus somnus 129PT]
 gi|112822604|gb|ABI24693.1| conserved membrane protein [Haemophilus somnus 129PT]
          Length = 518

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 106/222 (47%), Gaps = 12/222 (5%)

Query: 4   LLPKLSSAI--QLENKQQSS----ELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           +LP LS     + +N ++S+    +  +  +  +L FGIP    + +L + ++  L+ RG
Sbjct: 291 ILPTLSRHYVNRTDNIEKSAVDFRQTMDWGVRMILLFGIPAMIGIAVLAQPMLLVLFMRG 350

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIA 115
            F+  D    S  L  ++  ++ F+L ++L + +YAR D +TP K  I+++V  MGF + 
Sbjct: 351 KFSFSDVQAASYSLWAFNAGLLSFMLIKILANGYYARQDTQTPVKIGIIAMVSNMGFNLL 410

Query: 116 IGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMF 175
              F +I   G+A A      +N   L   L K        Q+    + + IS+ +MG  
Sbjct: 411 AIPFSYI---GLAIASAMSATLNAYLLYRGLAKADIYHFTRQSAVFFVKVLISAIIMGAV 467

Query: 176 IVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
           I ++ P L +     T F+    L  ++  AV+ Y   + LL
Sbjct: 468 IWYYSPAL-SLWKQMTFFTRVHWLGWLIFVAVITYFVMLILL 508


>gi|117926700|ref|YP_867317.1| integral membrane protein MviN [Magnetococcus sp. MC-1]
 gi|117610456|gb|ABK45911.1| integral membrane protein MviN [Magnetococcus sp. MC-1]
          Length = 529

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 68/129 (52%), Gaps = 2/129 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS+     +    +   + A+  +    +P    L+ML + I+  L+ERGAF ++
Sbjct: 299 AILPALSAHAAKNDDAALNHDLDFALRLIFLINLPAMVGLIMLREPILALLFERGAFGSE 358

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG-FVIAIGLFPF 121
            T L  + L  Y+  ++ F   +VL   FYAR D KTP +  I+ ++   F+  I +FP 
Sbjct: 359 TTHLTGNALFAYAMGLMAFASVKVLAPAFYARKDTKTPVRIAIICMITNMFLNVILMFP- 417

Query: 122 IGGYGIATA 130
           +G  G+A A
Sbjct: 418 LGYVGLALA 426


>gi|82913424|ref|XP_728638.1| virulence factor MVIN [Plasmodium yoelii yoelii str. 17XNL]
 gi|23485091|gb|EAA20203.1| Virulence factor MVIN, putative [Plasmodium yoelii yoelii]
          Length = 1197

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 60/106 (56%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP L++     ++   S   + A+ +V+  G+P T  L++L K ++ TL+E   F+  
Sbjct: 274 AILPHLAAGHLDHDRDGFSRTLDWALRWVVLLGLPATLGLMILAKPLVFTLFEHDEFSDH 333

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
           DT + S  L  Y+  + G +  +VL S F AR DV+TP ++ + +I
Sbjct: 334 DTEMASRSLIAYAAGLPGAVAVKVLASGFSARRDVRTPLRYGLYAI 379


>gi|317491771|ref|ZP_07950206.1| integral membrane protein MviN [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920205|gb|EFV41529.1| integral membrane protein MviN [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 512

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ ++        S L +  +       +P T  L +L K +I +L++ G FTA D
Sbjct: 287 LLPSLAKSVSSGRLDDYSRLMDWGLRLCFVLALPSTVALGILSKPLIASLFQYGQFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T +    L  YS  ++G +L +VL   FY+  +++TP K  I S++M
Sbjct: 347 TEMTQRALIAYSVGLMGIILVKVLAPGFYSHQNIRTPVKIAIASLIM 393


>gi|238756953|ref|ZP_04618141.1| Virulence factor mviN [Yersinia aldovae ATCC 35236]
 gi|238704783|gb|EEP97312.1| Virulence factor mviN [Yersinia aldovae ATCC 35236]
          Length = 511

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIL 393


>gi|170768195|ref|ZP_02902648.1| integral membrane protein MviN [Escherichia albertii TW07627]
 gi|170122961|gb|EDS91892.1| integral membrane protein MviN [Escherichia albertii TW07627]
          Length = 512

 Score = 63.9 bits (154), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 288 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 348 ALMTQRALITYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 394


>gi|167623063|ref|YP_001673357.1| integral membrane protein MviN [Shewanella halifaxensis HAW-EB4]
 gi|167353085|gb|ABZ75698.1| integral membrane protein MviN [Shewanella halifaxensis HAW-EB4]
          Length = 519

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 61/110 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS         + ++  +  ++ ++  G+P    L+ML K ++  L+ RGAF+ +D
Sbjct: 296 ILPALSKRHVNAESDEFAKTMDWGVKAIILLGLPAMCGLIMLAKPMLMVLFMRGAFSYED 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
             + S  L  Y + ++ F+L ++L   +Y+R D +TP ++ I+++V   V
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKILAPGYYSRQDTRTPVRYGIIAMVSNMV 405


>gi|331662475|ref|ZP_08363398.1| integral membrane protein MviN [Escherichia coli TA143]
 gi|284920892|emb|CBG33955.1| putative membrane protein [Escherichia coli 042]
 gi|331060897|gb|EGI32861.1| integral membrane protein MviN [Escherichia coli TA143]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|256018674|ref|ZP_05432539.1| hypothetical protein ShiD9_07149 [Shigella sp. D9]
 gi|332102095|gb|EGJ05441.1| integral membrane protein MviN [Shigella sp. D9]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|26247209|ref|NP_753249.1| virulence factor mviN-like protein [Escherichia coli CFT073]
 gi|30062607|ref|NP_836778.1| putative virulence factor [Shigella flexneri 2a str. 2457T]
 gi|56479815|ref|NP_706990.2| putative virulence factor [Shigella flexneri 2a str. 301]
 gi|74311631|ref|YP_310050.1| putative virulence factor [Shigella sonnei Ss046]
 gi|82544465|ref|YP_408412.1| virulence factor [Shigella boydii Sb227]
 gi|110805087|ref|YP_688607.1| putative virulence factor [Shigella flexneri 5 str. 8401]
 gi|157157105|ref|YP_001462303.1| integral membrane protein MviN [Escherichia coli E24377A]
 gi|157160596|ref|YP_001457914.1| integral membrane protein MviN [Escherichia coli HS]
 gi|170020535|ref|YP_001725489.1| integral membrane protein MviN [Escherichia coli ATCC 8739]
 gi|170684055|ref|YP_001744112.1| integral membrane protein MviN [Escherichia coli SMS-3-5]
 gi|187731551|ref|YP_001880759.1| integral membrane protein MviN [Shigella boydii CDC 3083-94]
 gi|191168475|ref|ZP_03030263.1| integral membrane protein MviN [Escherichia coli B7A]
 gi|193064533|ref|ZP_03045613.1| integral membrane protein MviN [Escherichia coli E22]
 gi|193069481|ref|ZP_03050435.1| integral membrane protein MviN [Escherichia coli E110019]
 gi|194428491|ref|ZP_03061031.1| integral membrane protein MviN [Escherichia coli B171]
 gi|194432493|ref|ZP_03064780.1| integral membrane protein MviN [Shigella dysenteriae 1012]
 gi|209918323|ref|YP_002292407.1| hypothetical protein ECSE_1132 [Escherichia coli SE11]
 gi|215486278|ref|YP_002328709.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218553648|ref|YP_002386561.1| hypothetical protein ECIAI1_1104 [Escherichia coli IAI1]
 gi|218689022|ref|YP_002397234.1| hypothetical protein ECED1_1213 [Escherichia coli ED1a]
 gi|218694603|ref|YP_002402270.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218700428|ref|YP_002408057.1| hypothetical protein ECIAI39_2094 [Escherichia coli IAI39]
 gi|218704477|ref|YP_002411996.1| hypothetical protein ECUMN_1243 [Escherichia coli UMN026]
 gi|227886573|ref|ZP_04004378.1| virulence factor mviN family protein [Escherichia coli 83972]
 gi|260867432|ref|YP_003233834.1| putative inner membrane protein MviN [Escherichia coli O111:H- str.
           11128]
 gi|306814082|ref|ZP_07448255.1| putative inner membrane protein MviN [Escherichia coli NC101]
 gi|307310153|ref|ZP_07589803.1| integral membrane protein MviN [Escherichia coli W]
 gi|312968858|ref|ZP_07783065.1| integral membrane protein MviN [Escherichia coli 2362-75]
 gi|312971205|ref|ZP_07785383.1| integral membrane protein MviN [Escherichia coli 1827-70]
 gi|331646327|ref|ZP_08347430.1| integral membrane protein MviN [Escherichia coli M605]
 gi|331657130|ref|ZP_08358092.1| integral membrane protein MviN [Escherichia coli TA206]
 gi|331667469|ref|ZP_08368333.1| integral membrane protein MviN [Escherichia coli TA271]
 gi|331676860|ref|ZP_08377556.1| integral membrane protein MviN [Escherichia coli H591]
 gi|26107610|gb|AAN79809.1|AE016759_83 Virulence factor mviN homolog [Escherichia coli CFT073]
 gi|30040853|gb|AAP16584.1| putative virulence factor [Shigella flexneri 2a str. 2457T]
 gi|56383366|gb|AAN42697.2| putative virulence factor [Shigella flexneri 2a str. 301]
 gi|73855108|gb|AAZ87815.1| putative virulence factor [Shigella sonnei Ss046]
 gi|81245876|gb|ABB66584.1| putative virulence factor [Shigella boydii Sb227]
 gi|110614635|gb|ABF03302.1| putative virulence factor [Shigella flexneri 5 str. 8401]
 gi|157066276|gb|ABV05531.1| integral membrane protein MviN [Escherichia coli HS]
 gi|157079135|gb|ABV18843.1| integral membrane protein MviN [Escherichia coli E24377A]
 gi|169755463|gb|ACA78162.1| integral membrane protein MviN [Escherichia coli ATCC 8739]
 gi|170521773|gb|ACB19951.1| integral membrane protein MviN [Escherichia coli SMS-3-5]
 gi|187428543|gb|ACD07817.1| integral membrane protein MviN [Shigella boydii CDC 3083-94]
 gi|190901494|gb|EDV61255.1| integral membrane protein MviN [Escherichia coli B7A]
 gi|192927785|gb|EDV82399.1| integral membrane protein MviN [Escherichia coli E22]
 gi|192957229|gb|EDV87678.1| integral membrane protein MviN [Escherichia coli E110019]
 gi|194413543|gb|EDX29825.1| integral membrane protein MviN [Escherichia coli B171]
 gi|194419380|gb|EDX35462.1| integral membrane protein MviN [Shigella dysenteriae 1012]
 gi|209911582|dbj|BAG76656.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|215264350|emb|CAS08707.1| predicted inner membrane protein [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218351335|emb|CAU97041.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli 55989]
 gi|218360416|emb|CAQ97968.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI1]
 gi|218370414|emb|CAR18221.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli IAI39]
 gi|218426586|emb|CAR07414.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli ED1a]
 gi|218431574|emb|CAR12453.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli UMN026]
 gi|222032822|emb|CAP75561.1| Virulence factor mviN homolog [Escherichia coli LF82]
 gi|227836777|gb|EEJ47243.1| virulence factor mviN family protein [Escherichia coli 83972]
 gi|257763788|dbj|BAI35283.1| predicted inner membrane protein MviN [Escherichia coli O111:H-
           str. 11128]
 gi|281178178|dbj|BAI54508.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|281600489|gb|ADA73473.1| Integral membrane protein MviN precursor [Shigella flexneri
           2002017]
 gi|305852719|gb|EFM53167.1| putative inner membrane protein MviN [Escherichia coli NC101]
 gi|306909871|gb|EFN40365.1| integral membrane protein MviN [Escherichia coli W]
 gi|307553071|gb|ADN45846.1| integral membrane protein MviN [Escherichia coli ABU 83972]
 gi|310336407|gb|EFQ01593.1| integral membrane protein MviN [Escherichia coli 1827-70]
 gi|312286260|gb|EFR14173.1| integral membrane protein MviN [Escherichia coli 2362-75]
 gi|312945631|gb|ADR26458.1| putative inner membrane protein MviN [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313650482|gb|EFS14889.1| integral membrane protein MviN [Shigella flexneri 2a str. 2457T]
 gi|315060347|gb|ADT74674.1| peptidoglycan lipid II flippase [Escherichia coli W]
 gi|320179232|gb|EFW54190.1| putative peptidoglycan lipid II flippase MurJ [Shigella boydii ATCC
           9905]
 gi|320186985|gb|EFW61698.1| putative peptidoglycan lipid II flippase MurJ [Shigella flexneri
           CDC 796-83]
 gi|320196449|gb|EFW71072.1| putative peptidoglycan lipid II flippase MurJ [Escherichia coli
           WV_060327]
 gi|320200964|gb|EFW75548.1| putative peptidoglycan lipid II flippase MurJ [Escherichia coli
           EC4100B]
 gi|323163750|gb|EFZ49569.1| integral membrane protein MviN [Escherichia coli E128010]
 gi|323165576|gb|EFZ51363.1| integral membrane protein MviN [Shigella sonnei 53G]
 gi|323174803|gb|EFZ60418.1| integral membrane protein MviN [Escherichia coli LT-68]
 gi|323175701|gb|EFZ61295.1| integral membrane protein MviN [Escherichia coli 1180]
 gi|323185808|gb|EFZ71169.1| integral membrane protein MviN [Escherichia coli 1357]
 gi|323379092|gb|ADX51360.1| integral membrane protein MviN [Escherichia coli KO11]
 gi|324117360|gb|EGC11267.1| integral membrane protein MviN [Escherichia coli E1167]
 gi|330910883|gb|EGH39393.1| putative peptidoglycan lipid 2 flippase MurJ [Escherichia coli
           AA86]
 gi|331045079|gb|EGI17206.1| integral membrane protein MviN [Escherichia coli M605]
 gi|331055378|gb|EGI27387.1| integral membrane protein MviN [Escherichia coli TA206]
 gi|331065054|gb|EGI36949.1| integral membrane protein MviN [Escherichia coli TA271]
 gi|331075549|gb|EGI46847.1| integral membrane protein MviN [Escherichia coli H591]
 gi|332088759|gb|EGI93871.1| integral membrane protein MviN [Shigella boydii 5216-82]
 gi|332092942|gb|EGI98010.1| integral membrane protein MviN [Shigella dysenteriae 155-74]
 gi|332094045|gb|EGI99097.1| integral membrane protein MviN [Shigella boydii 3594-74]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|223042011|ref|ZP_03612192.1| virulence factor-like MviN [Actinobacillus minor 202]
 gi|223017173|gb|EEF15604.1| virulence factor-like MviN [Actinobacillus minor 202]
          Length = 522

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 101/217 (46%), Gaps = 8/217 (3%)

Query: 5   LPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++    +++ Q+  E +   +  +  VL  GIP    + +L + +I T++ RG F  
Sbjct: 300 LSRIAKKKDIDDNQRKVEFQSTMDWGVRMVLLLGIPAMIGIAVLAQPMIMTIFMRGKFGL 359

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D I  S  L I    +  ++L  +L + FYA  + KTP K  +++ V      +   PF
Sbjct: 360 SDVIASSHALWIMCFGLNSYMLISILANGFYANQNTKTPVKIGLIATVSNMCFGVLAIPF 419

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      VN   L   L K+    +  +T++ +L + I+  +MG  I +F P
Sbjct: 420 -GYLGLAMASALSAAVNAGLLYRQLSKQAIYHISRKTVFFVLKLLIAGLIMGGVIHYFCP 478

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
            L +  +  T    +  L +I    VL  +C  ++LL
Sbjct: 479 DLQSWYAMSTLLKVYWLLWLI----VLAAICYFAMLL 511


>gi|254482884|ref|ZP_05096121.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2148]
 gi|214036965|gb|EEB77635.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2148]
          Length = 527

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 78/152 (51%), Gaps = 6/152 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+      + Q +   + A+  VL  G+P    L++L + I+ TL++ GA T  D
Sbjct: 296 ILPNLSAHRAAAREDQFASTLDWAMRSVLLIGLPAALALILLAEPILITLFQYGALTPTD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV------MGFVIAIG 117
             + S  L  YS  ++ F+L ++L   +YAR D  TP K  I+++       + FV+ + 
Sbjct: 356 VDMASLSLRAYSLGLIAFMLIKILAPGYYARKDTATPVKIGIIAMAANMVMNLAFVLPLL 415

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKR 149
            +  +G  G+A A  +  W+N   L   LLK+
Sbjct: 416 WYFNVGHVGLALATSASAWLNAGLLLRGLLKQ 447


>gi|331682571|ref|ZP_08383190.1| integral membrane protein MviN [Escherichia coli H299]
 gi|331080202|gb|EGI51381.1| integral membrane protein MviN [Escherichia coli H299]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|300816771|ref|ZP_07096991.1| integral membrane protein MviN [Escherichia coli MS 107-1]
 gi|300821150|ref|ZP_07101299.1| integral membrane protein MviN [Escherichia coli MS 119-7]
 gi|300899588|ref|ZP_07117827.1| integral membrane protein MviN [Escherichia coli MS 198-1]
 gi|300918670|ref|ZP_07135252.1| integral membrane protein MviN [Escherichia coli MS 115-1]
 gi|300922595|ref|ZP_07138695.1| integral membrane protein MviN [Escherichia coli MS 182-1]
 gi|300938634|ref|ZP_07153363.1| integral membrane protein MviN [Escherichia coli MS 21-1]
 gi|300974373|ref|ZP_07172585.1| integral membrane protein MviN [Escherichia coli MS 45-1]
 gi|301328561|ref|ZP_07221622.1| integral membrane protein MviN [Escherichia coli MS 78-1]
 gi|309798063|ref|ZP_07692438.1| integral membrane protein MviN [Escherichia coli MS 145-7]
 gi|300356859|gb|EFJ72729.1| integral membrane protein MviN [Escherichia coli MS 198-1]
 gi|300410616|gb|EFJ94154.1| integral membrane protein MviN [Escherichia coli MS 45-1]
 gi|300414213|gb|EFJ97523.1| integral membrane protein MviN [Escherichia coli MS 115-1]
 gi|300421072|gb|EFK04383.1| integral membrane protein MviN [Escherichia coli MS 182-1]
 gi|300456419|gb|EFK19912.1| integral membrane protein MviN [Escherichia coli MS 21-1]
 gi|300526449|gb|EFK47518.1| integral membrane protein MviN [Escherichia coli MS 119-7]
 gi|300530545|gb|EFK51607.1| integral membrane protein MviN [Escherichia coli MS 107-1]
 gi|300844953|gb|EFK72713.1| integral membrane protein MviN [Escherichia coli MS 78-1]
 gi|308118346|gb|EFO55608.1| integral membrane protein MviN [Escherichia coli MS 145-7]
 gi|315291118|gb|EFU50481.1| integral membrane protein MviN [Escherichia coli MS 153-1]
 gi|315296700|gb|EFU55995.1| integral membrane protein MviN [Escherichia coli MS 16-3]
 gi|324007909|gb|EGB77128.1| integral membrane protein MviN [Escherichia coli MS 57-2]
 gi|324017427|gb|EGB86646.1| integral membrane protein MviN [Escherichia coli MS 117-3]
          Length = 497

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 333 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 379


>gi|283784864|ref|YP_003364729.1| putative outer membrane protein [Citrobacter rodentium ICC168]
 gi|282948318|emb|CBG87900.1| putative outer membrane protein [Citrobacter rodentium ICC168]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 347 ALMTQKALIAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 393


>gi|82777316|ref|YP_403665.1| putative virulence factor [Shigella dysenteriae Sd197]
 gi|309788123|ref|ZP_07682729.1| integral membrane protein MviN [Shigella dysenteriae 1617]
 gi|81241464|gb|ABB62174.1| putative virulence factor [Shigella dysenteriae Sd197]
 gi|308923975|gb|EFP69476.1| integral membrane protein MviN [Shigella dysenteriae 1617]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|188496352|ref|ZP_03003622.1| integral membrane protein MviN [Escherichia coli 53638]
 gi|188491551|gb|EDU66654.1| integral membrane protein MviN [Escherichia coli 53638]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|191172400|ref|ZP_03033941.1| integral membrane protein MviN [Escherichia coli F11]
 gi|190907284|gb|EDV66882.1| integral membrane protein MviN [Escherichia coli F11]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|110641245|ref|YP_668975.1| virulence factor mviN-like protein [Escherichia coli 536]
 gi|110342837|gb|ABG69074.1| virulence factor mviN-like protein [Escherichia coli 536]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|300982628|ref|ZP_07176212.1| integral membrane protein MviN [Escherichia coli MS 200-1]
 gi|300307093|gb|EFJ61613.1| integral membrane protein MviN [Escherichia coli MS 200-1]
 gi|324013343|gb|EGB82562.1| integral membrane protein MviN [Escherichia coli MS 60-1]
          Length = 497

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 333 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 379


>gi|260854552|ref|YP_003228443.1| putative inner membrane protein MviN [Escherichia coli O26:H11 str.
           11368]
 gi|257753201|dbj|BAI24703.1| predicted inner membrane protein MviN [Escherichia coli O26:H11
           str. 11368]
 gi|323156876|gb|EFZ43010.1| integral membrane protein MviN [Escherichia coli EPECa14]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|89900907|ref|YP_523378.1| integral membrane protein MviN [Rhodoferax ferrireducens T118]
 gi|89345644|gb|ABD69847.1| integral membrane protein MviN [Rhodoferax ferrireducens T118]
          Length = 545

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/212 (22%), Positives = 97/212 (45%), Gaps = 2/212 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L+ A    +K + S + +  +  V+   +PC   L++ P  ++  LY  GA T  D
Sbjct: 322 LMPQLALARAAGDKAKYSAMLDWGLRLVVLLAVPCAVALIVFPMPLVAVLYHYGAMTDLD 381

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L  +   ++G +  +VL   +YA  D KTP    +  +++  ++ + L P   
Sbjct: 382 VQKITYALMGWGVGLIGIVAIKVLAPGYYANQDTKTPVTIAVAVLIITQLLNVVLVPVFA 441

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
              +  +      +N   L V L++R            +L +  +  L+ +F+++     
Sbjct: 442 HAALTLSIGIGAMINAGWLLVGLMRRGSYKPEPGWGAFVLQVIAACALLAVFLMWANSAF 501

Query: 184 -FNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
            + QL +E+ F     LA++L GA  +Y  +I
Sbjct: 502 AWTQLRSES-FKRIWLLALVLIGAGAIYFAAI 532


>gi|323967010|gb|EGB62436.1| integral membrane protein MviN [Escherichia coli M863]
 gi|323976558|gb|EGB71646.1| integral membrane protein MviN [Escherichia coli TW10509]
 gi|327253468|gb|EGE65106.1| integral membrane protein MviN [Escherichia coli STEC_7v]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|260843309|ref|YP_003221087.1| putative inner membrane protein MviN [Escherichia coli O103:H2 str.
           12009]
 gi|257758456|dbj|BAI29953.1| predicted inner membrane protein MviN [Escherichia coli O103:H2
           str. 12009]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|238751577|ref|ZP_04613067.1| Virulence factor mviN [Yersinia rohdei ATCC 43380]
 gi|238710139|gb|EEQ02367.1| Virulence factor mviN [Yersinia rohdei ATCC 43380]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S+L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSKLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|300902460|ref|ZP_07120442.1| integral membrane protein MviN [Escherichia coli MS 84-1]
 gi|300928379|ref|ZP_07143913.1| integral membrane protein MviN [Escherichia coli MS 187-1]
 gi|300950164|ref|ZP_07164109.1| integral membrane protein MviN [Escherichia coli MS 116-1]
 gi|300954391|ref|ZP_07166845.1| integral membrane protein MviN [Escherichia coli MS 175-1]
 gi|301023256|ref|ZP_07187053.1| integral membrane protein MviN [Escherichia coli MS 69-1]
 gi|301304992|ref|ZP_07211094.1| integral membrane protein MviN [Escherichia coli MS 124-1]
 gi|301644981|ref|ZP_07244947.1| integral membrane protein MviN [Escherichia coli MS 146-1]
 gi|300318627|gb|EFJ68411.1| integral membrane protein MviN [Escherichia coli MS 175-1]
 gi|300397101|gb|EFJ80639.1| integral membrane protein MviN [Escherichia coli MS 69-1]
 gi|300405492|gb|EFJ89030.1| integral membrane protein MviN [Escherichia coli MS 84-1]
 gi|300450511|gb|EFK14131.1| integral membrane protein MviN [Escherichia coli MS 116-1]
 gi|300463637|gb|EFK27130.1| integral membrane protein MviN [Escherichia coli MS 187-1]
 gi|300839710|gb|EFK67470.1| integral membrane protein MviN [Escherichia coli MS 124-1]
 gi|301076710|gb|EFK91516.1| integral membrane protein MviN [Escherichia coli MS 146-1]
 gi|315253870|gb|EFU33838.1| integral membrane protein MviN [Escherichia coli MS 85-1]
 gi|315287376|gb|EFU46787.1| integral membrane protein MviN [Escherichia coli MS 110-3]
          Length = 497

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 333 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 379


>gi|301051147|ref|ZP_07197977.1| integral membrane protein MviN [Escherichia coli MS 185-1]
 gi|300297168|gb|EFJ53553.1| integral membrane protein MviN [Escherichia coli MS 185-1]
          Length = 497

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 273 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 333 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 379


>gi|293404353|ref|ZP_06648347.1| virulence factor mviN [Escherichia coli FVEC1412]
 gi|293409435|ref|ZP_06653011.1| integral membrane protein MviN [Escherichia coli B354]
 gi|293433359|ref|ZP_06661787.1| integral membrane protein MviN [Escherichia coli B088]
 gi|298380133|ref|ZP_06989738.1| virulence factor [Escherichia coli FVEC1302]
 gi|291324178|gb|EFE63600.1| integral membrane protein MviN [Escherichia coli B088]
 gi|291428939|gb|EFF01964.1| virulence factor mviN [Escherichia coli FVEC1412]
 gi|291469903|gb|EFF12387.1| integral membrane protein MviN [Escherichia coli B354]
 gi|298279831|gb|EFI21339.1| virulence factor [Escherichia coli FVEC1302]
          Length = 524

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 300 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 360 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 406


>gi|238894116|ref|YP_002918850.1| putative virulence factor [Klebsiella pneumoniae NTUH-K2044]
 gi|238546432|dbj|BAH62783.1| putative virulence factor [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 524

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 300 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 360 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIMTQVMNLA---FIG 416


>gi|15801186|ref|NP_287203.1| putative virulence factor [Escherichia coli O157:H7 EDL933]
 gi|25298797|pir||C85669 probable virulence factor mviN [imported] - Escherichia coli
           (strain O157:H7, substrain EDL933)
 gi|12514607|gb|AAG55815.1|AE005317_4 putative virulence factor [Escherichia coli O157:H7 str. EDL933]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|15830701|ref|NP_309474.1| hypothetical protein ECs1447 [Escherichia coli O157:H7 str. Sakai]
 gi|16129032|ref|NP_415587.1| probable peptidoglycan lipid II flippase required for murein
           synthesis [Escherichia coli str. K-12 substr. MG1655]
 gi|89107915|ref|AP_001695.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. W3110]
 gi|91210221|ref|YP_540207.1| putative virulence factor [Escherichia coli UTI89]
 gi|117623255|ref|YP_852168.1| hypothetical protein APECO1_151 [Escherichia coli APEC O1]
 gi|168747155|ref|ZP_02772177.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758639|ref|ZP_02783646.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764481|ref|ZP_02789488.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4501]
 gi|168767728|ref|ZP_02792735.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773914|ref|ZP_02798921.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783599|ref|ZP_02808606.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790004|ref|ZP_02815011.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC869]
 gi|168802014|ref|ZP_02827021.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC508]
 gi|170080720|ref|YP_001730040.1| inner membrane protein [Escherichia coli str. K-12 substr. DH10B]
 gi|194438038|ref|ZP_03070131.1| integral membrane protein MviN [Escherichia coli 101-1]
 gi|195935459|ref|ZP_03080841.1| inner membrane protein [Escherichia coli O157:H7 str. EC4024]
 gi|208806686|ref|ZP_03249023.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4206]
 gi|208816392|ref|ZP_03257571.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822798|ref|ZP_03263117.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397958|ref|YP_002269915.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4115]
 gi|217328570|ref|ZP_03444652.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           TW14588]
 gi|218557951|ref|YP_002390864.1| hypothetical protein ECS88_1083 [Escherichia coli S88]
 gi|237706945|ref|ZP_04537426.1| MviN [Escherichia sp. 3_2_53FAA]
 gi|238900323|ref|YP_002926119.1| putative inner membrane protein [Escherichia coli BW2952]
 gi|253773907|ref|YP_003036738.1| integral membrane protein MviN [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161175|ref|YP_003044283.1| putative inner membrane protein [Escherichia coli B str. REL606]
 gi|254792451|ref|YP_003077288.1| putative inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|256023233|ref|ZP_05437098.1| predicted inner membrane protein [Escherichia sp. 4_1_40B]
 gi|261227026|ref|ZP_05941307.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256260|ref|ZP_05948793.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291282089|ref|YP_003498907.1| Virulence factor mviN-like protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|293414364|ref|ZP_06657013.1| integral membrane protein MviN [Escherichia coli B185]
 gi|297516828|ref|ZP_06935214.1| Virulence factor mviN-like protein [Escherichia coli OP50]
 gi|301029717|ref|ZP_07192771.1| integral membrane protein MviN [Escherichia coli MS 196-1]
 gi|307137704|ref|ZP_07497060.1| Virulence factor mviN-like protein [Escherichia coli H736]
 gi|331641613|ref|ZP_08342748.1| integral membrane protein MviN [Escherichia coli H736]
 gi|331652122|ref|ZP_08353141.1| integral membrane protein MviN [Escherichia coli M718]
 gi|331672589|ref|ZP_08373378.1| integral membrane protein MviN [Escherichia coli TA280]
 gi|84027818|sp|P0AF17|MVIN_ECO57 RecName: Full=Virulence factor mviN homolog
 gi|84027819|sp|P0AF16|MVIN_ECOLI RecName: Full=Virulence factor mviN homolog
 gi|1787309|gb|AAC74153.1| probable peptidoglycan lipid II flippase required for murein
           synthesis [Escherichia coli str. K-12 substr. MG1655]
 gi|4062648|dbj|BAA35877.1| predicted inner membrane protein [Escherichia coli str. K12 substr.
           W3110]
 gi|13360911|dbj|BAB34870.1| putative virulence factor [Escherichia coli O157:H7 str. Sakai]
 gi|91071795|gb|ABE06676.1| putative virulence factor [Escherichia coli UTI89]
 gi|115512379|gb|ABJ00454.1| MviN [Escherichia coli APEC O1]
 gi|169888555|gb|ACB02262.1| predicted inner membrane protein [Escherichia coli str. K-12
           substr. DH10B]
 gi|187770524|gb|EDU34368.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4196]
 gi|188018126|gb|EDU56248.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4113]
 gi|188999083|gb|EDU68069.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354577|gb|EDU72996.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363190|gb|EDU81609.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365531|gb|EDU83947.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370458|gb|EDU88874.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC869]
 gi|189375936|gb|EDU94352.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC508]
 gi|194422974|gb|EDX38968.1| integral membrane protein MviN [Escherichia coli 101-1]
 gi|208726487|gb|EDZ76088.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733040|gb|EDZ81728.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738283|gb|EDZ85966.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159358|gb|ACI36791.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           EC4115]
 gi|209773448|gb|ACI85036.1| putative virulence factor [Escherichia coli]
 gi|209773450|gb|ACI85037.1| putative virulence factor [Escherichia coli]
 gi|209773452|gb|ACI85038.1| putative virulence factor [Escherichia coli]
 gi|209773454|gb|ACI85039.1| putative virulence factor [Escherichia coli]
 gi|209773456|gb|ACI85040.1| putative virulence factor [Escherichia coli]
 gi|217318997|gb|EEC27423.1| integral membrane protein MviN [Escherichia coli O157:H7 str.
           TW14588]
 gi|218364720|emb|CAR02410.1| conserved hypothetical protein; putative inner membrane protein
           [Escherichia coli S88]
 gi|226898155|gb|EEH84414.1| MviN [Escherichia sp. 3_2_53FAA]
 gi|238862544|gb|ACR64542.1| predicted inner membrane protein [Escherichia coli BW2952]
 gi|242376873|emb|CAQ31590.1| lipid II flippase [Escherichia coli BL21(DE3)]
 gi|253324951|gb|ACT29553.1| integral membrane protein MviN [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973076|gb|ACT38747.1| predicted inner membrane protein [Escherichia coli B str. REL606]
 gi|253977290|gb|ACT42960.1| predicted inner membrane protein [Escherichia coli BL21(DE3)]
 gi|254591851|gb|ACT71212.1| predicted inner membrane protein [Escherichia coli O157:H7 str.
           TW14359]
 gi|260449791|gb|ACX40213.1| integral membrane protein MviN [Escherichia coli DH1]
 gi|290761962|gb|ADD55923.1| Virulence factor mviN-like protein [Escherichia coli O55:H7 str.
           CB9615]
 gi|291434422|gb|EFF07395.1| integral membrane protein MviN [Escherichia coli B185]
 gi|294491805|gb|ADE90561.1| integral membrane protein MviN [Escherichia coli IHE3034]
 gi|299877405|gb|EFI85616.1| integral membrane protein MviN [Escherichia coli MS 196-1]
 gi|307627461|gb|ADN71765.1| Virulence factor mviN-like protein [Escherichia coli UM146]
 gi|309701341|emb|CBJ00642.1| putative membrane protein [Escherichia coli ETEC H10407]
 gi|315135701|dbj|BAJ42860.1| virulence factor mviN-like protein [Escherichia coli DH1]
 gi|315618239|gb|EFU98829.1| integral membrane protein MviN [Escherichia coli 3431]
 gi|320189751|gb|EFW64407.1| putative peptidoglycan lipid II flippase MurJ [Escherichia coli
           O157:H7 str. EC1212]
 gi|320637520|gb|EFX07320.1| Virulence factor mviN-like protein [Escherichia coli O157:H7 str.
           G5101]
 gi|320643081|gb|EFX12282.1| Virulence factor mviN-like protein [Escherichia coli O157:H- str.
           493-89]
 gi|320648539|gb|EFX17194.1| Virulence factor mviN-like protein [Escherichia coli O157:H- str. H
           2687]
 gi|320653853|gb|EFX21927.1| Virulence factor mviN-like protein [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659333|gb|EFX26902.1| Virulence factor mviN-like protein [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664468|gb|EFX31619.1| Virulence factor mviN-like protein [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323190580|gb|EFZ75852.1| integral membrane protein MviN [Escherichia coli RN587/1]
 gi|323937809|gb|EGB34073.1| integral membrane protein MviN [Escherichia coli E1520]
 gi|323942538|gb|EGB38705.1| integral membrane protein MviN [Escherichia coli E482]
 gi|323953245|gb|EGB49111.1| integral membrane protein MviN [Escherichia coli H252]
 gi|323957893|gb|EGB53605.1| integral membrane protein MviN [Escherichia coli H263]
 gi|323962668|gb|EGB58246.1| integral membrane protein MviN [Escherichia coli H489]
 gi|323973342|gb|EGB68531.1| integral membrane protein MviN [Escherichia coli TA007]
 gi|326339291|gb|EGD63105.1| Proposed peptidoglycan lipid II flippase MurJ [Escherichia coli
           O157:H7 str. 1125]
 gi|326344749|gb|EGD68497.1| Proposed peptidoglycan lipid II flippase MurJ [Escherichia coli
           O157:H7 str. 1044]
 gi|331038411|gb|EGI10631.1| integral membrane protein MviN [Escherichia coli H736]
 gi|331050400|gb|EGI22458.1| integral membrane protein MviN [Escherichia coli M718]
 gi|331070232|gb|EGI41598.1| integral membrane protein MviN [Escherichia coli TA280]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|262043223|ref|ZP_06016357.1| integral membrane protein MviN [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330001815|ref|ZP_08304107.1| integral membrane protein MviN [Klebsiella sp. MS 92-3]
 gi|259039405|gb|EEW40542.1| integral membrane protein MviN [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537538|gb|EGF63763.1| integral membrane protein MviN [Klebsiella sp. MS 92-3]
          Length = 511

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIMTQVMNLA---FIG 403


>gi|152969634|ref|YP_001334743.1| putative virulence factor [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|150954483|gb|ABR76513.1| putative virulence factor [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 499

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 275 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 335 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIMTQVMNLA---FIG 391


>gi|323703009|ref|ZP_08114665.1| integral membrane protein MviN [Desulfotomaculum nigrificans DSM
           574]
 gi|323532022|gb|EGB21905.1| integral membrane protein MviN [Desulfotomaculum nigrificans DSM
           574]
          Length = 523

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 74/147 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A  P +++      +++ ++   RAI  V+ F +P    L++L   II+ L+E G F  +
Sbjct: 285 AFYPTITTLAAQGKQRELADTVLRAIRTVILFALPAGVGLMVLSTPIIKLLFEHGEFGPR 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + +  L  YS  +VG   + +L   FYA+ D KTP K   +++ +  + ++ L   +
Sbjct: 345 ATAMTALALMFYSIGLVGQAANIILTRGFYAQQDTKTPVKLMAVTVTVNLIFSLLLIGPL 404

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
              G+A A      VNT+ L+  L KR
Sbjct: 405 KHGGLALANSIASLVNTVMLSYYLNKR 431


>gi|294139771|ref|YP_003555749.1| MviN protein [Shewanella violacea DSS12]
 gi|293326240|dbj|BAJ00971.1| MviN protein [Shewanella violacea DSS12]
          Length = 519

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 87/180 (48%), Gaps = 4/180 (2%)

Query: 4   LLPKLSS-AIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           +LP LS   I  E     S + +  ++ +L  G+P    L++L K ++  L+ RG FT  
Sbjct: 296 ILPALSKKHINAEGSGFESTM-DWGVKAILLLGMPAMCGLIVLAKPMLMVLFMRGEFTLH 354

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPF 121
           +  + S  L  Y   ++ F+L +VL   +Y+R D +TP ++ I+++V   V  + L +PF
Sbjct: 355 NVEMSSYSLMAYGCGLLSFMLIKVLAPGYYSRQDTRTPVRYGIIAMVCNMVFNLILAYPF 414

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      +N   L   L K     +  QT +  L   +S  +M   +V F P
Sbjct: 415 -GYVGLAMATSMSALLNAGLLYRGLHKAGVYRVSRQTAFFFLKALLSCCVMVALLVHFLP 473


>gi|99034163|ref|ZP_01314252.1| hypothetical protein Wendoof_01000955 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 333

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 105/225 (46%), Gaps = 11/225 (4%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
             LLP +S   Q++N +   +++N+A+   L   +P TA  +++P  I+ TL+  G F  
Sbjct: 113 TVLLPLISK--QVDNTENIVKIQNKALNIGLMLIMPTTAAFIIIPDIILLTLFSYGRFDH 170

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
                    L  +S  +  F++++VLL  F+A+ ++K P  F ++ + +  V+ + L   
Sbjct: 171 YAVQQTVPTLIAFSLSLPAFIINKVLLPTFFAKGNLKIPTIFSLMCLGINVVLNLLLMNE 230

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
               GIA A     W+N+I L   L   +   +    +  ++ IF    +M + +  F  
Sbjct: 231 YQHTGIAIATSVSTWINSILLISYLTINKMYKVSQALLLNVMKIFEQRAVMSIALYIFNS 290

Query: 182 CL----FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGF 222
            L    F+++ A   +     L  +++ +V+VY   + L+    F
Sbjct: 291 LLAGLFFDKMLARIVY-----LTTLIALSVIVYFGILYLIFKGNF 330


>gi|120599903|ref|YP_964477.1| integral membrane protein MviN [Shewanella sp. W3-18-1]
 gi|146292160|ref|YP_001182584.1| integral membrane protein MviN [Shewanella putrefaciens CN-32]
 gi|120559996|gb|ABM25923.1| integral membrane protein MviN [Shewanella sp. W3-18-1]
 gi|145563850|gb|ABP74785.1| integral membrane protein MviN [Shewanella putrefaciens CN-32]
 gi|319425456|gb|ADV53530.1| peptidoglycan lipid II flippase, MurJ [Shewanella putrefaciens 200]
          Length = 519

 Score = 63.5 bits (153), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 2/111 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS            +  +  I+ +L  G+P    L++L K ++  L+ RGAF+  D
Sbjct: 296 ILPALSRNHVNAEGAGFGKTMDWGIKAILLLGLPAMMGLIVLAKPMLMVLFMRGAFSVHD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGF 112
             + S  L  Y + ++ F+L +VL   +Y+R D KTP ++ I++++  MGF
Sbjct: 356 VEMASYSLMAYGSGLLSFMLIKVLAPGYYSRQDTKTPVRYGIIAMITNMGF 406


>gi|269926715|ref|YP_003323338.1| integral membrane protein MviN [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790375|gb|ACZ42516.1| integral membrane protein MviN [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 514

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 89/183 (48%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A  P LS      +      +  RA++ V+FF +P +  +++L + II  L+ERG FT +
Sbjct: 286 AAFPALSREAGAMDIAAYKSVLKRAVKGVIFFILPASVGMMLLREPIIALLFERGKFTRE 345

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT+L +     ++  +  + L  +L   FYA  D  TP K  ++++++   ++  L   +
Sbjct: 346 DTLLTAQPFFFFAVGMWAYALVDMLPRAFYALQDTLTPLKVALVTVLLDIFVSFILVGPL 405

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPC 182
           G  G+A A      V  + L+  L  R    +  + I  +L   I++ LMG  ++  +P 
Sbjct: 406 GLRGLAFAFSLATIVQVLALSYLLRSRVGEWIDSEMINFLLKCCIATVLMGGLLILLRPW 465

Query: 183 LFN 185
           + N
Sbjct: 466 VVN 468


>gi|157371032|ref|YP_001479021.1| integral membrane protein MviN [Serratia proteamaculans 568]
 gi|157322796|gb|ABV41893.1| integral membrane protein MviN [Serratia proteamaculans 568]
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAIALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIITLIL 393


>gi|288936154|ref|YP_003440213.1| integral membrane protein MviN [Klebsiella variicola At-22]
 gi|288890863|gb|ADC59181.1| integral membrane protein MviN [Klebsiella variicola At-22]
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIMTQVMNLA---FIG 403


>gi|119509638|ref|ZP_01628784.1| hypothetical protein N9414_21586 [Nodularia spumigena CCY9414]
 gi|119465657|gb|EAW46548.1| hypothetical protein N9414_21586 [Nodularia spumigena CCY9414]
          Length = 534

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 84/158 (53%), Gaps = 6/158 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L + +   +L+ R  + +L   +   P  A++++L   I+Q +YERGAF 
Sbjct: 299 LLPLLPMFAKLADPEHWPDLKLRIRQGILLTAVTMLPLGALMIVLSVPIVQIVYERGAFK 358

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLF 119
            + T LVSS L  Y   +  +L   VL+  FYA  D +TP +  I +I +   + AI + 
Sbjct: 359 QEATQLVSSLLIAYGIGMFVYLGRDVLVRVFYALGDGQTPFRISIFNIFLNAGLDAILVK 418

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
           PF G  GI  A V  V  ++I + + LL R+   LP++
Sbjct: 419 PF-GATGIVLATVG-VNCSSILMLLWLLDRKLNGLPWR 454


>gi|206579788|ref|YP_002239299.1| integral membrane protein MviN [Klebsiella pneumoniae 342]
 gi|290510791|ref|ZP_06550161.1| integral membrane protein MviN [Klebsiella sp. 1_1_55]
 gi|206568846|gb|ACI10622.1| integral membrane protein MviN [Klebsiella pneumoniae 342]
 gi|289777507|gb|EFD85505.1| integral membrane protein MviN [Klebsiella sp. 1_1_55]
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M  V+ +    FIG
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIMTQVMNLA---FIG 403


>gi|146311239|ref|YP_001176313.1| integral membrane protein MviN [Enterobacter sp. 638]
 gi|145318115|gb|ABP60262.1| integral membrane protein MviN [Enterobacter sp. 638]
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L K +  +L++ G F+A D
Sbjct: 287 LLPSLSRSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|323947392|gb|EGB43397.1| integral membrane protein MviN [Escherichia coli H120]
          Length = 456

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|296135411|ref|YP_003642653.1| integral membrane protein MviN [Thiomonas intermedia K12]
 gi|295795533|gb|ADG30323.1| integral membrane protein MviN [Thiomonas intermedia K12]
          Length = 512

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 63/127 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   ++  + S L +  +   L   +P    LL+  + ++  LY  G F   D
Sbjct: 289 LLPSLSRASATQDVAKYSTLLDWGLRLTLVLALPSAIALLIFAQPLVSMLYNYGRFDHAD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +  +S L  Y   ++  +  ++L   FYAR D++TP K  ++ +V   ++ +   P++G
Sbjct: 349 VLATTSALRAYGVGLIALIGVKILAPGFYARQDLRTPVKIALVVLVCTQLMNLLFVPWLG 408

Query: 124 GYGIATA 130
             G+A A
Sbjct: 409 HAGLALA 415


>gi|146305986|ref|YP_001186451.1| integral membrane protein MviN [Pseudomonas mendocina ymp]
 gi|145574187|gb|ABP83719.1| integral membrane protein MviN [Pseudomonas mendocina ymp]
          Length = 513

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 59/106 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +++ +   L +  +       +PCT  L +L + ++ +L++ G FTA D
Sbjct: 287 LLPALSKTYASKDRDEYRRLLDWGLRLCFLLVLPCTLALAILAEPLVVSLFQYGKFTAND 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           +++    L  Y+  ++  +L ++L   FYA+ ++KTP +  ++S++
Sbjct: 347 SLMTQQALMAYAVGLLALILVKILAPGFYAQQNIKTPVRIAVVSLL 392


>gi|21672597|ref|NP_660664.1| virulence factor MviN [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25008824|sp|Q8K9L3|MVIN_BUCAP RecName: Full=Virulence factor mviN homolog
 gi|21623227|gb|AAM67875.1| virulence factor MviN [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 514

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 9/208 (4%)

Query: 15  ENKQQSSE--LRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLS 72
            N  QS    L N  I + L   +P + IL M  K ++  L++ G FT  D ++    L 
Sbjct: 296 SNNTQSEYKILLNWGIRFGLILSLPISVILFMFSKPLVIILFQYGKFTDFDVLMTQKALE 355

Query: 73  IYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEV 132
           +YS  +V F+L ++L+S FY+  +V  P +  IL++ +  ++   L  +    G+A +  
Sbjct: 356 LYSFGLVSFILVKILVSAFYSCQEVNIPMRISILTLFLTQLMNPFLIFYFQHSGLALSCS 415

Query: 133 SWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF---FKPCLFNQLSA 189
              W+N   L   L ++  I+        I  + I+  +M  F++F   F P        
Sbjct: 416 IASWINFFLLYWKLYQKGIINFKLNDFIFIFRLLIAVLVMTFFLIFMLYFIP----SWKI 471

Query: 190 ETAFSPFKNLAIILSGAVLVYLCSISLL 217
            + F     L  ILS + +VYL ++  L
Sbjct: 472 GSFFDKIIRLFTILSISGIVYLIALHFL 499


>gi|253688193|ref|YP_003017383.1| integral membrane protein MviN [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251754771|gb|ACT12847.1| integral membrane protein MviN [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 511

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L + +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNHDEYSRLMDWGLRLCFLLALPSAVALGILAQPLTVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL+  FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLMGLIVVKVLVPGFYSRQDIKTPVKIAIVTLIL 393


>gi|88858005|ref|ZP_01132647.1| virulence factor mviN [Pseudoalteromonas tunicata D2]
 gi|88819622|gb|EAR29435.1| virulence factor mviN [Pseudoalteromonas tunicata D2]
          Length = 516

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 73/133 (54%), Gaps = 9/133 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +LP LS   +L  +QQ    +   +  + +V++ G+P    L+++   II  L+  G F 
Sbjct: 287 ILPALS---KLHVEQQGHRFQATLDWGVRFVIWLGLPALFGLIVISPIIITVLFGHGEFM 343

Query: 61  AQ--DTILVSSY-LSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
           A+  + I   SY ++ Y+  +V F+L +VL   FYA+ + KTP K  I+++V+  V  I 
Sbjct: 344 AEGANNIEKVSYGVTAYALGLVSFMLIKVLAPGFYAQQNTKTPVKVGIIALVLNMVFNIM 403

Query: 118 LFPFIGGYGIATA 130
           L PF G  G+A A
Sbjct: 404 LAPFWGYVGLALA 416


>gi|296102915|ref|YP_003613061.1| virulence factor MviN [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295057374|gb|ADF62112.1| virulence factor MviN [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 517

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  +   L +  +       +P    L +L + +  +L++ G FTA D
Sbjct: 293 LLPSLSKSFASGNHDEYCRLMDWGLRLCFLLALPSAVALGILAQPLTVSLFQYGKFTAFD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  I++++M
Sbjct: 353 ASMTQQALIAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAIVTLIM 399


>gi|300814387|ref|ZP_07094658.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 836
           str. F0141]
 gi|300511495|gb|EFK38724.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 836
           str. F0141]
          Length = 533

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 92/181 (50%), Gaps = 2/181 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P L+ +    N  Q  ++ N +I+ VLF  +P T  +++L + +I+  +  G FT 
Sbjct: 288 AIVYPILTRSFGRGNMLQGKKVMNASIKSVLFLTVPATIGMIILARPLIEIAFVHGKFTV 347

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           +D I  +S L  YS  ++   L+ VL   +Y+ ND KTP     L++++   + + +   
Sbjct: 348 EDGISATSTLRFYSLSLISISLTNVLNRIYYSLNDTKTPFVIGALNVIINVGLNLLVAHH 407

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFIVFFK 180
            G  G+A A VS      + +   LL+++  +L  ++ I  I+   ++S  MG+  + + 
Sbjct: 408 YGTDGLA-ASVSIATTAAVFIGFYLLRKKIGNLGTKSYIKAIIKTVMASVAMGLVALTYF 466

Query: 181 P 181
           P
Sbjct: 467 P 467


>gi|238783285|ref|ZP_04627310.1| Virulence factor mviN [Yersinia bercovieri ATCC 43970]
 gi|238715878|gb|EEQ07865.1| Virulence factor mviN [Yersinia bercovieri ATCC 43970]
          Length = 512

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIVTLIL 393


>gi|226943307|ref|YP_002798380.1| integral membrane protein [Azotobacter vinelandii DJ]
 gi|226718234|gb|ACO77405.1| integral membrane protein MviN [Azotobacter vinelandii DJ]
          Length = 514

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 57/105 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S L +  +       +PC   L +L + +  +L++ G FTA D
Sbjct: 287 LLPALSKTHASRDRQEYSRLLDWGLRLCFLLVLPCALALAILAEPLTVSLFQYGRFTAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
            ++    L  Y+  ++G +L +VL   FYA+ +++TP +  +L++
Sbjct: 347 ALMTQYALIAYAVGLLGIILVKVLAPGFYAQQNIRTPVRIAMLTL 391


>gi|282882668|ref|ZP_06291278.1| integral membrane protein MviN [Peptoniphilus lacrimalis 315-B]
 gi|281297481|gb|EFA89967.1| integral membrane protein MviN [Peptoniphilus lacrimalis 315-B]
          Length = 533

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 92/181 (50%), Gaps = 2/181 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P L+ +    N  Q  ++ N +I+ VLF  +P T  +++L + +I+  +  G FT 
Sbjct: 288 AIVYPILTRSFGRGNMLQGKKVMNASIKSVLFLTVPATIGMIILARPLIEIAFVHGKFTV 347

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           +D I  +S L  YS  ++   L+ VL   +Y+ ND KTP     L++++   + + +   
Sbjct: 348 EDGISATSTLRFYSLSLISISLTNVLNRIYYSLNDTKTPFVIGALNVIINVGLNLLVAHH 407

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFIVFFK 180
            G  G+A A VS      + +   LL+++  +L  ++ I  I+   ++S  MG+  + + 
Sbjct: 408 YGTDGLA-ASVSIATTAAVFIGFYLLRKKIGNLGTKSYIKAIIKTVMASVAMGLVALTYF 466

Query: 181 P 181
           P
Sbjct: 467 P 467


>gi|313902663|ref|ZP_07836062.1| integral membrane protein MviN [Thermaerobacter subterraneus DSM
           13965]
 gi|313467101|gb|EFR62616.1| integral membrane protein MviN [Thermaerobacter subterraneus DSM
           13965]
          Length = 597

 Score = 63.2 bits (152), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 88/186 (47%), Gaps = 6/186 (3%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+L++ I    +Q      NR +  ++F   P +A L++L  E+ + ++ERGAF   DT 
Sbjct: 287 PELATRIARGERQGFGSALNRGLRVLIFVLAPVSAGLILLRIEVTRLVFERGAFDFHDTQ 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG--LFPFIG 123
           L +  L  Y   + G+    +L    Y+  D  TPA     ++ MG  IA+   L  F+ 
Sbjct: 347 LTAFALLFYMLGLAGYAWRELLSRAMYSMGDTWTPAS--TAAVAMGLNIALNLVLVRFLA 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVFFKPC 182
             GIA A    +W   + L V  ++RR   + ++ + +  L    ++ +M + +   +  
Sbjct: 405 QGGIALAASVAMWWGALVLMVR-IRRRMGQISYRAVGKGALQALAATAVMALAVELARRL 463

Query: 183 LFNQLS 188
           +F  L+
Sbjct: 464 IFGDLA 469


>gi|238799210|ref|ZP_04642659.1| Virulence factor mviN [Yersinia mollaretii ATCC 43969]
 gi|238716939|gb|EEQ08806.1| Virulence factor mviN [Yersinia mollaretii ATCC 43969]
          Length = 511

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIVTLIL 393


>gi|294339517|emb|CAZ87876.1| putative virulence factor MviN family [Thiomonas sp. 3As]
          Length = 512

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 63/127 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   ++  + S L +  +   L   +P    LL+  + ++  LY  G F   D
Sbjct: 289 LLPSLSRASATQDVAKYSTLLDWGLRLTLVLALPSAIALLIFAQPLVSMLYNYGRFDHAD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +  +S L  Y   ++  +  ++L   FYAR D++TP K  ++ +V   ++ +   P++G
Sbjct: 349 VLATTSALRAYGIGLIALIGVKILAPGFYARQDLRTPVKIALVVLVCTQLMNLLFVPWLG 408

Query: 124 GYGIATA 130
             G+A A
Sbjct: 409 HAGLALA 415


>gi|320173521|gb|EFW48717.1| putative peptidoglycan lipid II flippase MurJ [Shigella dysenteriae
           CDC 74-1112]
          Length = 511

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N  + + L +  +       +P    L +L   +  +L++ G FTA D
Sbjct: 287 LLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FY+R D+KTP K  I+++++
Sbjct: 347 ALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLML 393


>gi|88608527|ref|YP_506443.1| MviN family membrane protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600696|gb|ABD46164.1| membrane protein, MviN family [Neorickettsia sennetsu str.
           Miyayama]
          Length = 503

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 3/170 (1%)

Query: 9   SSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGA-FTAQDTILV 67
           SS +   N ++  + +N+A++ V+   IP T +L+ +P+ I  +L+  G  F  Q     
Sbjct: 285 SSIMFTHNAEELKKTQNKALKKVITACIPVTIMLIFMPEHITASLFLLGGKFDIQSVKHT 344

Query: 68  SSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGI 127
           +  L I +  +    L +  L  F A + +K P  F + S+V+  + +I L P     GI
Sbjct: 345 THMLEILAFALPAHALKKGFLQPFLAFDKLKAPVSFTVASVVLNAITSIILVPHYSYTGI 404

Query: 128 ATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS-IFISSGLMGMFI 176
           A A  +  W++T+ L +  LKRR++      I R+LS +F  + +   FI
Sbjct: 405 AIALCAAAWLDTL-LIIVYLKRRKMFSSDGKIPRLLSTVFFPASITIFFI 453


>gi|58040304|ref|YP_192268.1| virulence factor MviN [Gluconobacter oxydans 621H]
 gi|58002718|gb|AAW61612.1| Virulence factor MviN [Gluconobacter oxydans 621H]
          Length = 518

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 70/147 (47%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP L+  I   ++       NRAI+Y L   +P    +++L   I+  L+  G FT  
Sbjct: 282 ALLPLLTRHIANNDRAAVHSSLNRAIDYTLLLTLPAMIGMIVLASPIMAALFGYGHFTVS 341

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D IL    L  Y+  +  F+L +VL   F+A  D  TP +    ++ +  V+ + L+  +
Sbjct: 342 DAILSGQCLQAYALGLPAFVLIKVLSPAFFAEGDTVTPVRIGFFTLALNLVLNLLLYRPL 401

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
           G  G   A     +VN   LAV L +R
Sbjct: 402 GHIGPPLASTIAAFVNCTLLAVILHRR 428


>gi|238792567|ref|ZP_04636200.1| Virulence factor mviN [Yersinia intermedia ATCC 29909]
 gi|238728202|gb|EEQ19723.1| Virulence factor mviN [Yersinia intermedia ATCC 29909]
          Length = 511

 Score = 62.8 bits (151), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + S L +  +       +P    L +L K ++ +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHDEYSRLMDWGLRLCFLLALPSAVALGILAKPLVVSLFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSIGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLIL 393


>gi|119774059|ref|YP_926799.1| integral membrane protein MviN [Shewanella amazonensis SB2B]
 gi|119766559|gb|ABL99129.1| integral membrane protein MviN [Shewanella amazonensis SB2B]
          Length = 521

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +     ++  +  +  +L  G+P    L++L K ++  L+ RGAF   D
Sbjct: 296 VLPALSKKHVNDEGDGFAKTMDWGVRAILLLGMPAMVGLIVLAKPMLMVLFMRGAFDISD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
             + S  L  Y   ++ F+L +VL   +Y+R D KTP ++ I+++V   V  I
Sbjct: 356 VEMASYSLMAYGAGLLNFMLIKVLAPGYYSRQDTKTPVRYGIVAMVSNMVFNI 408


>gi|330432292|gb|AEC17351.1| MviN-like protein [Gallibacterium anatis UMN179]
          Length = 531

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 88/184 (47%), Gaps = 9/184 (4%)

Query: 4   LLPKLS-SAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           +LP LS   +  +N Q     R   +  +  +L  G+P    + +L + ++  L+ RG F
Sbjct: 306 ILPTLSRHHVNKDNMQSEQAFRQTLDWGVRMILLLGVPAMVGIALLAQPMLLVLFMRGNF 365

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIG 117
              D    S  L  ++  ++ ++L ++L + +YAR D KTP ++ I++++  MGF +   
Sbjct: 366 LLSDVQAASYSLWAFNAGLLSYMLIKILANGYYARQDTKTPVRYGIIAMISNMGFNLLAI 425

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
            F ++   G+A A      +N   L   L  ++      +++Y  L + I++  MG  + 
Sbjct: 426 PFSYV---GLAMASAMSATLNAFLLYRGLSHQQVYHFSARSLYFFLKVVIAAVAMGALLF 482

Query: 178 FFKP 181
           +  P
Sbjct: 483 YLTP 486


>gi|91200996|emb|CAJ74053.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 539

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 60/116 (51%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P  S+    E+ +  S   N+A++++LF GIP +  ++ML + I+  LY+R  F A+
Sbjct: 309 AVFPFFSTYAAREDWENFSRTFNKALKFILFMGIPASIGIIMLREPIVSLLYKRNQFDAE 368

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
             +  S  +  Y+  I  +    VL+  FY+  D  TP K   L + +  V+ I L
Sbjct: 369 SALRTSRVILFYAIGIWAYCGLHVLIRAFYSLKDTVTPVKIGTLCVGLNLVLNISL 424


>gi|160903217|ref|YP_001568798.1| integral membrane protein MviN [Petrotoga mobilis SJ95]
 gi|160360861|gb|ABX32475.1| integral membrane protein MviN [Petrotoga mobilis SJ95]
          Length = 494

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 89/175 (50%), Gaps = 4/175 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLPKLS +  ++++++ ++    +IE  LFF IP    L+ L  EI+  +Y+ G+FT +
Sbjct: 278 ALLPKLSYSSSIKDEKEYNKNLKDSIELTLFFAIPSMFGLIFLNNEIVALIYQHGSFTFE 337

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT++ +  L  YS  +  + L  + +  ++++ + + P+   ++ + +  ++ + L    
Sbjct: 338 DTLITAKTLLYYSIGLPFYSLHTIFIRTYHSKLNTRYPSLVAVVMLSVNAILDVLLAFRY 397

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
           G  GIA A      +        ++K     L  +    I  IFI+S  M +FIV
Sbjct: 398 GVVGIAFATSISGIIGMFMTGFNIIK----GLTGEDWVEIFKIFIASAFMSIFIV 448


>gi|254562472|ref|YP_003069567.1| peptidoglycan lipid II flippase protein, MurJ [Methylobacterium
           extorquens DM4]
 gi|254269750|emb|CAX25722.1| putative peptidoglycan lipid II flippase protein, MurJ (MviN)-like
           protein [Methylobacterium extorquens DM4]
          Length = 527

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P T   L LP  I+  L++RGAFTA+D
Sbjct: 303 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFTIAFLTLPGLIMAALFQRGAFTAED 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   ++ R  ++ F AR D  TP    + +I +   + + L    G
Sbjct: 363 AARAASVLAAYGLALPAVVMVRSAVASFNARQDTTTPLYASLTAIAVNVALKLVLTGPYG 422

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 423 VAGLALATAIAQWIN-LALLYGLALRRGWTAP 453


>gi|254230238|ref|ZP_04923629.1| MviN protein [Vibrio sp. Ex25]
 gi|151937218|gb|EDN56085.1| MviN protein [Vibrio sp. Ex25]
          Length = 205

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 2/149 (1%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  +  V+  G+P    L++L K ++  L+ RG F+ QD    S  L  Y++ ++ F+L 
Sbjct: 2   DWGVRMVILLGLPAMLGLMVLAKPMLMVLFMRGEFSPQDVHQASLSLFAYASGLLNFMLI 61

Query: 85  RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY-GIATAEVSWVWVNTICLA 143
           +VL   +Y+R D KTP K+ I+++V   V    +F +  GY G+A A     +VN   L 
Sbjct: 62  KVLAPGYYSRQDTKTPVKYGIIAMVTNMVFN-AIFAYFYGYVGLAIATALSAFVNMALLY 120

Query: 144 VALLKRRQIDLPFQTIYRILSIFISSGLM 172
             L       +  +T++ I+ + I+   M
Sbjct: 121 RGLHIAGVYQITKRTVFFIIRLVIAGAAM 149


>gi|220925729|ref|YP_002501031.1| integral membrane protein MviN [Methylobacterium nodulans ORS 2060]
 gi|219950336|gb|ACL60728.1| integral membrane protein MviN [Methylobacterium nodulans ORS 2060]
          Length = 509

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 79/156 (50%), Gaps = 1/156 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   +NRA  + L    P     L++P  I+  L++RGAF A+ 
Sbjct: 285 LLPEMSRQLAAGDAAAAHAAQNRATGFSLALSAPFAVAFLLVPDLIMTALFQRGAFDAEA 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y   +   +L R +++ FYAR D +TP    + ++ +  V+ + L   +G
Sbjct: 345 AARSGAVLAAYGLALPAAVLIRSIVASFYARQDSRTPVVASLTAVALNVVLKVVLTGPLG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
             G+A A  + VWVN + L V + +RR    P + +
Sbjct: 405 VTGLALATAAGVWVNVLMLFV-IARRRGWTAPSRAL 439


>gi|188582737|ref|YP_001926182.1| integral hypothetical protein MviN [Methylobacterium populi BJ001]
 gi|179346235|gb|ACB81647.1| integral membrane protein MviN [Methylobacterium populi BJ001]
          Length = 509

 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P     L LP  I+  L++RGAFTA+D
Sbjct: 285 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFMVAFLTLPGLIMAALFQRGAFTAED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   +L R  ++ FYAR D  TP    + +I +   + + L    G
Sbjct: 345 AARAASVLAAYGLALPAVVLVRSGVASFYARQDTTTPLYASLTAIAVNVGLKLVLTGPYG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 405 VAGLALATAIGQWIN-LALLYGLALRRGWTAP 435


>gi|218531552|ref|YP_002422368.1| integral membrane protein MviN [Methylobacterium chloromethanicum
           CM4]
 gi|218523855|gb|ACK84440.1| integral membrane protein MviN [Methylobacterium chloromethanicum
           CM4]
          Length = 509

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P T   L LP  I+  L++RGAFTA+D
Sbjct: 285 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFTIAFLTLPGLIMAALFQRGAFTAED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   ++ R  ++ F AR D  TP    + +I +   + + L    G
Sbjct: 345 AARAASVLAAYGLALPAVVMVRSAVASFNARQDTTTPLYASLTAIAVNVALKLVLTGPYG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 405 VAGLALATAIAQWIN-LALLYGLALRRGWTAP 435


>gi|163852712|ref|YP_001640755.1| integral membrane protein MviN [Methylobacterium extorquens PA1]
 gi|163664317|gb|ABY31684.1| integral membrane protein MviN [Methylobacterium extorquens PA1]
          Length = 509

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P T   L LP  I+  L++RGAFTA+D
Sbjct: 285 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFTIAFLTLPGLIMAALFQRGAFTAED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   ++ R  ++ F AR D  TP    + +I +   + + L    G
Sbjct: 345 AARAASVLAAYGLALPAVVMVRSAVASFNARQDTTTPLYASLTAIAVNVALKLVLTGPYG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 405 VAGLALATAIAQWIN-LALLYGLALRRGWTAP 435


>gi|240140047|ref|YP_002964524.1| putative peptidoglycan lipid II flippase protein, MurJ (MviN)-like
           protein [Methylobacterium extorquens AM1]
 gi|240010021|gb|ACS41247.1| putative peptidoglycan lipid II flippase protein, MurJ (MviN)-like
           protein [Methylobacterium extorquens AM1]
          Length = 509

 Score = 62.4 bits (150), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 71/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P T   L LP  I+  L++RGAFTA+D
Sbjct: 285 LLPEMSRRIAAGDVAGAHAAQNRAAGFSLALSAPFTIAFLTLPGLIMAALFQRGAFTAED 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   ++ R  ++ F AR D  TP    + +I +   + + L    G
Sbjct: 345 AARAASVLAAYGLALPAVVMVRSAVASFNARQDTTTPLYASLTAIAVNVALKLVLTGPYG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 405 VAGLALATAIAQWIN-LALLYGLALRRGWTAP 435


>gi|182415628|ref|YP_001820694.1| integral membrane protein MviN [Opitutus terrae PB90-1]
 gi|177842842|gb|ACB77094.1| integral membrane protein MviN [Opitutus terrae PB90-1]
          Length = 519

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 81/173 (46%), Gaps = 1/173 (0%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P ++      N    ++   + +  +L   +P  A L +L + I++ +Y+ G FTA DT 
Sbjct: 288 PLIARHATERNFAGMADDYRKGLRLILMINVPAAAGLALLSEPIVRLIYQHGEFTATDTR 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
            +   L+++S  +  F +S +    FYA  D  TP K   LS V+   ++  L  ++G  
Sbjct: 348 AMGPLLALFSVGMPFFSISSLTTRAFYALKDTVTPVKIGALSFVINVGLSWALKDWLGAP 407

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
           G+  A  + V V TI +   LL R    L F  ++R +   +++      +VF
Sbjct: 408 GLVLASTAAVIVQTIVMQ-RLLARAVPGLGFGELWRTIGKIVAATAAMSLVVF 459


>gi|15603525|ref|NP_246599.1| hypothetical protein PM1660 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722066|gb|AAK03744.1| MviN [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 510

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 9/208 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
            + Q + + R+     I  +L  G+P    + +L + ++  L+ RG F   D    S  L
Sbjct: 296 HSSQSAIDFRHTLDWGIRMILLLGVPAMVGIAILAQPLLLVLFMRGNFGLNDVQAASLSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIGGYGIAT 129
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++   G+A 
Sbjct: 356 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYV---GLAM 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSA 189
           A      +N   L   L+K        Q+      + +S+ +MG  + +  P L  +  A
Sbjct: 413 ASAMSATLNAYLLYRGLVKEEVYHFSRQSAVFFGKVLLSASVMGGLVWYNTPTLL-EWHA 471

Query: 190 ETAFSPFKNLAIILSGAVLVYLCSISLL 217
            T  +    L  ++  AV++Y   ++L+
Sbjct: 472 MTFLTRLHWLIWLIGFAVVIYFSMLALV 499


>gi|225158975|ref|ZP_03725286.1| integral membrane protein MviN [Opitutaceae bacterium TAV2]
 gi|224802416|gb|EEG20677.1| integral membrane protein MviN [Opitutaceae bacterium TAV2]
          Length = 567

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 75/153 (49%), Gaps = 2/153 (1%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
            + +  +L   +P  A ++ L + I++ L++RGAFTA D+ L++  L+  +  +  F  +
Sbjct: 344 RKGMRLILLINLPAAAGMMALAEPIVRLLFQRGAFTASDSALMTPVLAASALGLPFFSFT 403

Query: 85  RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAV 144
            + L  FYAR D KTP +  + S V+    ++ L       G+A A    + V  + L  
Sbjct: 404 NLALRAFYARKDTKTPVRAALWSFVVNVAASLVLMRLFSTVGLALAGSLAIVVQAVYLQT 463

Query: 145 ALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFI 176
             L R    L F+ + R +L I  +S  MG  +
Sbjct: 464 H-LARSNAALAFRHLLRDVLRITAASAAMGAVV 495


>gi|187929901|ref|YP_001900388.1| integral membrane protein MviN [Ralstonia pickettii 12J]
 gi|187726791|gb|ACD27956.1| integral membrane protein MviN [Ralstonia pickettii 12J]
          Length = 530

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    N+++ S L +  +   +   +P    L +    +  TL+  G FT  D
Sbjct: 305 LLPSLSKASAENNREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGKFTGVD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L+ Y   ++G ++ ++L   FYAR D++TP K  ++ +V   +      P  G
Sbjct: 365 VEMTRQALTSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLVATQLSNYVFVPIFG 424

Query: 124 GYGIA 128
             G+A
Sbjct: 425 HAGLA 429


>gi|253989981|ref|YP_003041337.1| virulence factor mvin-like protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639038|emb|CAR67651.1| virulence factor mvin homolog [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781431|emb|CAQ84594.1| virulence factor mvin homolog [Photorhabdus asymbiotica]
          Length = 511

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N ++ + L +  +       +PC   L +L + +  +L++ G FTA D
Sbjct: 287 LLPSLAKSFSSGNHEEYTRLMDWGLRLCFLLALPCAVALGILAEPLTVSLFQYGNFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  Y   ++G ++ +VL   FY+R D+KTP K  I ++++
Sbjct: 347 AEMTQKALIAYCFGLMGIIIVKVLAPGFYSRQDIKTPVKIAIATLIL 393


>gi|120553792|ref|YP_958143.1| integral membrane protein MviN [Marinobacter aquaeolei VT8]
 gi|120323641|gb|ABM17956.1| integral membrane protein MviN [Marinobacter aquaeolei VT8]
          Length = 495

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 70/146 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +  Q +   + A+  VL  G+P    L +L + +I TL+  G  T +D
Sbjct: 273 ILPSLSRKHAAASADQFAATLDWAVRAVLLIGVPAALALALLAEPLIATLFHYGEVTDRD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  ++ F+L +VL   F+AR D +TP K  ++++V   V  + L   + 
Sbjct: 333 VAMSAQSLRAYSAGLLAFMLIKVLAPGFFAREDTRTPVKIGVIAMVANMVFNLALIVPLA 392

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A     W+N   L   L K 
Sbjct: 393 HAGLALATSLSAWLNGYLLWRGLRKE 418


>gi|307257630|ref|ZP_07539389.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306863805|gb|EFM95729.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 499

 Score = 62.4 bits (150), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 272 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 327

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 328 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 387

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 388 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISTCLMG 446

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 447 ASVAYFSP 454


>gi|88707063|ref|ZP_01104759.1| Virulence factor mviN-like protein [Congregibacter litoralis KT71]
 gi|88698713|gb|EAQ95836.1| Virulence factor mviN-like protein [Congregibacter litoralis KT71]
          Length = 540

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 6/133 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           ++P LS+      +   +   + A+  VL  G+P +  LL+L + I+ +L+  GA + +D
Sbjct: 297 IMPTLSAQKSAAREDDYARTLDWAVRSVLLVGVPASLALLILAEPILISLFHYGALSERD 356

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG------FVIAIG 117
             + +  L  YS  +  F+L +VL   FYAR D+ TP +  I ++V        FV+ + 
Sbjct: 357 IAMSALSLRAYSLGLCAFMLIKVLAPGFYARQDMVTPVRIGIRAMVANMVMNLVFVVPLM 416

Query: 118 LFPFIGGYGIATA 130
            +  IG  G+A A
Sbjct: 417 FYCGIGHVGLALA 429


>gi|53729214|ref|ZP_00133738.2| COG0728: Uncharacterized membrane protein, putative virulence
           factor [Actinobacillus pleuropneumoniae serovar 1 str.
           4074]
 gi|307246478|ref|ZP_07528550.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248603|ref|ZP_07530617.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306852541|gb|EFM84774.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854814|gb|EFM87003.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 514

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 287 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 342

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 343 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 402

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 403 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 461

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 462 ASVAYFSP 469


>gi|307250836|ref|ZP_07532764.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253215|ref|ZP_07535090.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255461|ref|ZP_07537267.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259913|ref|ZP_07541626.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306857086|gb|EFM89214.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859303|gb|EFM91341.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861503|gb|EFM93491.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865941|gb|EFM97816.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 499

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 272 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 327

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 328 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 387

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 388 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 446

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 447 ASVAYFSP 454


>gi|307264241|ref|ZP_07545831.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|306870412|gb|EFN02166.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 499

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 272 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 327

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 328 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 387

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 388 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 446

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 447 ASVAYFSP 454


>gi|307262043|ref|ZP_07543697.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306868222|gb|EFN00045.1| Integral membrane protein MviN [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 499

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 272 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 327

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 328 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 387

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 388 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 446

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 447 ASVAYFSP 454


>gi|303249605|ref|ZP_07335811.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252919|ref|ZP_07339076.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302648227|gb|EFL78426.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302651538|gb|EFL81688.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
          Length = 523

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 296 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 351

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 352 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 411

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 412 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 470

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 471 ASVAYFSP 478


>gi|296127545|ref|YP_003634797.1| integral membrane protein MviN [Brachyspira murdochii DSM 12563]
 gi|296019361|gb|ADG72598.1| integral membrane protein MviN [Brachyspira murdochii DSM 12563]
          Length = 537

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 54/97 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS  I    K ++ E  + ++  V    IP T   ++L KEI++ ++E GAF+++ 
Sbjct: 300 MLPTLSKLITDNKKDEAVETLSYSLRLVALVTIPATFGFIVLGKEIVRMIFEYGAFSSKS 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           T LVSS L   S  +      R+L+  FYA  D+KTP
Sbjct: 360 TYLVSSALRYLSVSLFFVASYRILVQSFYAMKDMKTP 396


>gi|190150888|ref|YP_001969413.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|189916019|gb|ACE62271.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
          Length = 523

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 296 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 351

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 352 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 411

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 412 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 470

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 471 ASVAYFSP 478


>gi|126209021|ref|YP_001054246.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae L20]
 gi|165976988|ref|YP_001652581.1| MviN virulence factor [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|126097813|gb|ABN74641.1| virulence factor-like MviN [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165877089|gb|ABY70137.1| MviN virulence factor [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
          Length = 509

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY----------VLFFGIPCTAILLMLPKEIIQTL 53
           +LP LS   ++  K++  E++ RA+E+          VL  GIP    + +L + ++ T+
Sbjct: 282 VLPSLS---RIAKKKEIDEVQ-RAVEFQGTMDWGVRMVLLLGIPAMIGIAVLAQPLMMTI 337

Query: 54  YERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + RG F   D I  S  L I    +  ++L  +L + FYAR + KTP K  +++ V    
Sbjct: 338 FMRGKFGLSDVIATSHALWIMCLGLNSYMLINILANGFYARQNTKTPVKIGMIATVCNIC 397

Query: 114 IAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMG 173
             +   PF G  G+A A      VN   L   L +     +  +T   +L + IS+ LMG
Sbjct: 398 FGVLAIPF-GYLGLAMASALSAAVNASLLYRGLAQSGVYKVTAKTGIFVLKVAISACLMG 456

Query: 174 MFIVFFKP 181
             + +F P
Sbjct: 457 ASVAYFSP 464


>gi|295293763|gb|ADF88290.1| putative integral membrane protein MviN [Aphanizomenon sp. 10E6]
          Length = 399

 Score = 62.0 bits (149), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 104/211 (49%), Gaps = 15/211 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L +  +L +     EL+ R  + +L   +   P  A+++ L   I+Q +Y+RGAF 
Sbjct: 161 LLPLLPTFAKLSHPDNWEELKLRIRQGLLLTAVTMLPLGALMVSLSVPIVQIVYQRGAFK 220

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + T LVSS L  Y   +  +L   VL+  FYA  D +TP K  I +IV+  V+ + L  
Sbjct: 221 QEATQLVSSLLIAYGIGMFVYLGRDVLVRVFYALGDGQTPFKISIFNIVLNAVLDLILVE 280

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ---------TIYRILSIFISSG- 170
             G  G+  A V  V  +++ + + LL R+   LP+Q         T+  I++   S G 
Sbjct: 281 PFGAPGLVLATVG-VNCSSMLMLLFLLNRKLNGLPWQEWCLPILGLTVGSIIAGLASFGT 339

Query: 171 LMGMFIVFFKPCLFNQLSAETAFSPFKNLAI 201
           L+    +  KP LF +L  E A S F  + +
Sbjct: 340 LVASQQILGKPDLF-RLLIELAISAFVGIGV 369


>gi|217034712|ref|ZP_03440114.1| hypothetical protein HP9810_896g9 [Helicobacter pylori 98-10]
 gi|216942825|gb|EEC22322.1| hypothetical protein HP9810_896g9 [Helicobacter pylori 98-10]
          Length = 486

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNHQQDLILQRLQKAWFFLVGVLLLCSTGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G V ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLVASLSLMP 412


>gi|298490837|ref|YP_003721014.1| integral membrane protein MviN ['Nostoc azollae' 0708]
 gi|298232755|gb|ADI63891.1| integral membrane protein MviN ['Nostoc azollae' 0708]
          Length = 540

 Score = 62.0 bits (149), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 81/157 (51%), Gaps = 4/157 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L   +   +L+ R  + +L   +   P  A+++ L + I+Q +Y+RGAF 
Sbjct: 305 LLPLLPIFAKLAEPENWPDLKLRIRQGLLLTAVTMLPLGALMIALSEPIVQLIYQRGAFK 364

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + T LVSS L  Y   +  +L+  VL+  FYA  D +TP +    +I++   +   L  
Sbjct: 365 QEATELVSSLLIAYGIGMFVYLVRDVLVRVFYALGDGQTPFRISTFNILLNAGLDFILVK 424

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
             G  G+  A VS V  ++I + + LL R+   LPF+
Sbjct: 425 PFGAPGLVLATVS-VNCSSILMLLWLLNRKLNGLPFR 460


>gi|153217673|ref|ZP_01951354.1| integral membrane protein MviN [Vibrio cholerae 1587]
 gi|124113381|gb|EAY32201.1| integral membrane protein MviN [Vibrio cholerae 1587]
          Length = 405

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    +   +  I  V F GIP    L++L K ++  L+ RG FT  D
Sbjct: 296 ILPALSRKHVDAHSDGFAHTMDWGIRMVTFLGIPAMLGLMVLAKPMLMVLFMRGEFTPSD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKF 103
               S  L  YS+ ++ F+L +VL   +Y+R D KTP ++
Sbjct: 356 VEQASYSLLAYSSGLLSFMLIKVLAPGYYSRQDTKTPVRY 395


>gi|169832227|ref|YP_001718209.1| integral membrane protein MviN [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169639071|gb|ACA60577.1| integral membrane protein MviN [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 526

 Score = 61.6 bits (148), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 87/176 (49%), Gaps = 3/176 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L++      + +  E   RA+  V+   +P    L++L + ++Q L+ERGAF  +
Sbjct: 284 AVFPTLTTWAAEGKRSEVLETLARALRIVVLTTVPAGVGLIVLRQPVVQLLFERGAFDER 343

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + +  L  YS  +VG   + +L   FYA  D +TP K   +++ +  V+++ L   +
Sbjct: 344 ATAMTAVALLFYSVGLVGLAANILLTRGFYAFQDTRTPVKLLAVNVTVNLVLSLALMGPL 403

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDL--PFQTIYRILSIFISSGLMGMFI 176
              G+A A      VNT+ L V  L+R    L  P   +     + ++SGLM + +
Sbjct: 404 QHGGLALASSLAALVNTVLL-VRYLERLLPGLWQPAAWLRFGGGVLVASGLMALAV 458


>gi|90412464|ref|ZP_01220467.1| virulence factor MviN [Photobacterium profundum 3TCK]
 gi|90326501|gb|EAS42907.1| virulence factor MviN [Photobacterium profundum 3TCK]
          Length = 519

 Score = 61.6 bits (148), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +  +Q +E  +  +  VL  GIP    +L+L K ++  L+ RG F+  D
Sbjct: 296 ILPALSRKHADQQGKQFAETMDWGVRMVLLLGIPAMLGMLVLAKPMLMVLFMRGEFSLYD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
               +  L   S  ++ F+L ++    +YAR D KTP ++ I+++V
Sbjct: 356 VNQSAMSLWALSAGLLNFMLIKIFAPGYYARQDTKTPVRYGIIAMV 401


>gi|330811822|ref|YP_004356284.1| Putative virulence factor, MviN-like protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379930|gb|AEA71280.1| Putative virulence factor, MviN-like protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 512

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 59/107 (55%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++Q+ S + +  +       +PC+  L +L + +  +L++ G F A D
Sbjct: 287 LLPTLAKTYASQDRQEYSRILDWGLRLCFVLVLPCSLALGILAEPLTVSLFQYGQFNAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FYA+ +++TP K  I ++VM
Sbjct: 347 ALMTQRALIAYSVGLLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLVM 393


>gi|46204336|ref|ZP_00050133.2| COG0728: Uncharacterized membrane protein, putative virulence
           factor [Magnetospirillum magnetotacticum MS-1]
          Length = 401

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 70/152 (46%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   +NRA  + L    P     L LP  I+  L++RGAFTA+D
Sbjct: 192 LLPEMSRRIASGDVAGAHAAQNRAAGFSLALSAPFMVAFLTLPGPIVAALFQRGAFTAED 251

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +S L+ Y   +   +L R  ++ F AR D  TP    + +I +   + + L    G
Sbjct: 252 AARAASVLAAYGLALPAVVLVRSAVASFNARQDTTTPLYASLTAIAVNVGLKLVLTGPYG 311

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     W+N + L   L  RR    P
Sbjct: 312 VAGLALATAIGQWIN-LALLYGLALRRGWTAP 342


>gi|330961577|gb|EGH61837.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 512

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|330966383|gb|EGH66643.1| membrane protein, MviN family [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 512

 Score = 61.6 bits (148), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGQFNALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|307824930|ref|ZP_07655152.1| integral membrane protein MviN [Methylobacter tundripaludum SV96]
 gi|307733977|gb|EFO04832.1| integral membrane protein MviN [Methylobacter tundripaludum SV96]
          Length = 512

 Score = 61.2 bits (147), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 80/156 (51%), Gaps = 8/156 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+ +   E+    S   +  +  V+  G+P T  L++L + ++ TL++   F   D
Sbjct: 289 ILPNLAKSHAAEDTAAFSNALDWGLRLVVLVGLPATIGLVLLAEPMLSTLFQYNEFGVSD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKF--YILSIVMGFVIAIGLFPF 121
                  L  YS  ++GF+L +VL+  F +R D+KTP ++  Y + + +G  +A+ +FP 
Sbjct: 349 VHFAGLSLKAYSLGLLGFILIKVLVPGFTSRGDMKTPVRYGVYAMIVSLGLNLAL-VFP- 406

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
           +   G+A A     + N    AV LL++   D  +Q
Sbjct: 407 LAHAGLALATSLGAFFN----AVLLLRKLHKDKVYQ 438


>gi|126173296|ref|YP_001049445.1| integral membrane protein MviN [Shewanella baltica OS155]
 gi|152999653|ref|YP_001365334.1| integral membrane protein MviN [Shewanella baltica OS185]
 gi|217974393|ref|YP_002359144.1| integral membrane protein MviN [Shewanella baltica OS223]
 gi|125996501|gb|ABN60576.1| integral membrane protein MviN [Shewanella baltica OS155]
 gi|151364271|gb|ABS07271.1| integral membrane protein MviN [Shewanella baltica OS185]
 gi|217499528|gb|ACK47721.1| integral membrane protein MviN [Shewanella baltica OS223]
          Length = 519

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 2/90 (2%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  ++ +L  G+P    L++L K ++  L+ RGAF+  D  + S  L  Y + ++ F+L 
Sbjct: 317 DWGVKAILLLGLPAMMGLIILAKPMLMVLFMRGAFSMHDVEMASYSLMAYGSGLLSFMLI 376

Query: 85  RVLLSEFYARNDVKTPAKFYILSIV--MGF 112
           +VL   +Y+R D KTP ++ I++++  MGF
Sbjct: 377 KVLAPGYYSRQDTKTPVRYGIIAMITNMGF 406


>gi|296108280|ref|YP_003619981.1| integral membrane protein (putative virulence factor) MviN,
           possible role in motility [Legionella pneumophila
           2300/99 Alcoy]
 gi|295650182|gb|ADG26029.1| integral membrane protein (putative virulence factor) MviN,
           possible role in motility [Legionella pneumophila
           2300/99 Alcoy]
          Length = 517

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 97/217 (44%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 292 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 351

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 352 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFVFVWHLA 411

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN + L   L+KRR        +   + + I++  +G+++ F     
Sbjct: 412 HAGLTLASALAGYVNCVILLFLLIKRRLFKPSPGWLKYSMQLLIANFTIGVYLYFMS--- 468

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 469 -GTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 504


>gi|330977516|gb|EGH77462.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 414

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 189 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 248

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 249 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 295


>gi|33600988|ref|NP_888548.1| integral membrane protein [Bordetella bronchiseptica RB50]
 gi|33575423|emb|CAE32500.1| conserved integral membrane protein [Bordetella bronchiseptica
           RB50]
          Length = 530

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 74/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A    ++   S L +  +  VL  G+P    L +L   ++ TL+  GAF AQD
Sbjct: 304 LLPSLSAAHARADQDGYSGLLDWGLRLVLMLGLPAALGLALLSDGLVATLFHYGAFQAQD 363

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  +  YS  ++G L  ++L   FYA+ D++TP K  I+ +V+  ++   L P++ 
Sbjct: 364 VQQTRLAVIAYSAGLIGLLAIKILAPGFYAKQDIRTPVKIAIMVLVLTQLLNAILVPWLA 423

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L   L +R
Sbjct: 424 HAGLALAIGLGACINALALLTGLRRR 449


>gi|257487504|ref|ZP_05641545.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331008749|gb|EGH88805.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 498

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 273 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 333 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 379


>gi|160874274|ref|YP_001553590.1| integral membrane protein MviN [Shewanella baltica OS195]
 gi|160859796|gb|ABX48330.1| integral membrane protein MviN [Shewanella baltica OS195]
 gi|315266507|gb|ADT93360.1| integral membrane protein MviN [Shewanella baltica OS678]
          Length = 519

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 2/90 (2%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  ++ +L  G+P    L++L K ++  L+ RGAF+  D  + S  L  Y + ++ F+L 
Sbjct: 317 DWGVKAILLLGLPAMMGLIVLAKPMLMVLFMRGAFSMHDVEMASYSLMAYGSGLLSFMLI 376

Query: 85  RVLLSEFYARNDVKTPAKFYILSIV--MGF 112
           +VL   +Y+R D KTP ++ I++++  MGF
Sbjct: 377 KVLAPGYYSRQDTKTPVRYGIIAMITNMGF 406


>gi|330878962|gb|EGH13111.1| membrane protein, MviN family [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGQFNALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|304412574|ref|ZP_07394179.1| integral membrane protein MviN [Shewanella baltica OS183]
 gi|307303590|ref|ZP_07583343.1| integral membrane protein MviN [Shewanella baltica BA175]
 gi|304349050|gb|EFM13463.1| integral membrane protein MviN [Shewanella baltica OS183]
 gi|306912488|gb|EFN42911.1| integral membrane protein MviN [Shewanella baltica BA175]
          Length = 505

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 2/90 (2%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  ++ +L  G+P    L++L K ++  L+ RGAF+  D  + S  L  Y + ++ F+L 
Sbjct: 303 DWGVKAILLLGLPAMMGLIILAKPMLMVLFMRGAFSMHDVEMASYSLMAYGSGLLSFMLI 362

Query: 85  RVLLSEFYARNDVKTPAKFYILSIV--MGF 112
           +VL   +Y+R D KTP ++ I++++  MGF
Sbjct: 363 KVLAPGYYSRQDTKTPVRYGIIAMITNMGF 392


>gi|309781397|ref|ZP_07676133.1| integral membrane protein MviN [Ralstonia sp. 5_7_47FAA]
 gi|308919810|gb|EFP65471.1| integral membrane protein MviN [Ralstonia sp. 5_7_47FAA]
          Length = 530

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    N+++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 305 LLPSLSKASADNNREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGKFNGMD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L+ Y   ++G ++ ++L   FYAR D++TP K  ++ +V   +      P  G
Sbjct: 365 VEMTRQALTSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLVATQLSNYVFVPIFG 424

Query: 124 GYGIA 128
             G+A
Sbjct: 425 HAGLA 429


>gi|301384212|ref|ZP_07232630.1| membrane protein, MviN family [Pseudomonas syringae pv. tomato
           Max13]
 gi|302060864|ref|ZP_07252405.1| membrane protein, MviN family [Pseudomonas syringae pv. tomato K40]
 gi|302132871|ref|ZP_07258861.1| membrane protein, MviN family [Pseudomonas syringae pv. tomato
           NCPPB 1108]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGQFNALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|28868032|ref|NP_790651.1| membrane protein, MviN family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851268|gb|AAO54346.1| membrane protein, MviN family [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331018366|gb|EGH98422.1| membrane protein, MviN family [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGQFNALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|289625175|ref|ZP_06458129.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|330869171|gb|EGH03880.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|71736340|ref|YP_273011.1| integral membrane protein MviN [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556893|gb|AAZ36104.1| integral membrane protein MviN [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|330988785|gb|EGH86888.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|288818132|ref|YP_003432480.1| virulence factor MviN homolog [Hydrogenobacter thermophilus TK-6]
 gi|288787532|dbj|BAI69279.1| virulence factor MviN homolog [Hydrogenobacter thermophilus TK-6]
 gi|308751733|gb|ADO45216.1| integral membrane protein MviN [Hydrogenobacter thermophilus TK-6]
          Length = 499

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 16  NKQQSSELRNR-AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIY 74
           ++ + +++  R A  +VL   IP +  L++L + II  LY RG F+  D  + SS L  Y
Sbjct: 285 SRGEDAKVNTRLAFRFVLLVSIPASIGLIVLSEHIIALLYGRGRFSESDVYVASSVLGAY 344

Query: 75  STEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           +  +  F L +VL S F+A+ D KTP K  ++++V
Sbjct: 345 ALGLTFFSLQKVLSSVFFAKGDTKTPVKASLIAVV 379


>gi|298485390|ref|ZP_07003480.1| Virulence factor mviN [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298160088|gb|EFI01119.1| Virulence factor mviN [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|213971065|ref|ZP_03399185.1| MVIN-like protein [Pseudomonas syringae pv. tomato T1]
 gi|213924173|gb|EEB57748.1| MVIN-like protein [Pseudomonas syringae pv. tomato T1]
          Length = 528

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 303 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGQFNALD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 363 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 409


>gi|330891594|gb|EGH24255.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|320330652|gb|EFW86629.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330881363|gb|EGH15512.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|312876147|ref|ZP_07736135.1| integral membrane protein MviN [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311797133|gb|EFR13474.1| integral membrane protein MviN [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 518

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 104/233 (44%), Gaps = 26/233 (11%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     A+  ++   +P     ++L KEI + +Y+RG FT + T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSAVNSIILMMMPFAIGGIILSKEITRLIYQRGNFTIESTL 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  Y    VG  L  +L    Y   D KT  K  +++IV   ++ I         
Sbjct: 351 LTASPLMFYCLGFVGLGLRDMLNRTLYVLKDSKTAVKNGVIAIVCNIILDIIFIRKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKP 181
           G A A  S  ++  + L ++L K+    L      RI S+F    ++S +MG+F+  FK 
Sbjct: 411 GAAMAFASANYIAAVLLFISLRKK----LGSIGWKRIASVFVKALVASLVMGVFVYAFKQ 466

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
             F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 467 K-FIHLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|54298624|ref|YP_124993.1| hypothetical protein lpp2688 [Legionella pneumophila str. Paris]
 gi|53752409|emb|CAH13841.1| hypothetical protein lpp2688 [Legionella pneumophila str. Paris]
          Length = 523

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 97/217 (44%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 298 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 358 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFVFVWHLA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN + L   L+KRR        +   + + I++  +G+++ F     
Sbjct: 418 HAGLTLASALAGYVNCVILLFLLIKRRLFKPSPGWLKYSMQLLIANFTIGVYLYFMS--- 474

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 475 -GTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 510


>gi|217032935|ref|ZP_03438410.1| hypothetical protein HPB128_147g8 [Helicobacter pylori B128]
 gi|216945345|gb|EEC24017.1| hypothetical protein HPB128_147g8 [Helicobacter pylori B128]
          Length = 213

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAF 59
           +AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F
Sbjct: 21  SALFP--SIAIALKNNQQDLVLQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQF 78

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           + +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L 
Sbjct: 79  SPKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLM 138

Query: 120 P 120
           P
Sbjct: 139 P 139


>gi|33593731|ref|NP_881375.1| integral membrane protein [Bordetella pertussis Tohama I]
 gi|33563804|emb|CAE43046.1| conserved integral membrane protein [Bordetella pertussis Tohama I]
          Length = 533

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 74/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A    ++   S L +  +  VL  G+P    L +L   ++ TL+  GAF AQD
Sbjct: 304 LLPSLSAAHARADQDGYSGLLDWGLRLVLMLGLPAALGLALLSDGLVATLFHYGAFQAQD 363

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  +  YS  ++G L  ++L   FYA+ D++TP K  I+ +V+  ++   L P++ 
Sbjct: 364 VQQTRLAVIAYSAGLIGLLAIKILAPGFYAKQDIRTPVKIAIMVLVLTQLLNAILVPWLA 423

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L   L +R
Sbjct: 424 HAGLALAIGLGACINALALLTGLRRR 449


>gi|289651359|ref|ZP_06482702.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPMTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|319760580|ref|YP_004124518.1| integral membrane protein MviN [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039294|gb|ADV33844.1| integral membrane protein MviN [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 520

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
             LLP LS  I + +  +   L N  ++       P   IL +L K +I TL++ G F+ 
Sbjct: 286 TVLLPCLSRFIAIGSSVEYFNLINWGLKLCCVLSFPSAVILGVLSKPLIITLFQYGKFSG 345

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            D ++    +  YS  + G +L++VL + FY+R+D++TP +  I+++V
Sbjct: 346 FDVLMTQYSVIAYSIGLPGLILTKVLTAGFYSRHDIQTPIRMIIITVV 393


>gi|298736163|ref|YP_003728689.1| integral membrane protein MviN [Helicobacter pylori B8]
 gi|298355353|emb|CBI66225.1| integral membrane protein MviN [Helicobacter pylori B8]
          Length = 486

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAF 59
           +AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F
Sbjct: 294 SALFP--SIAIALKNNQQDLVLQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQF 351

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           + +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L 
Sbjct: 352 SPKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLM 411

Query: 120 P 120
           P
Sbjct: 412 P 412


>gi|33597143|ref|NP_884786.1| integral membrane protein [Bordetella parapertussis 12822]
 gi|33566594|emb|CAE37852.1| conserved integral membrane protein [Bordetella parapertussis]
          Length = 534

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 74/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A    ++   S L +  +  VL  G+P    L +L   ++ TL+  GAF AQD
Sbjct: 308 LLPSLSAAHARADQDGYSGLLDWGLRLVLMLGLPAALGLALLSDGLVATLFHYGAFQAQD 367

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  +  YS  ++G L  ++L   FYA+ D++TP K  I+ +V+  ++   L P++ 
Sbjct: 368 VQQTRLAVIAYSVGLIGLLAIKILAPGFYAKQDIRTPVKIAIMVLVLTQLLNAILVPWLA 427

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L   L +R
Sbjct: 428 HAGLALAIGLGACINALALLTGLRRR 453


>gi|302185237|ref|ZP_07261910.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           syringae 642]
          Length = 512

 Score = 61.2 bits (147), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 SAMTQRALVAYSIGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|317014291|gb|ADU81727.1| virulence factor MviN [Helicobacter pylori Gambia94/24]
          Length = 486

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N +Q   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIALKNNEQDLVLQRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G V ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLNKLFSLWLYAKLEQKKAAKISLISLFLGLVASLSLMP 412


>gi|294085164|ref|YP_003551924.1| integral membrane protein MviN [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664739|gb|ADE39840.1| integral membrane protein MviN [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 514

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 86/174 (49%), Gaps = 3/174 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLPKLS A   +++   + + N  I    FF IP    ++ + + II  L+  GAF+  
Sbjct: 293 ALLPKLSKAEATQDQASVNAILNDGIGLGGFFVIPAVTAMICIAEPIISGLFAYGAFSTA 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D  + +  L  Y+  ++GF+ +R+    FYA     T  K  + ++++    ++ L    
Sbjct: 353 DATVTALALQAYALGLLGFVATRLFQPAFYAAGQPTTVLKVSLCAVLVNIAGSLLLMRIF 412

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQ-IDLPFQTIYRIL--SIFISSGLMG 173
           G  G+A A      +  + L + L++  + + +PF  + +I   S  +++GL+G
Sbjct: 413 GHVGLAIATSFSGVMAALILGILLVRSGKLVQMPFAVLGKICLASACMAAGLLG 466


>gi|330427893|gb|AEC19227.1| membrane protein [Pusillimonas sp. T7-7]
          Length = 518

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 75/146 (51%), Gaps = 1/146 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS+A   E+    S L +  +  VL  G+P    L +L   ++ TL+  GAF A D
Sbjct: 293 LLPRLSAAHAKEDHAGYSALLDWGLRLVLLLGLPAAIGLALLSDGLVATLFNYGAFGAAD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     +  Y+  ++G L  ++L   FYA+ +++TP +  +  +V+  +  + L P   
Sbjct: 353 VMQTRLAVMAYAVGLIGLLAIKILAPGFYAKQNIRTPVRIALFVLVLTQIFNLILVPLFA 412

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      VN +CL V LL+R
Sbjct: 413 HAGLALSIGLGATVNALCL-VVLLRR 437


>gi|210135075|ref|YP_002301514.1| virulence factor MviN protein [Helicobacter pylori P12]
 gi|210133043|gb|ACJ08034.1| virulence factor MviN protein [Helicobacter pylori P12]
          Length = 486

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAF 59
           +AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F
Sbjct: 294 SALFP--SIAIALKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQF 351

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           + +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L 
Sbjct: 352 SPKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLM 411

Query: 120 P 120
           P
Sbjct: 412 P 412


>gi|146296489|ref|YP_001180260.1| integral membrane protein MviN [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410065|gb|ABP67069.1| integral membrane protein MviN [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 518

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 98/213 (46%), Gaps = 8/213 (3%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     ++  ++   +P     ++L KEI + +Y+RG FT   T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSSVNSIILLMMPFAVGGMILSKEITRLIYQRGNFTVYSTM 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  YS   VG  L  +L    Y   D KT  K  +++IV   ++ I         
Sbjct: 351 LTASPLMFYSLGFVGLGLRDILNRTLYVLKDSKTAVKNGVIAIVCNIILDIVFIHKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL-SIFISSGLMGMFIVFFKPCLF 184
           G A A  S  ++ T+ L ++L K+    + ++ I  +L    I+S +MG+F+  FK    
Sbjct: 411 GAAMAFASANYIATVLLFISLRKKLG-SIGWKRIASVLVKSLIASLIMGIFVYLFKQRFI 469

Query: 185 NQLSAETAFSPFKNLAIILSGAV---LVYLCSI 214
           N       FS +  +AI+   A+   L+YL  +
Sbjct: 470 NLNMHFAPFSLYTLIAIVFGMAIYAGLIYLFKV 502


>gi|188527711|ref|YP_001910398.1| virulence factor MviN [Helicobacter pylori Shi470]
 gi|188143951|gb|ACD48368.1| virulence factor MviN [Helicobacter pylori Shi470]
          Length = 486

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L      +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNHQQDLILERLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G V ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLVASLSLMP 412


>gi|83748949|ref|ZP_00945958.1| Virulence factor mviN homolog [Ralstonia solanacearum UW551]
 gi|207744176|ref|YP_002260568.1| hypothetical protein RSIPO_02363 [Ralstonia solanacearum IPO1609]
 gi|83724372|gb|EAP71541.1| Virulence factor mviN homolog [Ralstonia solanacearum UW551]
 gi|206595581|emb|CAQ62508.1| conserved hypothetical protein [Ralstonia solanacearum IPO1609]
          Length = 530

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   E++++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 305 LLPSLSKASAEEHREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGRFNGLD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ + +  +  I   P  G
Sbjct: 365 VEMTRQALVSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLAVTQLSNIVFVPMFG 424

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N   L + L +R
Sbjct: 425 HAGLALSISFGATINAALLFLGLRRR 450


>gi|237801848|ref|ZP_04590309.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331024706|gb|EGI04762.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 468

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP K  + ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAVFTLIV 393


>gi|289674844|ref|ZP_06495734.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           syringae FF5]
 gi|330971961|gb|EGH72027.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 512

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|66043973|ref|YP_233814.1| virulence factor MVIN-like [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254680|gb|AAY35776.1| Virulence factor MVIN-like [Pseudomonas syringae pv. syringae
           B728a]
          Length = 528

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 303 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDALD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 363 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 409


>gi|307637573|gb|ADN80023.1| Proposed peptidoglycan lipid II flippase [Helicobacter pylori 908]
 gi|325996164|gb|ADZ51569.1| putative peptidoglycan lipid II flippase [Helicobacter pylori 2018]
 gi|325997760|gb|ADZ49968.1| putative peptidoglycan lipid II flippase [Helicobacter pylori 2017]
          Length = 486

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIALKNNQQDLVLQRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|207721721|ref|YP_002252160.1| hypothetical protein RSMK02007 [Ralstonia solanacearum MolK2]
 gi|206586883|emb|CAQ17468.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
          Length = 530

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   E++++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 305 LLPSLSKASAEEHREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGRFNGLD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ + +  +  I   P  G
Sbjct: 365 VEMTRQALVSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLAVTQLSNIVFVPMFG 424

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N   L + L +R
Sbjct: 425 HAGLALSISFGATINAALLFLGLRRR 450


>gi|317012689|gb|ADU83297.1| virulence factor MviN [Helicobacter pylori Lithuania75]
          Length = 486

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIALKNHQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|300723080|ref|YP_003712378.1| putative virulence factor [Xenorhabdus nematophila ATCC 19061]
 gi|297629595|emb|CBJ90198.1| putative virulence factor [Xenorhabdus nematophila ATCC 19061]
          Length = 511

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  +   L +  +       +PC   L ML + +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHAEYRRLMDWGLRLCFLLALPCAVALGMLAEPLTVSLFQYGNFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  Y   ++G ++ +VL   FY+R D+KTP K  I ++++
Sbjct: 347 AEMTQRALIAYCFGLMGLIVVKVLAPGFYSRQDIKTPVKIAIATLIL 393


>gi|296132017|ref|YP_003639264.1| integral membrane protein MviN [Thermincola sp. JR]
 gi|296030595|gb|ADG81363.1| integral membrane protein MviN [Thermincola potens JR]
          Length = 482

 Score = 60.8 bits (146), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 86/173 (49%), Gaps = 2/173 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L++ +  E      +  +  I  + F  IP    +++L   II+ L+E+G F   
Sbjct: 247 AIFPTLTAYVATERMDDYKKTFSLGIRTIAFITIPAAVGMMVLGMPIIRLLFEQGKFQHN 306

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT+  +S L  Y+  +       +++  FYA +D KTP K  +L+I   ++++  L  ++
Sbjct: 307 DTVATASVLIYYAIGLFAQSAVFIIIRGFYALHDTKTPLKLGLLTITGNYILSHLLIVYL 366

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLMGM 174
           G  G+A A     +V+   L + LL+R+   L  + I    L   +++ +MG+
Sbjct: 367 GARGLALAYSLTGFVDMTAL-LFLLRRKIGPLGIKKILISALKTLVAAAIMGL 418


>gi|223040199|ref|ZP_03610478.1| integral membrane protein MviN [Campylobacter rectus RM3267]
 gi|222878560|gb|EEF13662.1| integral membrane protein MviN [Campylobacter rectus RM3267]
          Length = 466

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 4/131 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIE--YVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           AL PK++  I+  N+ ++ +   ++ E  Y L F      I+L  P  II+ L+ERG+FT
Sbjct: 284 ALFPKITRQIKAGNEAEALKWMRKSFEILYFLLFAAAIGGIVLAQP--IIKLLFERGSFT 341

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
             DT   +S LS Y   ++ F L+++     YA    K  +K  ++++V   V+A+ L  
Sbjct: 342 QADTAATASVLSAYMIGLLPFGLAKLFSLWLYAHLQQKLASKIAVITLVFNLVLAVILMQ 401

Query: 121 FIGGYGIATAE 131
             G +G+A A 
Sbjct: 402 ACGAFGLALAS 412


>gi|15639507|ref|NP_218957.1| virulence factor (mviN) [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189025746|ref|YP_001933518.1| virulence factor [Treponema pallidum subsp. pallidum SS14]
 gi|7387912|sp|O83529|MVIN_TREPA RecName: Full=Virulence factor mviN homolog
 gi|3322808|gb|AAC65504.1| virulence factor (mviN) [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189018321|gb|ACD70939.1| virulence factor [Treponema pallidum subsp. pallidum SS14]
 gi|291059893|gb|ADD72628.1| integral membrane protein MviN [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 526

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 76/154 (49%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           + +LP LS  +  ++ Q   +L   AI+ V+   IP T  +L     II  +Y+   F  
Sbjct: 291 SVVLPDLSFHVMRKDWQSFEDLLITAIKIVMLITIPATFFVLFSSDRIITLVYKNAIFNE 350

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
               + ++    +S  ++   L+RVL+S FYA+++   P     +S V   ++A  LF  
Sbjct: 351 LSVRMTATIFRWHSVGMLAIALNRVLISAFYAQHNSFAPMIAGTISFVTNIILATLLFIP 410

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
           +GG GIA +  +   V T+ L + L +  QI +P
Sbjct: 411 LGGKGIAFSLSAASMVQTVFLWMFLKRSWQITIP 444


>gi|300703180|ref|YP_003744782.1| virulence factor mviN-like, inner membrane protein [Ralstonia
           solanacearum CFBP2957]
 gi|299070843|emb|CBJ42144.1| Virulence factor MVIN-like, inner membrane protein [Ralstonia
           solanacearum CFBP2957]
          Length = 530

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   E++++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 305 LLPSLSKASAEEHREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGRFNGLD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ + +  +  I   P  G
Sbjct: 365 VEMTRQALVSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLAVTQLSNIVFVPMFG 424

Query: 124 GYGIA 128
             G+A
Sbjct: 425 HAGLA 429


>gi|311107329|ref|YP_003980182.1| integral membrane protein MviN [Achromobacter xylosoxidans A8]
 gi|310762018|gb|ADP17467.1| integral membrane protein MviN [Achromobacter xylosoxidans A8]
          Length = 519

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 73/146 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A   ++    S L +  +  VL  G+P    + +L   ++ TL+  GAF AQD
Sbjct: 293 LLPSLSAAHARDDHGGYSGLLDWGLRLVLLLGLPAAVGMALLSDGLVATLFHYGAFAAQD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  +  YS  ++G L  ++L   FYA+ D++TP K  I  ++   ++ + L P + 
Sbjct: 353 VTQTRLAVISYSAGLIGLLAVKILAPGFYAKQDIRTPVKIAIGVLITTQLMNLVLVPLMA 412

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A A      +N + L + L +R
Sbjct: 413 HAGLALAIGLGACLNALALLIGLRRR 438


>gi|297171220|gb|ADI22228.1| uncharacterized membrane protein, putative virulence factor
           [uncultured Gemmatimonadales bacterium HF0200_34B24]
 gi|297171308|gb|ADI22313.1| uncharacterized membrane protein, putative virulence factor
           [uncultured actinobacterium HF0500_01C15]
          Length = 470

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 1/117 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+ LP+LS  ++ E ++  ++   R++  VL+F IP T   + L   I+  LYE G F A
Sbjct: 243 ASELPELSR-MRGEAERVVADRVARSLRRVLYFLIPSTLAYVALGDVIVAALYETGEFGA 301

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
            +T++    L+ Y+  +     SRVL S FYA  D +TPA+   L +    ++ + L
Sbjct: 302 VETLVTWGVLAAYAIGLPASASSRVLSSAFYALRDTRTPARIAYLRVATAILVGVTL 358


>gi|15616939|ref|NP_240152.1| virulence factor MviN-like protein [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|11133486|sp|P57415|MVIN_BUCAI RecName: Full=Virulence factor mviN homolog
 gi|25298796|pir||F84968 virulence factor mviN homolog [imported] - Buchnera sp.  (strain
           APS)
 gi|10039004|dbj|BAB13038.1| virulence factor mviN homolog [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
          Length = 511

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 75/145 (51%), Gaps = 4/145 (2%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           + I+LE K+    L +  +   L   +P + IL  L K +I  L++ G FT  D ++ + 
Sbjct: 297 NGIKLEYKK----LLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTAR 352

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIAT 129
            L +YS  ++ F+  ++L S FYA  ++K P K  + ++++  ++   L  +    GIA 
Sbjct: 353 VLKLYSCGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGIAL 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDL 154
           +     WVN + L+  L +R+ + L
Sbjct: 413 SLSITSWVNFLLLSRKLYQRKIVSL 437


>gi|108563290|ref|YP_627606.1| virulence factor mviN protein [Helicobacter pylori HPAG1]
 gi|107837063|gb|ABF84932.1| virulence factor mviN protein [Helicobacter pylori HPAG1]
          Length = 460

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAF 59
           +AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F
Sbjct: 268 SALFP--SIAIALKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQF 325

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           + +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L 
Sbjct: 326 SPKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLM 385

Query: 120 P 120
           P
Sbjct: 386 P 386


>gi|290475232|ref|YP_003468118.1| putative virulence factor [Xenorhabdus bovienii SS-2004]
 gi|289174551|emb|CBJ81345.1| putative virulence factor [Xenorhabdus bovienii SS-2004]
          Length = 512

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N ++  +L +  +       +PC   L +L + +  +L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGNHEEYRKLMDWGLRLCFLLALPCAVALGILAEPLTVSLFQYGHFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  Y   ++G ++ +VL   FY+R D+KTP K  I ++++
Sbjct: 347 AEMTQRALIAYCFGLMGLIVVKVLAPGFYSRQDIKTPVKIAIATLIL 393


>gi|260913214|ref|ZP_05919696.1| integral membrane protein MviN [Pasteurella dagmatis ATCC 43325]
 gi|260632801|gb|EEX50970.1| integral membrane protein MviN [Pasteurella dagmatis ATCC 43325]
          Length = 510

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 100/209 (47%), Gaps = 10/209 (4%)

Query: 15  ENKQQSS-ELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSY 70
           +N  QS  + RN     +  +L  G+P    + +L + ++  L+ RG F   D    S  
Sbjct: 295 DNSAQSEVDFRNTLDWGVRMILLLGVPAMVGIAILAQPLLLVLFMRGNFGLDDVQAASLS 354

Query: 71  LSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIGGYGIA 128
           L  ++  ++ F+L ++L + +YAR D KTP K  I++++  MGF +    F ++   G+A
Sbjct: 355 LWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMISNMGFNLLAIPFSYV---GLA 411

Query: 129 TAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLS 188
            A      +N   L   L K        ++   ++ I +++ +MG  + +  P L  + +
Sbjct: 412 MASAMSATLNAYLLYRGLAKSNVYHFSRKSAVFLVKILLAATVMGGIVWYNSPSLM-EWN 470

Query: 189 AETAFSPFKNLAIILSGAVLVYLCSISLL 217
           A +  +    L  ++S A +VYL  + LL
Sbjct: 471 AMSFLNRIHWLFWLISLAGIVYLGMLMLL 499


>gi|148284163|ref|YP_001248253.1| putative virlence factor, integral membrane protein [Orientia
           tsutsugamushi str. Boryong]
 gi|146739602|emb|CAM79369.1| putative virlence factor, integral membrane protein [Orientia
           tsutsugamushi str. Boryong]
          Length = 504

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 97/211 (45%), Gaps = 4/211 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +     ++  L+ + I    F  +P   ++ ML   I + +Y+ GAFT ++
Sbjct: 284 LLPELSKLYKQGLVDKAIILQKKTINISCFLALPAAVVIGMLSYPIAELVYQHGAFTQEN 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   S  ++I +  +  ++L++V+   FYA  D KTP K  + S ++   ++I    F  
Sbjct: 344 TQKTSLVIAISAFGLPTYILAKVITPAFYANCDTKTPMKIAVCSSLLNITLSILFAQFFD 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP-C 182
             GI  +    +  N I + +A  K     L   T   IL + +S  +M + I +     
Sbjct: 404 YIGIVLSNAISLLTNIIFVLIAANKFSYYKLTKATAVFILKLLVSCVIMAITIYYLNNVV 463

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
           L+N+      F  F  L  I  G  LVYL S
Sbjct: 464 LYNK--TTLLFKIFSLLICIAIGG-LVYLVS 491


>gi|330941228|gb|EGH44094.1| virulence factor MVIN-like protein [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 313

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 88  LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDAFD 147

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 148 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 194


>gi|15611884|ref|NP_223535.1| hypothetical protein jhp0817 [Helicobacter pylori J99]
 gi|7387929|sp|Q9ZKW7|MVIN_HELPJ RecName: Full=Virulence factor mviN homolog
 gi|4155388|gb|AAD06398.1| putative [Helicobacter pylori J99]
          Length = 460

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 269 ALFP--SIAIALKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 326

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 327 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 386


>gi|120609856|ref|YP_969534.1| integral membrane protein MviN [Acidovorax citrulli AAC00-1]
 gi|120588320|gb|ABM31760.1| integral membrane protein MviN [Acidovorax citrulli AAC00-1]
          Length = 545

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 104/213 (48%), Gaps = 4/213 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    + Q+ S + +  +  V+   +PC   LL   + ++ TL+  GA    D
Sbjct: 322 LTPQLAAARAAGDAQRYSAMLDWGLRIVVVLSVPCAVALLTFAQPLVATLFHHGALHDGD 381

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L+ Y   ++G +  +VL   +YA  D++TP +  ++ + +  ++   L P + 
Sbjct: 382 VGQIALALAGYGVGLLGLVAIKVLAPGYYASQDIRTPVRIAVVVLCVTQLLNAVLVPTLE 441

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVFFKPC 182
             G+A +      VN + L V LL+R     P     R +L +  +S L+ +F+++    
Sbjct: 442 HAGLALSIGLGALVNALWLLVGLLRRGSFQ-PQPGWGRLLLQVVAASALLAIFLIWASRY 500

Query: 183 L-FNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
           + +  + A  A      LA+ L+GA ++Y  ++
Sbjct: 501 IDWIAMRAHEA-QRVGWLAVFLAGAAVLYFGAL 532


>gi|240948167|ref|ZP_04752570.1| virulence factor-like MviN [Actinobacillus minor NM305]
 gi|240297520|gb|EER48027.1| virulence factor-like MviN [Actinobacillus minor NM305]
          Length = 538

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 99/217 (45%), Gaps = 8/217 (3%)

Query: 5   LPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++    ++  Q+  E +   +  +  VL  GIP    + +L + +I T++ RG F  
Sbjct: 316 LSRIAKKKDIDENQRKVEFQSTMDWGVRMVLLLGIPAMIGIAVLAQPMIMTIFMRGKFGL 375

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D I  S  L I    +  ++L  +L + FYA  + KTP K  +++ V      +   PF
Sbjct: 376 SDVIASSHALWIMCFGLNSYMLISILANGFYANQNTKTPVKIGLIATVSNMCFGVLAIPF 435

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      VN   L   L K+    +  +T+  +L + I+  +MG  + +F P
Sbjct: 436 -GYLGLAMASALSAAVNAGLLYRQLSKQAIYHISRKTVIFVLKLLIAGLIMGGVVHYFCP 494

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLL 218
            L +  +  T    +  L +I    VL  +C  ++LL
Sbjct: 495 DLQSWYAMSTLLKVYWLLWLI----VLAAICYFAMLL 527


>gi|134095627|ref|YP_001100702.1| MviN family virulence factor [Herminiimonas arsenicoxydans]
          Length = 422

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 4   LLPKLSSAIQLENKQ-QSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           LLP LS A   E K  + S L +  +       +PC   L  + + +  TL+  G F AQ
Sbjct: 197 LLPSLSKA-NFEGKTAEYSSLLDWGLRLTFLLALPCAVGLATISEPLTATLFHYGKFDAQ 255

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
              + S  L  Y   ++G +L ++L   FYA+ ++KTP K  I  ++   ++ +   P+I
Sbjct: 256 SVAMTSRALIAYGVGLIGLILVKILAPGFYAQQNIKTPVKIAIGVLIATQLMNLIFVPWI 315

Query: 123 GGYGIA 128
              G+A
Sbjct: 316 AHAGLA 321


>gi|255020998|ref|ZP_05293052.1| integral membrane protein MviN [Acidithiobacillus caldus ATCC
           51756]
 gi|254969553|gb|EET27061.1| integral membrane protein MviN [Acidithiobacillus caldus ATCC
           51756]
          Length = 501

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 92/178 (51%), Gaps = 3/178 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +  + L +  + +    G P T  L++L + ++ TL+  GA+TA+D
Sbjct: 278 VLPMLSRQAASGSSEFPATL-DWGLRWTWLVGFPATLGLVLLAEPLLITLFHYGAYTAED 336

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   IV  + +RVL   FYAR D +TP +F ++S+++  V+++ L     
Sbjct: 337 AAQSALSLVGYGLGIVPIIAARVLAPAFYARQDTRTPVRFGVISVLVNVVVSLMLAWHFR 396

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL-SIFISSGLMGMFIVFFK 180
             G+A A      VN+I LA   L R  +  PF   +R L    ++SG MG+F+ + +
Sbjct: 397 QLGLALATTLAALVNSILLA-RRLSRDGVYRPFPGWWRFLRQTSLASGAMGLFLWWGR 453


>gi|317182190|dbj|BAJ59974.1| virulence factor MviN [Helicobacter pylori F57]
          Length = 486

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 66/120 (55%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ+  L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQNLILKRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|325577252|ref|ZP_08147736.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160834|gb|EGC72955.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Haemophilus parainfluenzae ATCC
           33392]
          Length = 524

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 15  ENKQQSS-ELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSY 70
           +N  QS+ + RN     +  +L  G+P    + +L + ++  L+ RG+FT  D    S  
Sbjct: 309 DNSSQSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLVLFMRGSFTLTDVHSASYS 368

Query: 71  LSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
           L  ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 369 LWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNVLAIPFSYVG 423


>gi|91974732|ref|YP_567391.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB5]
 gi|91681188|gb|ABE37490.1| integral membrane protein MviN [Rhodopseudomonas palustris BisB5]
          Length = 518

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 104/210 (49%), Gaps = 2/210 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A L+P+L+ A++ +++   S+  +R +E  +   +P    L++L + I++ L+E GAFTA
Sbjct: 283 AVLVPELARAVRGDDRAALSDAASRGLELAIGVALPAMLGLIVLREPIVRVLFEHGAFTA 342

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            DT   +  L + +  +   +L++   + F+AR D  TP    ++++ +    A+ L   
Sbjct: 343 SDTAATALALGLLALGLPAQVLAKTWSAAFFAREDTSTPLFATLVALGVALAAALLLGRT 402

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A     W N   L    L R  + +      R+  I +++G MG  + + K 
Sbjct: 403 YGASGVAAAIALGAWSNAALLLGRGLARFGVAIDPAARRRVALIVLAAGAMGGLL-WLKA 461

Query: 182 CLFNQLSAE-TAFSPFKNLAIILSGAVLVY 210
                L AE +  +    L ++++G +++Y
Sbjct: 462 GFVLPLVAEASTLAQAAVLGVLIAGGLIIY 491


>gi|218245908|ref|YP_002371279.1| integral membrane protein MviN [Cyanothece sp. PCC 8801]
 gi|218166386|gb|ACK65123.1| integral membrane protein MviN [Cyanothece sp. PCC 8801]
          Length = 533

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   IIQ +Y+RGAF 
Sbjct: 298 LVPFMPVFSRLTTPENWPELKLRIRQGLLLTALTMLPLTAIFIALATPIIQVIYQRGAFK 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           A D+ +V   L  Y   +  +L   +L+  FYA  D +TP +  I++IV+  ++    + 
Sbjct: 358 AADSEIVVPVLMAYGVGMFFYLGRDILVRVFYALGDGETPFRVSIINIVLNGLLDFLFYK 417

Query: 121 FIGGYGIATAEVSWVWVNTICLAV--ALLKRRQIDLPFQ 157
             G  GI  A V    VN + + +   +L RR   LP +
Sbjct: 418 PFGTPGIVFATVG---VNILSMIIFLGILNRRLHGLPLK 453


>gi|257058956|ref|YP_003136844.1| integral membrane protein MviN [Cyanothece sp. PCC 8802]
 gi|256589122|gb|ACV00009.1| integral membrane protein MviN [Cyanothece sp. PCC 8802]
          Length = 533

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   IIQ +Y+RGAF 
Sbjct: 298 LVPFMPVFSRLTTPENWPELKLRIRQGLLLTALTMLPLTAIFIALATPIIQVIYQRGAFK 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           A D+ +V   L  Y   +  +L   +L+  FYA  D +TP +  I++IV+  ++    + 
Sbjct: 358 AADSEIVVPVLMAYGVGMFFYLGRDILVRVFYALGDGETPFRVSIINIVLNGLLDFLFYK 417

Query: 121 FIGGYGIATAEVSWVWVNTICLAV--ALLKRRQIDLPFQ 157
             G  GI  A V    VN + + +   +L RR   LP +
Sbjct: 418 PFGTPGIVFATVG---VNILSMIIFLGILNRRLHGLPLK 453


>gi|312792883|ref|YP_004025806.1| integral membrane protein mvin [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180023|gb|ADQ40193.1| integral membrane protein MviN [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 518

 Score = 60.5 bits (145), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 104/233 (44%), Gaps = 26/233 (11%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     A+  ++   +P     ++L KEI + +Y+RG FT + T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSAVNSIILMMMPFAIGGIILSKEITRLIYQRGNFTIESTL 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  Y    VG  L  +L    Y   D KT  K  +++IV   ++ I         
Sbjct: 351 LTASPLMFYCLGFVGLGLRDMLNRTLYVLKDSKTAVKNGVIAIVCNIILDIIFIHKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKP 181
           G A A  S  ++  + L ++L K+    L      RI S+F    ++S +MG+F+  FK 
Sbjct: 411 GAAMAFASANYIAAVLLFISLRKK----LGSIGWKRIASVFVKALVASLVMGVFVYAFKQ 466

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
             F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 467 K-FIYLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|254491236|ref|ZP_05104417.1| integral membrane protein MviN [Methylophaga thiooxidans DMS010]
 gi|224463749|gb|EEF80017.1| integral membrane protein MviN [Methylophaga thiooxydans DMS010]
          Length = 513

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++    S+  + A+++V   G P    L++L + ++ TL++ G FT+ D
Sbjct: 288 ILPSLSQKHASKSADAFSDTIDWALKWVFLLGTPAAIGLIVLAEPLLITLFQYGEFTSSD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  Y   ++ F+  +VL   ++AR D KTP K  I+++V   V+ I L  ++ 
Sbjct: 348 AHKASLSLMAYGLGLLPFIFIKVLAPGYFARQDTKTPVKIGIIAMVSNMVLNIILMIYLA 407

Query: 124 GYG 126
             G
Sbjct: 408 HVG 410


>gi|15645503|ref|NP_207678.1| virulence factor mviN protein (mviN) [Helicobacter pylori 26695]
 gi|7387909|sp|O25551|MVIN_HELPY RecName: Full=Virulence factor mviN homolog
 gi|2314021|gb|AAD07933.1| virulence factor mviN protein (mviN) [Helicobacter pylori 26695]
          Length = 461

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 270 ALFP--SIAIALKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 327

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 328 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 387


>gi|146297022|ref|YP_001180793.1| integral membrane protein MviN [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410598|gb|ABP67602.1| integral membrane protein MviN [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 523

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 82/168 (48%), Gaps = 1/168 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P LS       +++  +    +I  ++   IP T  + +L  EI+Q +YERGAF  
Sbjct: 284 AVIYPYLSRFFSSSQQEEFKKYLILSINSLILIMIPITFGVFILSNEIVQVVYERGAFNR 343

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T L S  L  +S   +G+ +  +L   FY+  D  TP K  I ++ +  ++ + L  F
Sbjct: 344 KSTYLTSGALMFFSLGYLGYAVRDILSRTFYSIQDTLTPMKNGIFAVAVNIILNVILVRF 403

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFIS 168
           +   G+A       +V+   L  +L+++  +IDL    +  + +IF S
Sbjct: 404 LQHRGLALGTSIVAYVSVFLLLRSLIEKIGKIDLKNSLVVLLKAIFAS 451


>gi|261838268|gb|ACX98034.1| virulence factor mviN protein [Helicobacter pylori 51]
          Length = 461

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 270 ALFP--SIAIAIKNNQQDLILKRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 327

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 328 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLTASLSLMP 387


>gi|241664011|ref|YP_002982371.1| integral membrane protein MviN [Ralstonia pickettii 12D]
 gi|240866038|gb|ACS63699.1| integral membrane protein MviN [Ralstonia pickettii 12D]
          Length = 530

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    N+++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 305 LLPSLSKASAENNREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGKFNGID 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L+ Y   ++G ++ ++L   FYAR D++TP K  ++ +V   +      P  G
Sbjct: 365 VEMTRQALTSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLVATQLSNYVFVPIFG 424

Query: 124 GYGIA 128
             G+A
Sbjct: 425 HAGLA 429


>gi|261839680|gb|ACX99445.1| virulence factor MviN [Helicobacter pylori 52]
          Length = 486

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILKRLQKAWFFLVGVLLFCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|58584382|ref|YP_197955.1| hypothetical protein Wbm0122 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418698|gb|AAW70713.1| Uncharacterized membrane protein, virulence factor MviN [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 497

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 71/139 (51%), Gaps = 2/139 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   Q  + + + +++NRA+   L   +P TA  +++P  I+ TL+  G F    
Sbjct: 277 LLPLISK--QANDTENTVKIQNRALNIGLMLIMPTTAAFIIIPNTILLTLFSYGKFDHYA 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L   S  +  F++++VLL  F+A++++K P  F +  + +  V+ + L     
Sbjct: 335 VQQTAPTLIALSLSLPAFIINKVLLPTFFAKSNLKIPTIFSLACLGINVVLNLLLMNKYQ 394

Query: 124 GYGIATAEVSWVWVNTICL 142
             GIA A     W+N+I L
Sbjct: 395 HTGIAIATSISTWINSILL 413


>gi|254422676|ref|ZP_05036394.1| integral membrane protein MviN [Synechococcus sp. PCC 7335]
 gi|196190165|gb|EDX85129.1| integral membrane protein MviN [Synechococcus sp. PCC 7335]
          Length = 532

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 9/178 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P L    +L    Q  EL+ R  + ++   +   P +A+++ L + I+  +YERGAF 
Sbjct: 298 LVPFLPIFSRLSLPNQWPELKQRIRQSLILVALTMLPLSALIVTLARPIVSVVYERGAFD 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
                LV++ L  Y   +  +L   V++  FYA  D +TP    +++I+   V+    F 
Sbjct: 358 EDAVALVTAMLIAYGAGMFVYLARDVMVRVFYALGDGQTPFNISLVNIITNAVLDYVFFN 417

Query: 121 FIGGYGIATAEVSWVWVNTICL-AVALLKRRQID-LPFQTIYR-ILSIFISSGLMGMF 175
            +G  G+  A +    VN + L A+ +L  R+ID LP     R I +I  +S L G+F
Sbjct: 418 LMGPPGLVVATIG---VNIVSLVAMTVLLARKIDGLPVADWARSIATITGASFLSGVF 472


>gi|193222388|emb|CAL62581.2| Virulence factor MviN homolog [Herminiimonas arsenicoxydans]
          Length = 516

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 4   LLPKLSSAIQLENKQ-QSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           LLP LS A   E K  + S L +  +       +PC   L  + + +  TL+  G F AQ
Sbjct: 291 LLPSLSKA-NFEGKTAEYSSLLDWGLRLTFLLALPCAVGLATISEPLTATLFHYGKFDAQ 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
              + S  L  Y   ++G +L ++L   FYA+ ++KTP K  I  ++   ++ +   P+I
Sbjct: 350 SVAMTSRALIAYGVGLIGLILVKILAPGFYAQQNIKTPVKIAIGVLIATQLMNLIFVPWI 409

Query: 123 GGYGIA 128
              G+A
Sbjct: 410 AHAGLA 415


>gi|229588312|ref|YP_002870431.1| putative virulence factor [Pseudomonas fluorescens SBW25]
 gi|229360178|emb|CAY47035.1| putative virulence factor [Pseudomonas fluorescens SBW25]
          Length = 512

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++Q+ S + +  +       +PC   L +L + +  +L++ G F A D
Sbjct: 287 LLPTLARTYASKDRQEYSRILDWGLRLCFVLVLPCALALGILAEPLTVSLFQYGQFDAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FYA+ +++TP K  I ++++
Sbjct: 347 ALMTQHALVAYSVGLLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|317407675|gb|EFV87611.1| integral membrane protein [Achromobacter xylosoxidans C54]
          Length = 519

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 63/117 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A   ++    S L +  +  VL  G+P    + +L   ++ TL+  GAF+AQD
Sbjct: 293 LLPSLSAAHARDDHGGYSALLDWGLRLVLLLGLPAAVGMALLSDGLVATLFHYGAFSAQD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +     +  YS  ++G L  ++L   FYA+ D++TP K  I  +V+  ++ + L P
Sbjct: 353 VLQTRLAVISYSAGLIGLLAVKILAPGFYAKQDIRTPVKIAIGVLVLTQLMNLALVP 409


>gi|46581466|ref|YP_012274.1| integral membrane protein MviN [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450888|gb|AAS97534.1| integral membrane protein MviN [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311235118|gb|ADP87972.1| integral membrane protein MviN [Desulfovibrio vulgaris RCH1]
          Length = 562

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP L+S      ++    L  + +   LF  +P  A L+ +   ++Q L+  GAF A 
Sbjct: 335 ASLPVLASLHAAGRREHFETLLRQGVRLSLFVTLPAAAGLMAVAHPLVQVLFGHGAFDAA 394

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                 + L  Y+  +  F L R LL+  +AR D +TP    ++S+ +  V  + L   +
Sbjct: 395 AVAGTVTALCAYAPGLPAFALGRTLLAATHARGDTRTPVLAALVSLAVVLVAGLALSGPL 454

Query: 123 GGYGIATAEVSWVWVNTICLAVALLK 148
           G  G   A     W NT+ L +++++
Sbjct: 455 GVAGPPLAASLGAWCNTLLLHLSIVR 480


>gi|188534177|ref|YP_001907974.1| Virulence factor MviN, possible MOP Superfamliy efflux pump
           precursor [Erwinia tasmaniensis Et1/99]
 gi|188029219|emb|CAO97091.1| Virulence factor MviN, possible MOP Superfamliy efflux pump
           precursor [Erwinia tasmaniensis Et1/99]
          Length = 512

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQAEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  + +++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIALFTLL 392


>gi|315586832|gb|ADU41213.1| integral membrane protein MviN [Helicobacter pylori 35A]
          Length = 486

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILKRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|312958880|ref|ZP_07773399.1| integral membrane protein [Pseudomonas fluorescens WH6]
 gi|311286650|gb|EFQ65212.1| integral membrane protein [Pseudomonas fluorescens WH6]
          Length = 512

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++Q+ S + +  +       +PC   L +L + +  +L++ G F A D
Sbjct: 287 LLPTLARTYASKDRQEYSRILDWGLRLCFVLVLPCALALGILAEPLTVSLFQYGQFDAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G ++ +VL   FYA+ +++TP K  I ++++
Sbjct: 347 ALMTQHALVAYSVGLLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|146281348|ref|YP_001171501.1| MviN family membrane protein [Pseudomonas stutzeri A1501]
 gi|145569553|gb|ABP78659.1| membrane protein, MviN family [Pseudomonas stutzeri A1501]
          Length = 515

 Score = 60.1 bits (144), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 59/111 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E+ +  S   + A+  VL  G+P    L +L + +I +L+  GA + + 
Sbjct: 294 ILPSLSRQHAGEDPKAFSATLDWALRMVLLVGVPAALALGILAEPMIASLFYYGAMSEEA 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
            +  +  L  YS  ++ F+L +VL   F+AR D+KTP +  ++ +V   V+
Sbjct: 354 VVQSARALQAYSLGVLAFMLIKVLAPGFFARQDLKTPVRVAVICMVANMVM 404


>gi|322832418|ref|YP_004212445.1| integral membrane protein MviN [Rahnella sp. Y9602]
 gi|321167619|gb|ADW73318.1| integral membrane protein MviN [Rahnella sp. Y9602]
          Length = 511

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N  + + L +  +       +P +  L +L K +   L++ G F+A D
Sbjct: 287 LLPSLARSFSSGNHGEYNRLMDWGLRLCFLLALPSSVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  ++G ++ +VL   FY+R ++KTP K  I++++M  V+ +    FIG
Sbjct: 347 ASMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKTPVKIAIITLLMTQVMNLA---FIG 403


>gi|327479527|gb|AEA82837.1| MviN family membrane protein [Pseudomonas stutzeri DSM 4166]
          Length = 515

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 59/111 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E+ +  S   + A+  VL  G+P    L +L + +I +L+  GA + + 
Sbjct: 294 ILPSLSRQHAGEDPKAFSATLDWALRMVLLVGVPAALALGILAEPMIASLFYYGAMSEEA 353

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
            +  +  L  YS  ++ F+L +VL   F+AR D+KTP +  ++ +V   V+
Sbjct: 354 VVQSARALQAYSLGVLAFMLIKVLAPGFFARQDLKTPVRVAVICMVANMVM 404


>gi|237749045|ref|ZP_04579525.1| virulence factor MviN [Oxalobacter formigenes OXCC13]
 gi|229380407|gb|EEO30498.1| virulence factor MviN [Oxalobacter formigenes OXCC13]
          Length = 516

 Score = 60.1 bits (144), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    + ++ S L +  +       +P + +L+ L      TL+  G F A D
Sbjct: 291 LLPSLSKAHANNDDKEYSSLMDWGLRLTFLLAMPASILLMTLAVPFTATLFNYGKFNAVD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  +  Y   ++G ++ R+L   FYA+ D++TP K  +  +++  ++ +   P   
Sbjct: 351 VNMTAYAVIAYGVGLIGLIVVRILAPGFYAKQDIRTPVKIAVFVLILTQLMNLFFVPIFA 410

Query: 124 GYGIA 128
             G+A
Sbjct: 411 HAGLA 415


>gi|330818115|ref|YP_004361820.1| integral membrane protein MviN [Burkholderia gladioli BSR3]
 gi|327370508|gb|AEA61864.1| integral membrane protein MviN [Burkholderia gladioli BSR3]
          Length = 576

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 72/152 (47%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    LL+  + +  TL+  G F A  
Sbjct: 351 LLPSLSKAHVDADATEYSALLDWGLRVTFLLAAPSALGLLVFAEPLTATLFNYGKFDAHT 410

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I+ +++  +      P +G
Sbjct: 411 VEMVARALAAYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIVVLIVTQLSNYVFVPILG 470

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 471 HAGLTLSIGVGASLNSLLLFIG-LRRRGIYQP 501


>gi|262195664|ref|YP_003266873.1| integral membrane protein MviN [Haliangium ochraceum DSM 14365]
 gi|262079011|gb|ACY14980.1| integral membrane protein MviN [Haliangium ochraceum DSM 14365]
          Length = 548

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 82/164 (50%), Gaps = 2/164 (1%)

Query: 28  IEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVL 87
           +  VLF  +P T  L+ L + II+ ++ERGAFTA DT   +  L +Y+T +V +   +V+
Sbjct: 342 LRLVLFLTVPATVGLVTLGEPIIRLIFERGAFTALDTRATADALELYATGLVAYAAVKVV 401

Query: 88  LSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALL 147
              FYA +  + P    I ++    ++ I L P I GY +     +   V  + +  ++ 
Sbjct: 402 APAFYAMDMARIPVLASISAVAGNLLLNITLHP-IYGYRVLALGTALAAVLNLTVLYSMF 460

Query: 148 KRRQIDLPFQTIYRILS-IFISSGLMGMFIVFFKPCLFNQLSAE 190
            RR    P   + R L+ I +++ LMG  ++  +  L + +  E
Sbjct: 461 SRRIASPPHLALLRYLTLILVAAALMGAAVIAVRVQLIDLVGTE 504


>gi|15599758|ref|NP_253252.1| hypothetical protein PA4562 [Pseudomonas aeruginosa PAO1]
 gi|116052705|ref|YP_793021.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218893657|ref|YP_002442526.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           LESB58]
 gi|254238690|ref|ZP_04932013.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244541|ref|ZP_04937863.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296391376|ref|ZP_06880851.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           PAb1]
 gi|9950808|gb|AAG07950.1|AE004870_1 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115587926|gb|ABJ13941.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126170621|gb|EAZ56132.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126197919|gb|EAZ61982.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773885|emb|CAW29699.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           LESB58]
          Length = 512

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++ + S L +  +       +PC+  L +L + +  +L++ G FT  D
Sbjct: 287 LLPMLAKTYSNKDRHEYSRLLDWGLRLCFLLVLPCSLALAILAEPLTVSLFQYGKFTTVD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYA+ +++TP K  + ++V
Sbjct: 347 AAMTQRALVAYSVGLLGIILVKVLAPGFYAQQNIRTPVKIALFTLV 392


>gi|313107207|ref|ZP_07793406.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           39016]
 gi|310879908|gb|EFQ38502.1| putative virulence factor, membrane protein [Pseudomonas aeruginosa
           39016]
          Length = 506

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++ + S L +  +       +PC+  L +L + +  +L++ G FT  D
Sbjct: 281 LLPMLAKTYSNKDRHEYSRLLDWGLRLCFLLVLPCSLALAILAEPLTVSLFQYGKFTTVD 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYA+ +++TP K  + ++V
Sbjct: 341 AAMTQRALVAYSVGLLGIILVKVLAPGFYAQQNIRTPVKIALFTLV 386


>gi|107099775|ref|ZP_01363693.1| hypothetical protein PaerPA_01000793 [Pseudomonas aeruginosa PACS2]
          Length = 503

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++ + S L +  +       +PC+  L +L + +  +L++ G FT  D
Sbjct: 278 LLPMLAKTYSNKDRHEYSRLLDWGLRLCFLLVLPCSLALAILAEPLTVSLFQYGKFTTVD 337

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYA+ +++TP K  + ++V
Sbjct: 338 AAMTQRALVAYSVGLLGIILVKVLAPGFYAQQNIRTPVKIALFTLV 383


>gi|254779492|ref|YP_003057597.1| putative virulence factor MviN protein; putative membrane protein
           [Helicobacter pylori B38]
 gi|254001403|emb|CAX29396.1| Putative virulence factor MviN protein; putative membrane protein
           [Helicobacter pylori B38]
          Length = 461

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 66/121 (54%), Gaps = 4/121 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAF 59
           +AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F
Sbjct: 269 SALFP--SIAIAIKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQF 326

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
           + +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L 
Sbjct: 327 SPKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLM 386

Query: 120 P 120
           P
Sbjct: 387 P 387


>gi|258404840|ref|YP_003197582.1| integral membrane protein MviN [Desulfohalobium retbaense DSM 5692]
 gi|257797067|gb|ACV68004.1| integral membrane protein MviN [Desulfohalobium retbaense DSM 5692]
          Length = 511

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 80/172 (46%), Gaps = 2/172 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP  S        +   +  N+ +  +LF  +P  A L+ L + ++ TL+ RGAF+A+
Sbjct: 290 AALPSFSRLAADGAHEDLLQTLNKTLGLLLFISLPSAAGLIALSEPMVATLFGRGAFSAE 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                +  L  YST +  F   R L+S +YA  D KTP K   L +++   + + L  F 
Sbjct: 350 AVQATAWALVGYSTGLPAFCCVRSLVSTYYALEDTKTPVKIATLCLLLNGGLGLLLMQFW 409

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGM 174
              G+A A     W N + L   L  R   + P+  +  ++ +   S L+G+
Sbjct: 410 AHVGLALAVALASWANVVLLLRGL--RAHFNGPWMAVPGVVRMLGLSLLVGV 459


>gi|320326228|gb|EFW82282.1| virulence factor MVIN-like protein [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 512

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F A D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGRFDALD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           + +    L  YS  ++G +L +VL   FYA+ +++TP +  I ++++
Sbjct: 347 SAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVEIAIFTLIV 393


>gi|317178759|dbj|BAJ56547.1| virulence factor MviN [Helicobacter pylori F30]
          Length = 486

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNHQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|308184666|ref|YP_003928799.1| virulence factor MviN [Helicobacter pylori SJM180]
 gi|308060586|gb|ADO02482.1| virulence factor MviN [Helicobacter pylori SJM180]
          Length = 486

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|148358630|ref|YP_001249837.1| putative virulence factor MviN [Legionella pneumophila str. Corby]
 gi|148280403|gb|ABQ54491.1| integral membrane protein (putative virulence factor) MviN,
           possible role in motility [Legionella pneumophila str.
           Corby]
          Length = 487

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 97/217 (44%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 262 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 321

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 322 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFVFVWHLA 381

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN + L   L+KR         +   + + I++  +G+++     C+
Sbjct: 382 HAGLTLASALAGYVNCVILLFLLIKRGLFKPSPGWLKYSMQLLIANFAIGVYLY----CM 437

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 438 SGTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 474


>gi|118475298|ref|YP_891964.1| integral membrane protein MviN [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414524|gb|ABK82944.1| integral membrane protein MviN [Campylobacter fetus subsp. fetus
           82-40]
          Length = 466

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 68/128 (53%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ PK+S  I+  + + + +L  ++   + F  I  T   ++L +EII  L++RG F A 
Sbjct: 283 AIFPKISKQIKANSTKNAHDLLAKSFHILFFLLIFSTIGGIVLAREIIWLLFQRGEFNAN 342

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           +TI  +  L +Y   ++ F L ++     YA    K  AK  I S+++  ++++ LF  +
Sbjct: 343 NTIEAAKVLQMYMLGLIPFGLYKLFSLWLYANMKQKIAAKISIYSLILNVILSLILFKPL 402

Query: 123 GGYGIATA 130
           G  G+A A
Sbjct: 403 GAMGLALA 410


>gi|330954237|gb|EGH54497.1| virulence factor MVIN-like protein [Pseudomonas syringae Cit 7]
          Length = 512

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++Q+ S + +  +       +PCT  L +L + +  +L++ G F + D
Sbjct: 287 LLPILSKTYAQRDRQEYSRILDWGLRLCFVLVLPCTLALGLLAEPLTVSLFQYGKFDSLD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G +L +VL   FYA+ +++TP K  I ++++
Sbjct: 347 AAMTQRALVAYSVGLLGIILIKVLAPGFYAQQNIRTPVKIAIFTLIV 393


>gi|317009538|gb|ADU80118.1| virulence factor MviN [Helicobacter pylori India7]
          Length = 486

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNHQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|301154983|emb|CBW14446.1| predicted inner membrane protein [Haemophilus parainfluenzae T3T1]
          Length = 510

 Score = 59.7 bits (143), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 15  ENKQQSS----ELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSY 70
           +N  QS+    +  +  +  +L  G+P    + +L + ++  L+ RG+FT  D    S  
Sbjct: 295 DNSSQSAVDFRDTMDWGVRMILLLGVPAAIGIAVLAQPMLLVLFMRGSFTLTDVYAASYS 354

Query: 71  LSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
           L  ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 355 LWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNVLAIPFSYVG 409


>gi|308062208|gb|ADO04096.1| virulence factor MviN [Helicobacter pylori Cuz20]
          Length = 486

 Score = 59.7 bits (143), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNHQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|294635810|ref|ZP_06714267.1| integral membrane protein MviN [Edwardsiella tarda ATCC 23685]
 gi|291090845|gb|EFE23406.1| integral membrane protein MviN [Edwardsiella tarda ATCC 23685]
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 53/107 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +         + L +  +       +PC   L ++ K +   L++ G F A D
Sbjct: 287 LLPSLAKSFSSGRLDDYNRLLDWGLRLCFLLALPCAVALGVIAKPLTVALFQYGKFNAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ ++L   FY+R D+KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSVGLLGIIMVKILAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|83589085|ref|YP_429094.1| integral membrane protein MviN [Moorella thermoacetica ATCC 39073]
 gi|83571999|gb|ABC18551.1| integral membrane protein MviN [Moorella thermoacetica ATCC 39073]
          Length = 533

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 89/177 (50%), Gaps = 6/177 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L+    L ++++ + L +R +  V    +P    +++L   ++Q +++RGAF  +
Sbjct: 299 AIFPSLAEQAALNDRREMAHLTDRGLGLVALTILPAAVGMIVLRVPLVQLVFQRGAFDPR 358

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + +  +  YS  ++   +  +L   FYA  DV  P    I+S+ +  +++  L P +
Sbjct: 359 ATAMTAVAVLFYSVGLLAQAMHPILTRAFYALQDVVVPVVTGIISVGLNILLSYFLAPRL 418

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR---RQIDLPFQTIYRILSIFISSGLMGMFI 176
           G  G+A A      +  + L +AL +R    ++ L   T+ R   IF+++  MG+ +
Sbjct: 419 GHGGLALANSLAASIYALMLYLALYRRLPELKVTLLLSTMLR---IFLAAMGMGLLV 472


>gi|296447571|ref|ZP_06889493.1| integral membrane protein MviN [Methylosinus trichosporium OB3b]
 gi|296254959|gb|EFH02064.1| integral membrane protein MviN [Methylosinus trichosporium OB3b]
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 73/146 (50%), Gaps = 1/146 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +   +   +   +NR +   +    P     + +P+ I+  +++RGAFTA D
Sbjct: 283 LLPEMSRRLAAGDAAGAHAAQNRVMALTVALAAPFFIAFVTIPELIMSGVFQRGAFTAAD 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +  +  L+ Y   ++  +L     + F A+ D +TP    + ++ +   + + L+  +G
Sbjct: 343 ALRSADVLAAYGGGLMALVLISSARAGFQAQGDTRTPMYVALGAVAVNVALKVVLYRPLG 402

Query: 124 GYGIATAEVSWVWVN-TICLAVALLK 148
             G+ATA    +W+N T  + +AL +
Sbjct: 403 AVGLATATSVGLWINLTALIGIALHR 428


>gi|296533882|ref|ZP_06896412.1| integral membrane protein MviN [Roseomonas cervicalis ATCC 49957]
 gi|296265794|gb|EFH11889.1| integral membrane protein MviN [Roseomonas cervicalis ATCC 49957]
          Length = 508

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 74/149 (49%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALLP LS  ++   K  +    NRA+E  L   +P  A L++L + I+  L++RGA T +
Sbjct: 285 ALLPLLSRQLRAGRKLAAHRSMNRAVEMSLALTLPAAAALMVLAEPIVLALFQRGAMTTE 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                ++ L  Y+  +  F+L +     F+AR D  TP K  I  +V+   I++ L   +
Sbjct: 345 AAHATAAALMAYAAGLPAFVLVKAFAPGFFARGDTATPVKIGIAVVVVNLSISLTLIHVL 404

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQ 151
              GIA A     WVNT  L   L +R Q
Sbjct: 405 AHVGIALATSIAAWVNTALLCAILARRGQ 433


>gi|317177678|dbj|BAJ55467.1| virulence factor MviN [Helicobacter pylori F16]
          Length = 486

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|160947634|ref|ZP_02094801.1| hypothetical protein PEPMIC_01569 [Parvimonas micra ATCC 33270]
 gi|158446768|gb|EDP23763.1| hypothetical protein PEPMIC_01569 [Parvimonas micra ATCC 33270]
          Length = 503

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 1/127 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
            A+ P LS  + +E+  +      + I  +L+  IP T  +++  KEI+  +Y+RG F  
Sbjct: 277 TAIYPTLSR-LAIESTIKFKVQITKTISTILYLVIPSTIGIMLFSKEIVTLIYKRGKFDE 335

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D ILVS  L  Y++ ++G  +  VL S FYA    K P    I  +V+  V +I L  F
Sbjct: 336 SDVILVSGALFYYASGLIGLGIRDVLSSSFYALKLTKIPLINSIQMVVLNVVASIILSKF 395

Query: 122 IGGYGIA 128
           +G  G+A
Sbjct: 396 MGLNGLA 402


>gi|17547276|ref|NP_520678.1| MVIN_ECOLI homolog transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17429578|emb|CAD16264.1| probable transmembrane protein [Ralstonia solanacearum GMI1000]
          Length = 517

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 68/146 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    ++++ S L +  +   +   +P    L +    +  TL+  G F A D
Sbjct: 292 LLPSLSKASAENHREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGRFNALD 351

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ +V+  +  +   P  G
Sbjct: 352 VEMTRQALVSYGIGLIGLIVIKILAPGFYARQDIRTPVKIALVVLVVTQLSNMVFVPTFG 411

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N   L + L +R
Sbjct: 412 HAGLALSISFGATINAALLFLGLRRR 437


>gi|255526123|ref|ZP_05393044.1| integral membrane protein MviN [Clostridium carboxidivorans P7]
 gi|255510172|gb|EET86491.1| integral membrane protein MviN [Clostridium carboxidivorans P7]
          Length = 513

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 2/147 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           PK++        ++     + +I  ++ F +P + I++M  K II  L+ERGAFT   T 
Sbjct: 286 PKMARQTANNEMKEMKSTLSESICTLIVFILPMSLIVMMQSKPIIYILFERGAFTRSATD 345

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           + SS L  YS  ++ F L   +   +Y   D KTP     +S+V+  ++      F+G  
Sbjct: 346 ITSSVLCFYSLGLLAFGLRDFVCKAYYTLQDTKTPMINSAISLVLNIILIFIYKYFLGLK 405

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQI 152
           G+A A  + +++    L  +L  RR+I
Sbjct: 406 GLALANATSMYIACALLIFSL--RRKI 430


>gi|299065831|emb|CBJ37010.1| Virulence factor MVIN-like, inner membrane protein [Ralstonia
           solanacearum CMR15]
          Length = 517

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    ++++ S L +  +   +   +P    L +    +  TL+  G F A D
Sbjct: 292 LLPSLSKASAENHREEYSSLLDWGLRLTVLLAVPSAVGLFVFGAPLTATLFHYGRFNALD 351

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ +V+  +  +   P  G
Sbjct: 352 VEMTRQALVSYGIGLIGLIVIKILAPGFYARQDIRTPVKIALVVLVVTQLSNMVFVPAFG 411

Query: 124 GYGIA 128
             G+A
Sbjct: 412 HAGLA 416


>gi|269138776|ref|YP_003295477.1| integral membrane protein [Edwardsiella tarda EIB202]
 gi|267984437|gb|ACY84266.1| integral membrane protein [Edwardsiella tarda EIB202]
 gi|304558768|gb|ADM41432.1| Proposed peptidoglycan lipid II flippase MurJ [Edwardsiella tarda
           FL6-60]
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +         + L +  +       +PC   L ++ K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFSSGRLDDYNRLLDWGLRLCFLLALPCAVALGVIAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ ++L   FY+R D+KTP K  I+++++
Sbjct: 347 AAMTQRALVAYSIGLLGIIMVKILAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|310814757|ref|YP_003962721.1| integral membrane protein MviN [Ketogulonicigenium vulgare Y25]
 gi|308753492|gb|ADO41421.1| integral membrane protein MviN [Ketogulonicigenium vulgare Y25]
          Length = 536

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS  +   + +   +  NRA E+ L   +P    L+++   +I  +YERGAFT+ D
Sbjct: 306 LLPELSRRLAAGDDKAGKQAMNRATEFALMLSVPAAVALVVIAVPLISVMYERGAFTSAD 365

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L++Y   +  F++ +VL   FYAR D ++P +F ++S+V+  V A+ L PFIG
Sbjct: 366 TAATALALAVYGLGLPAFVMQKVLQPLFYARADTRSPFRFALVSLVVNAVAAVALAPFIG 425

Query: 124 --GYGIATAEVSW-----VWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
                + T    W     +W+ +  +  A     ++D   +T  R   I  ++ +MG+F+
Sbjct: 426 FIAAAVGTTVAGWGMVLQLWLGSRKMGAAA----EVDAQLRT--RFWRICAAAAIMGVFL 479

Query: 177 VFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGF-LASLKYSLKTDKG 235
                 L   L  E     +  L I++ G + VY  +  LL  + F +  ++  L+  KG
Sbjct: 480 AIAYALLNPML--EPGRMRYLALMILVFGGMGVYFVAGQLL--RAFDIREVRAMLRRSKG 535


>gi|308125675|ref|ZP_07663473.1| integral membrane protein MviN [Vibrio parahaemolyticus K5030]
 gi|308112961|gb|EFO50501.1| integral membrane protein MviN [Vibrio parahaemolyticus K5030]
          Length = 400

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +  +   +  +  V   GIP    L+ L K ++  L+ RG F+ QD
Sbjct: 296 ILPALSRKHVDSQSEGFAHTMDWGVRMVTLLGIPAMLGLMALAKPMLMVLFMRGEFSPQD 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKF 103
               S  L  Y++ ++ F+L +VL   +Y+R D KTP K+
Sbjct: 356 VHQASLSLLAYASGLLNFMLIKVLAPGYYSRQDTKTPVKY 395


>gi|331000949|ref|ZP_08324586.1| integral membrane protein MviN [Parasutterella excrementihominis
           YIT 11859]
 gi|329569908|gb|EGG51665.1| integral membrane protein MviN [Parasutterella excrementihominis
           YIT 11859]
          Length = 495

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 106/215 (49%), Gaps = 4/215 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A       + + L +  ++ V+ F +P    L +L + ++  L++   F   D
Sbjct: 269 LLPSLSAAFAKGMTDRYNALLDWGLKLVVAFAVPAAIGLALLGEGLVSVLFQSSRFNVND 328

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ +  YS  ++G +  ++L   FYA+ D+KTP K    ++++  +  +   P   
Sbjct: 329 VYQTATAVMGYSIGLIGLIGIKILAPGFYAQKDIKTPVKVACAALIVTQIFNLVNVPLFS 388

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVFFKP- 181
             G+A +       N  CL + +L+RR +  P     ++ L++ + S L+  +++  +  
Sbjct: 389 HAGLALSVGLGACFNACCLLI-ILRRRGVFTPLAGWKKLFLTVILGSVLLTAYLLVIQHY 447

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
           C + Q++   A      L ++ +GA ++Y+ ++++
Sbjct: 448 CDWTQMAYPWAVKLGLVLGVV-AGAAVLYIGTLAV 481


>gi|310767283|gb|ADP12233.1| Virulence factor MviN, possible MOP Superfamliy efflux pump
           [Erwinia sp. Ejp617]
          Length = 512

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQIEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  + +++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIALFTLL 392


>gi|319762107|ref|YP_004126044.1| integral membrane protein mvin [Alicycliphilus denitrificans BC]
 gi|330826062|ref|YP_004389365.1| integral membrane protein MviN [Alicycliphilus denitrificans K601]
 gi|317116668|gb|ADU99156.1| integral membrane protein MviN [Alicycliphilus denitrificans BC]
 gi|329311434|gb|AEB85849.1| integral membrane protein MviN [Alicycliphilus denitrificans K601]
          Length = 521

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 71/146 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    + ++ S + +  +  V+   +PC   LL     ++ TL+  GA    D
Sbjct: 298 LTPQLAAARAAGDAERYSAMLDWGLRIVVLLAVPCAVGLLTFATPLVATLFHHGALHDGD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L+ Y   ++G +  +VL   +YA  D++TP +  I+ +V    + + L P + 
Sbjct: 358 VGQIAVALAGYGVGLLGLVAIKVLAPGYYASQDIRTPVRIAIVVLVATQAMNVALVPLLA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N + L   L++R
Sbjct: 418 HAGLALSIGLGALINALWLLAGLVRR 443


>gi|208434793|ref|YP_002266459.1| virulence factor mviN protein [Helicobacter pylori G27]
 gi|208432722|gb|ACI27593.1| virulence factor mviN protein [Helicobacter pylori G27]
          Length = 486

 Score = 59.3 bits (142), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 62/114 (54%), Gaps = 2/114 (1%)

Query: 9   SSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFTAQDTIL 66
           S AI L+N QQ   L+     +    G+   C+   +ML KEI + L+ERG F+ +DT++
Sbjct: 299 SIAIALKNNQQDLILQRLQKAWFFLVGVLLLCSIGGIMLSKEITELLFERGQFSPKDTLI 358

Query: 67  VSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 359 TSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|312172053|emb|CBX80310.1| integral membrane protein mviN homolog [Erwinia amylovora ATCC
           BAA-2158]
          Length = 512

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQIEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  + +++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIAMFTLL 392


>gi|257471386|ref|ZP_05635385.1| virulence factor MviN-like protein [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
          Length = 511

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 5/170 (2%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           + I+LE K+    L +  +   L   +P + IL  L K +I  L++ G FT  D ++ + 
Sbjct: 297 NGIKLEYKK----LLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTAR 352

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIAT 129
            L +YS  ++ F+  ++L S FYA  ++K P K  + ++++  ++   L  +    G+A 
Sbjct: 353 VLKLYSCGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGLAL 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           +     WVN + L   L +R+ + L       I+ I +S+ +M + I+FF
Sbjct: 413 SLSISSWVNFLLLYRKLYQRKIVSLQRSEFIFIIYIILSTLVM-IVILFF 461


>gi|303246701|ref|ZP_07332979.1| integral membrane protein MviN [Desulfovibrio fructosovorans JJ]
 gi|302492041|gb|EFL51919.1| integral membrane protein MviN [Desulfovibrio fructosovorans JJ]
          Length = 513

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP LS         + +E  N ++   LF  +P  A L+ L + ++  L+ RGAF     
Sbjct: 293 LPSLSKLASSGQTGEFTETLNASLRLTLFICLPAAAGLIALAEPMVHILFGRGAFGPHAV 352

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
              ++ L  Y   +  F   R L S ++A  D +TPA    + +V+  +  + L      
Sbjct: 353 SATAAALVAYGVGLPAFACVRPLYSAYFALTDTRTPAITAAVCLVVYVIAGLALMGPTAH 412

Query: 125 YGIATAEVSWVWVNTICLAVALLKR 149
            G+A A     WVN   L V L KR
Sbjct: 413 VGLALATSISSWVNVAVLGVILRKR 437


>gi|326315998|ref|YP_004233670.1| integral membrane protein MviN [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372834|gb|ADX45103.1| integral membrane protein MviN [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 521

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 102/213 (47%), Gaps = 4/213 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    + Q+ S + +  +  V+   +PC   LL   + ++ TL+  GA    D
Sbjct: 298 LTPQLAAARAAGDAQRYSAMLDWGLRIVVVLSVPCAVALLTFAQPLVATLFHHGALHDGD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  L+ Y   ++G +  +VL   +YA  D++TP +  +  + +  ++   L P + 
Sbjct: 358 VGQIALALAGYGVGLLGLVAIKVLAPGYYASQDIRTPVRIAVAVLCVTQLLNAVLVPTLE 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVFFKPC 182
             G+A +      VN   L V LL+R     P     R +L +  +S L+ +F+++    
Sbjct: 418 HAGLALSIGLGALVNATWLLVGLLRRGSFQ-PQPGWGRLLLQVVAASALLAIFLIWASRY 476

Query: 183 L-FNQLSAETAFSPFKNLAIILSGAVLVYLCSI 214
           + +  + A  A      LA+ L+GA ++Y  ++
Sbjct: 477 IDWIAMRAHEA-QRVGWLAVFLTGAAVLYFGAL 508


>gi|238919487|ref|YP_002933002.1| integral membrane protein MviN, putative [Edwardsiella ictaluri
           93-146]
 gi|238869056|gb|ACR68767.1| integral membrane protein MviN, putative [Edwardsiella ictaluri
           93-146]
          Length = 530

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +         + L +  +       +PC   L ++ K +   L++ G F+A D
Sbjct: 305 LLPSLAKSFSSGRLDDYNRLLDWGLRLCFMLALPCAVALGVIAKPLTVALFQYGKFSAFD 364

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ ++L   FY+R D+KTP K  I+++++
Sbjct: 365 AAMTQRALVAYSIGLLGIIMVKILAPGFYSRQDIKTPVKIAIITLIL 411


>gi|259908819|ref|YP_002649175.1| Virulence factor MviN, possible MOP Superfamliy efflux pump
           [Erwinia pyrifoliae Ep1/96]
 gi|224964441|emb|CAX55950.1| Virulence factor MviN, possible MOP Superfamliy efflux pump
           [Erwinia pyrifoliae Ep1/96]
 gi|283478801|emb|CAY74717.1| integral membrane protein mviN homolog [Erwinia pyrifoliae DSM
           12163]
          Length = 512

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQIEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FY+R D+KTP K  + +++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIKTPVKIALFTLL 392


>gi|219681693|ref|YP_002468079.1| virulence factor MviN-like protein [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219624536|gb|ACL30691.1| virulence factor MviN-like protein [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 511

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 5/170 (2%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           + I+LE K+    L +  +   L   +P + IL  L K +I  L++ G FT  D ++ + 
Sbjct: 297 NGIKLEYKK----LLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTAR 352

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIAT 129
            L +YS  ++ F+  ++L S FYA  ++K P K  + ++++  ++   L  +    G+A 
Sbjct: 353 VLKLYSCGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGLAL 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           +     WVN + L   L +R+ + L       I+ I +S+ +M + I+FF
Sbjct: 413 SLSISSWVNFLLLYRKLYQRKIVSLQRSEFIFIIYIILSTLVM-IVILFF 461


>gi|313888107|ref|ZP_07821781.1| integral membrane protein MviN [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845797|gb|EFR33184.1| integral membrane protein MviN [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 536

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 95/185 (51%), Gaps = 10/185 (5%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P L+  +   + +   ++ N +++ VLF  +P T  L++L + II+  + RG+FTA
Sbjct: 291 AIVFPILTRTLGSGDMKLGKKVMNASVKTVLFITVPATVGLIILARPIIEIAFVRGSFTA 350

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            + +  +S L  YS  ++   +  VL   +Y+  D KTP  FY+   V   +I +GL   
Sbjct: 351 ANGVAATSTLRCYSLSLISISVINVLNRIYYSIGDTKTP--FYVG--VTNVIINVGLNLL 406

Query: 122 I----GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFI 176
           +    G  G+A A VS      + ++  LLKR+  +L  ++ I  ++   ++S +MG   
Sbjct: 407 VARHFGTNGLA-ASVSIATTIAVFISFILLKRKIGNLGTRSYIKALIKTVMASLVMGAIT 465

Query: 177 VFFKP 181
           + + P
Sbjct: 466 LAYFP 470


>gi|227485283|ref|ZP_03915599.1| virulence factor MviN [Anaerococcus lactolyticus ATCC 51172]
 gi|227236743|gb|EEI86758.1| virulence factor MviN [Anaerococcus lactolyticus ATCC 51172]
          Length = 523

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ PK++S  Q    ++     + A+   +   IP T  + +L   II+ +++R AFT+ 
Sbjct: 280 AIFPKIASLGQSGQIKEMKASISSAVVTTMSLVIPATIGMTVLSAPIIELIFQRNAFTSD 339

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DTI+V+S LS Y+  I+   LS V+   FYA  D KTP    ++  V+  ++   L    
Sbjct: 340 DTIIVASLLSAYAPYIIFQSLSDVVDRGFYAVGDSKTPVIIVVIQQVLNVILNFVLIKIF 399

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPF---QTIYRILSIFISSGLMG 173
              G+A A V    + ++ +   L K R     F   QT+  +  I +++GLM 
Sbjct: 400 DIQGLAYATVVSTALGSMMM---LYKFRANFGSFNLRQTLLSLGKIIVATGLMA 450


>gi|303257097|ref|ZP_07343111.1| integral membrane protein MviN [Burkholderiales bacterium 1_1_47]
 gi|302860588|gb|EFL83665.1| integral membrane protein MviN [Burkholderiales bacterium 1_1_47]
          Length = 516

 Score = 58.9 bits (141), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 106/215 (49%), Gaps = 4/215 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A       + + L +  ++ V+ F +P    L +L + ++  L++   F   D
Sbjct: 290 LLPSLSAAFAKGMTDRYNALLDWGLKLVVAFAVPAAIGLALLGEGLVSVLFQSSRFNVND 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ +  YS  ++G +  ++L   FYA+ D+KTP K    ++++  +  +   P   
Sbjct: 350 VYQTATAVMGYSIGLIGLIGIKILAPGFYAQKDIKTPVKVACAALIVTQIFNLVNVPLFS 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVFFKP- 181
             G+A +       N  CL + +L+RR +  P     ++ L++ + S L+  +++  +  
Sbjct: 410 HAGLALSVGLGACFNACCLLI-ILRRRGVFTPLAGWKKLFLTVILGSVLLTAYLLVIQHY 468

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
           C + Q++   A      L ++ +GA ++Y+ ++++
Sbjct: 469 CDWTQMAYPWAVKLGLVLGVV-AGAAVLYIGTLAV 502


>gi|225621480|ref|YP_002722739.1| integral membrane protein MviN [Brachyspira hyodysenteriae WA1]
 gi|225216301|gb|ACN85035.1| integral membrane protein MviN, putative virulence factor
           [Brachyspira hyodysenteriae WA1]
          Length = 537

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS  I    K ++ E    ++  V    IP T   ++L +EI++ ++E GAF+++ 
Sbjct: 300 MLPTLSKLIADNKKDEAVENLGYSLRLVALVTIPATFGFVVLGREIVRMIFEYGAFSSKS 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           T LVSS L   S  +      R+L+  FYA  D+KTP
Sbjct: 360 TYLVSSALRYLSISLFFVASYRILVQSFYAMKDMKTP 396


>gi|52425810|ref|YP_088947.1| MviN protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307862|gb|AAU38362.1| MviN protein [Mannheimia succiniciproducens MBEL55E]
          Length = 523

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 98/217 (45%), Gaps = 9/217 (4%)

Query: 4   LLPKLS-SAIQLENKQQSSELRNRA-----IEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           +LP LS   +   +  Q S    RA     +  +L  G+P T  + +L + ++  L+ RG
Sbjct: 296 ILPTLSRQHVNRADDVQKSAADFRATMDWGVRMILLLGVPATIGIAVLAQPMLLVLFMRG 355

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
            F+  D    S  L   +  ++ F+L ++L + +YAR D KTP K  I++++   V  + 
Sbjct: 356 QFSLTDVQATSYALWSINVGLLSFMLIKILANGYYARQDTKTPVKIGIIAMISNMVFNLL 415

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
             PF    G+A A      +N   L   L K        Q+    L +  ++ +MG  + 
Sbjct: 416 AIPF-SYVGLAMASAMSATLNAYLLYRGLAKADVYCFTKQSAVFFLKVLAAALVMGTVVW 474

Query: 178 FFKPCL--FNQLSAETAFSPFKNLAIILSGAVLVYLC 212
           +F P L  +N+++  T       L +I + + L+ L 
Sbjct: 475 YFSPQLVIWNEMAFLTKVIRLAELILIAASSYLLMLV 511


>gi|149928097|ref|ZP_01916344.1| hypothetical protein LMED105_15149 [Limnobacter sp. MED105]
 gi|149823183|gb|EDM82420.1| hypothetical protein LMED105_15149 [Limnobacter sp. MED105]
          Length = 519

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 61/124 (49%), Gaps = 1/124 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A    + ++ S L +  +   +   +P    + +    ++  L+  G F A D
Sbjct: 294 LLPSLSAAAT-RSHEEYSRLMDWGLRLTVVLVLPAAVGMGLFSDALVALLFHYGRFDAND 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  +  YS  + G +L ++L   FYA+ D++TP K  I+ +V   V+ +   P +G
Sbjct: 353 VAMTSQAVIAYSLGLAGLVLVKILAPGFYAKQDIRTPVKIGIMVVVATQVMNLLTVPLLG 412

Query: 124 GYGI 127
             G+
Sbjct: 413 HAGL 416


>gi|152979789|ref|YP_001354210.1| virulence factor MviN [Janthinobacterium sp. Marseille]
 gi|151279866|gb|ABR88276.1| MviN, virulence factor (MOP family) [Janthinobacterium sp.
           Marseille]
          Length = 516

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    N ++ S L +  +       +PC   L  + + +  TL+  G F    
Sbjct: 291 LLPSLSKANFEGNTEEYSSLLDWGLRLTFLLALPCAVGLATISEPLTATLFHYGKFNELS 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  Y   ++G +L ++L   FYA+ ++KTP K  I  ++   ++ +   P+I 
Sbjct: 351 VEMTSRALVAYGVGLIGLILVKILAPGFYAQQNIKTPVKIAIGVLIATQLMNLVFVPWIA 410

Query: 124 GYGIA 128
             G+A
Sbjct: 411 HAGLA 415


>gi|104783648|ref|YP_610146.1| virulence factor MviN family protein [Pseudomonas entomophila L48]
 gi|95112635|emb|CAK17363.1| putative virulence factor MviN family [Pseudomonas entomophila L48]
          Length = 512

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G FTA D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFTAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP +  I ++V
Sbjct: 347 AAMTQRALIAYSVGLLAIILVKVLAPGFYAQQNIRTPVRIAIFTLV 392


>gi|308063718|gb|ADO05605.1| virulence factor MviN [Helicobacter pylori Sat464]
          Length = 486

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 4/120 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFT 60
           AL P  S AI ++N QQ   L      +    G+   C+   +ML KEI + L+ERG F+
Sbjct: 295 ALFP--SIAIAIKNNQQDLILERLQKAWFFLVGVLLLCSIGGIMLNKEITELLFERGQFS 352

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT++ S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 353 PKDTLITSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|158522338|ref|YP_001530208.1| integral membrane protein MviN [Desulfococcus oleovorans Hxd3]
 gi|158511164|gb|ABW68131.1| integral membrane protein MviN [Desulfococcus oleovorans Hxd3]
          Length = 528

 Score = 58.9 bits (141), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 2/135 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP +S      +     +    ++  +LF   P  A L++L + I+  L+ERG F AQ
Sbjct: 293 AVLPSISRQAAAGDFDAVKDTFGYSMRMILFISFPSMAGLIVLREPIVALLFERGGFDAQ 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PF 121
            T L +  L  Y   +  F   R+++S FYA +D KTP    +++I +   +++ L  P 
Sbjct: 353 ATRLTADALFYYVAGLWAFSAVRIVVSTFYALSDTKTPVVMAVIAICINAALSLILMGPL 412

Query: 122 I-GGYGIATAEVSWV 135
             GG  +AT+  S V
Sbjct: 413 AHGGLALATSIASMV 427


>gi|312622824|ref|YP_004024437.1| integral membrane protein mvin [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312203291|gb|ADQ46618.1| integral membrane protein MviN [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 518

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 103/233 (44%), Gaps = 26/233 (11%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     A+  ++   +P     ++L KEI + +Y+RG FT + T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSAVNSIILMMMPFAIGGIILSKEITRLIYQRGNFTIESTL 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  Y    VG  L  +L    Y   D KT  K  +++IV   ++ I         
Sbjct: 351 LTASPLMFYCLGFVGLGLRDMLNRTLYVLKDSKTAVKNGVIAIVCNIILDIIFIHKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKP 181
           G A A  S  ++  + L ++L K+    L      RI  +F    ++S +MG+F+  FK 
Sbjct: 411 GAAMAFASANYIAAVLLFISLRKK----LGSIGWKRIAGVFVKALVASLVMGVFVYAFKQ 466

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
             F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 467 K-FIYLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|171464066|ref|YP_001798179.1| integral membrane protein MviN [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171193604|gb|ACB44565.1| integral membrane protein MviN [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 517

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 69/146 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   ++   + EL    ++       PC   L +  + +   LY  G F A D
Sbjct: 293 LLPSLSKANAKKDLAHAGELLIWGLQLTFLLAAPCALALFIFGEPLAAVLYHYGKFNALD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++    L+ Y   ++G +L ++L   FY+R D++TP K  +  +V   +  +   P++G
Sbjct: 353 VLMTQRALAAYGVGLIGLILVKILAPGFYSRQDIRTPVKIGLFVLVATQLANLVFVPWLG 412

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +  S   +N   L V L +R
Sbjct: 413 HAGLALSVGSGACLNAALLWVGLHRR 438


>gi|17227681|ref|NP_484229.1| hypothetical protein all0185 [Nostoc sp. PCC 7120]
 gi|17135163|dbj|BAB77709.1| all0185 [Nostoc sp. PCC 7120]
          Length = 554

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L   +   +L+ R  + +L   +   P  A+L+ L   I+Q +YERGAF 
Sbjct: 319 LLPLLPIFAKLAEPENWPDLKLRIRQGLLLTAVTMLPLGALLISLSVPIVQVVYERGAFK 378

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + T LVSS L  Y   +  +L   VL+  FYA  D +TP +  I +I++  V+   L  
Sbjct: 379 QEATQLVSSLLVAYGIGMFAYLGRDVLVRVFYALGDGQTPFRISIFNILLNAVLDWFLVK 438

Query: 121 FIGGYGIATAEVS 133
             G  G+  A V 
Sbjct: 439 PFGAPGLVLATVG 451


>gi|325479891|gb|EGC82976.1| putative integral membrane protein MviN [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 508

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 97/200 (48%), Gaps = 15/200 (7%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           IP T  +++L   II+  +ER AFT+ DT++VSS ++ Y+  I+   + +V  + FY+  
Sbjct: 313 IPATLGMMVLASPIIKLAFERNAFTSSDTMIVSSLMAAYAPYIIFVSVIKVFSNAFYSIG 372

Query: 96  DVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKR---RQI 152
           + K P    ++   + F++   +  F G  G+A A      + +  +  A  +R      
Sbjct: 373 ESKIPVLVVLIQQTINFILNFVMIKFSGINGLAYATSISNALGSFMIIFAFYRRFGKLST 432

Query: 153 DLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLC 212
           +  F+ I ++++  I   L   FI       FN+  +    +    +AIILSG + + L 
Sbjct: 433 EDNFKAILKVVAASIVMSLAAYFI-------FNKFVSHLGSNISLLIAIILSGFIYIVLV 485

Query: 213 SISLL-----LGKGFLASLK 227
           SIS +     L +GFL  +K
Sbjct: 486 SISKIKEVEYLKEGFLKKIK 505


>gi|167031663|ref|YP_001666894.1| integral membrane protein MviN [Pseudomonas putida GB-1]
 gi|166858151|gb|ABY96558.1| integral membrane protein MviN [Pseudomonas putida GB-1]
          Length = 512

 Score = 58.5 bits (140), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP K  I ++V
Sbjct: 347 AAMTQRALMAYSVGLLAIILVKVLAPGFYAQQNIRTPVKIAIFTLV 392


>gi|312128011|ref|YP_003992885.1| integral membrane protein mvin [Caldicellulosiruptor hydrothermalis
           108]
 gi|311778030|gb|ADQ07516.1| integral membrane protein MviN [Caldicellulosiruptor hydrothermalis
           108]
          Length = 518

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 103/233 (44%), Gaps = 26/233 (11%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     A+  ++   +P     ++L KEI + +Y+RG FT + T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSAVNSIILIMMPFAIGGIILSKEITRLIYQRGNFTIESTL 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  Y    VG  L  +L    Y   D KT  K  +++IV   ++ I         
Sbjct: 351 LTASPLMFYCLGFVGLGLRDMLNRTLYVLKDSKTAVKNGVIAIVCNIILDIIFIHKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKP 181
           G A A  S  ++  + L ++L K+    L      RI  +F    ++S +MG+F+  FK 
Sbjct: 411 GAAMAFASANYIAAVLLFISLRKK----LGSIGWKRIAGVFVKALVASLVMGVFVYAFKQ 466

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
             F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 467 K-FIYLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|167856016|ref|ZP_02478761.1| virulence factor-like MviN [Haemophilus parasuis 29755]
 gi|167852855|gb|EDS24124.1| virulence factor-like MviN [Haemophilus parasuis 29755]
          Length = 523

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 82/182 (45%), Gaps = 4/182 (2%)

Query: 5   LPKLSSAIQLENKQQS---SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++    L  +Q+     +  +  +  VL  GIP    +++L + ++ T++  G F  
Sbjct: 300 LSRIAKQKDLTEEQRKFNFEQTMDWGVRMVLLLGIPAMVGMMILAQPLMMTMFMHGKFQL 359

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D I  S  L +    ++ ++L  +L + FYA  + KTP K  +++ V      +   PF
Sbjct: 360 NDVIASSQALFVMCFGLISYMLISILANGFYANQNTKTPVKIGMIAAVSNICFGVLAIPF 419

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      VN   L   L ++    +   T    L + I++ +MG  + +F P
Sbjct: 420 -GFIGLAMASALSATVNAGLLYRGLSQKGIYKVTTTTAIFTLKLLIAACVMGALVSYFSP 478

Query: 182 CL 183
            L
Sbjct: 479 DL 480


>gi|325479657|gb|EGC82749.1| integral membrane protein MviN [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 511

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 70/140 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL PK++   QL   +Q  E  + ++   +   IP +  + +L + II  ++ER AFT  
Sbjct: 280 ALFPKIAELGQLGKIEQMKERISSSVVSTMLLIIPASIGMAVLSEPIIGVVFERNAFTRN 339

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DTI+V++ L+ Y+   +   +  V+   FYA  D KTP    ++   +  +  + +  F 
Sbjct: 340 DTIIVAALLTAYAPNNIFQSIVDVVDRGFYAVGDSKTPVIVVLIQQFLNVIFNLIMIKFF 399

Query: 123 GGYGIATAEVSWVWVNTICL 142
           G  G+A A V    V T+ +
Sbjct: 400 GIEGLAYATVLSTAVGTVLM 419


>gi|225848551|ref|YP_002728714.1| integral membrane protein MviN [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644132|gb|ACN99182.1| integral membrane protein MviN [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 504

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 84/174 (48%), Gaps = 9/174 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALL  LS      N Q   +    + +  +F  +P  A ++ L KEII  L  RGAFT +
Sbjct: 281 ALLVSLSKYYAEGNIQAFKKDLTLSFKVSIFISLPAMAGMIFLGKEIIDLLLVRGAFTEK 340

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D +L    L  Y+  ++G+  +R   S F+A  D KTP    I+ ++     A+  F F+
Sbjct: 341 DAVLTYYALVGYAIGLLGYAFTRPFKSAFFAVGDTKTPLVSTIVGLLSSMFFAV-FFTFV 399

Query: 123 ---GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIY-RILSIFISSGLM 172
                +G+A A     +VN+I L      + Q +L  ++I+   + + IS+ +M
Sbjct: 400 LKWEVFGLALASSLGAYVNSIYLYF----KYQYELDLKSIFISFVKVLISTSVM 449


>gi|311086069|gb|ADP66151.1| virulence factor MviN-like protein [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086641|gb|ADP66722.1| virulence factor MviN-like protein [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087226|gb|ADP67306.1| virulence factor MviN-like protein [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087745|gb|ADP67824.1| virulence factor MviN-like protein [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 511

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 5/170 (2%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           + I+LE K+    L +  +   L   +P + IL  L K +I  L++ G FT  D ++ + 
Sbjct: 297 NGIKLEYKK----LLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTAR 352

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIAT 129
            L +YS  ++ F+  ++L S FYA  ++K P K  + ++++  ++   L  +    G+A 
Sbjct: 353 VLKLYSFGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGLAL 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           +     WVN + L   L +R+ + L       I+ I +S+ +M + I+FF
Sbjct: 413 SLSISSWVNFLLLYWKLYQRKIVSLQRSEFIFIIYIILSTLVM-IVILFF 461


>gi|219682248|ref|YP_002468632.1| virulence factor MviN-like protein [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219621981|gb|ACL30137.1| virulence factor MviN-like protein [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
          Length = 511

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 5/170 (2%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           + I+LE K+    L +  +   L   +P + IL  L K +I  L++ G FT  D ++ + 
Sbjct: 297 NGIKLEYKK----LLDWGLRISLIVSLPGSVILFFLAKPVIIVLFQYGKFTDFDVLMTAR 352

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIAT 129
            L +YS  ++ F+  ++L S FYA  ++K P K  + ++++  ++   L  +    G+A 
Sbjct: 353 VLKLYSFGLISFIFVKILSSAFYACEEIKIPMKASLFTLLLNQLMNPFLIFYFQHAGLAL 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
           +     WVN + L   L +R+ + L       I+ I +S+ +M + I+FF
Sbjct: 413 SLSISSWVNFLLLYWKLYQRKIVSLQRSEFIFIIYIILSTLVM-IVILFF 461


>gi|319792291|ref|YP_004153931.1| integral membrane protein mvin [Variovorax paradoxus EPS]
 gi|315594754|gb|ADU35820.1| integral membrane protein MviN [Variovorax paradoxus EPS]
          Length = 527

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+LSSA   ++  + S L +  +  V+    PC   LL+  + ++  L+  GAF  +D
Sbjct: 304 LMPQLSSARAAKDDARYSALLDWGLRLVVLLSAPCAIALLLFAQPLVAVLFHNGAFGDED 363

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   +VG +  ++L   +YA+ D +TP    +  +V   V+   L P + 
Sbjct: 364 VKRTTLALMGYGVGLVGIVAIKILAPGYYAKQDTRTPMLIAVGVLVFTQVLNFFLVPVLQ 423

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
              +         VN   L V L++R
Sbjct: 424 HAALTLTIAIGALVNATWLLVGLVRR 449


>gi|299143275|ref|ZP_07036355.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 386
           str. F0131]
 gi|298517760|gb|EFI41499.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 386
           str. F0131]
          Length = 524

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 90/181 (49%), Gaps = 10/181 (5%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P +S A   ++      + N +++ VLF  +P T  +L+L + I+   +  G FT Q+ I
Sbjct: 288 PTMSRAFGNKDMIHGKRVMNASVKTVLFLTVPATIGMLILARPIVDVAFFHGKFTLQNAI 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI--- 122
             ++ L  Y+  ++   LS VL   +Y+  D KTP   +I+ ++    I +GL   +   
Sbjct: 348 DTTATLRFYTLALISISLSNVLNRVYYSIADTKTP---FIIGLI-NVSINVGLNLLVAHK 403

Query: 123 -GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT-IYRILSIFISSGLMGMFIVFFK 180
            G  G+A A VS      + ++  LL+ +  +L  ++ +  ++   +SS  MG+F + + 
Sbjct: 404 FGTRGLA-ASVSIATTVAVLISFILLREKIGNLGIKSYVKALVKTLMSSTAMGIFCLIYF 462

Query: 181 P 181
           P
Sbjct: 463 P 463


>gi|190571052|ref|YP_001975410.1| integral membrane protein MviN [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019573|ref|ZP_03335379.1| integral membrane protein MviN [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357324|emb|CAQ54753.1| integral membrane protein MviN [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994995|gb|EEB55637.1| integral membrane protein MviN [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 498

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 110/229 (48%), Gaps = 12/229 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S   ++ + +   +++N+A+   L   +P TA  +++P  I+ TL+  G F    
Sbjct: 277 LLPMISK--RINDTENIVKIQNKALNIGLILIMPITAAFIIIPDMILLTLFSYGRFDYYA 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  L  +S  +  F++++VLL  F+AR  +K P  F +  + +  ++ + L     
Sbjct: 335 VQQTVPTLVAFSLSLPAFIINKVLLPTFFARGKLKIPTMFSLTCLGINVILNLLLMNKYQ 394

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W+N+I L   L   +   L    +  I+ I  ++ +M   IV +   L
Sbjct: 395 HIGIAIATSISTWINSILLINYLTINKMYKLSQALLLNIVKILTATLVMS--IVLY---L 449

Query: 184 FNQLSA----ETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKY 228
            N LSA    +   +    L  +++ +V++Y  ++ L+  +G L +LKY
Sbjct: 450 SNYLSAGLFFDRGLARIVYLVTLIALSVIIYSSTLYLIF-RGNLNNLKY 497


>gi|325110892|ref|YP_004271960.1| integral membrane protein MviN [Planctomyces brasiliensis DSM 5305]
 gi|324971160|gb|ADY61938.1| integral membrane protein MviN [Planctomyces brasiliensis DSM 5305]
          Length = 541

 Score = 58.5 bits (140), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 61/127 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L  +L+   +  +++Q +E     I      G+P +  L+++   +   L+  GAF A+D
Sbjct: 314 LFAELARHAEAGDRKQLAEDVQTGIRLSWLIGLPASVGLVLIAGPLTDCLFRHGAFDAED 373

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  ++ Y T I  +L    L   FYA  D +TP +  I+++ +  V+   L   IG
Sbjct: 374 VKQTAGTVAAYGTAIWAYLGISALQRVFYALEDARTPMRLGIVAVAINVVLNFVLLFTIG 433

Query: 124 GYGIATA 130
           G G+A A
Sbjct: 434 GVGLAYA 440


>gi|219871503|ref|YP_002475878.1| MviN virulence factor [Haemophilus parasuis SH0165]
 gi|219691707|gb|ACL32930.1| MviN virulence factor [Haemophilus parasuis SH0165]
          Length = 514

 Score = 58.5 bits (140), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 4/182 (2%)

Query: 5   LPKLSSAIQLENKQQS---SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           L +++    L  +Q+     +  +  +  VL FGIP    +++L + +I T++  G F  
Sbjct: 291 LSRIAKQKDLTEEQRKFNFEQTMDWGVRMVLLFGIPAMIGMMILAQPLIMTMFMHGKFQL 350

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D I  S  L +    ++ ++L  +L + FYA  + KTP K  +++ V      +   PF
Sbjct: 351 NDVIASSQALFVMCFGLISYMLISILANGFYANQNTKTPVKIGMIAAVSNICFGVLAIPF 410

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
            G  G+A A      VN   L   L ++    +   T    L + I++ +MG  + +F P
Sbjct: 411 -GFIGLAMASALSAAVNAGLLYRGLAQKGIYKVTTTTAIFTLKLLIAACVMGALVSYFSP 469

Query: 182 CL 183
            L
Sbjct: 470 DL 471


>gi|159896824|ref|YP_001543071.1| integral membrane protein MviN [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159889863|gb|ABX02943.1| integral membrane protein MviN [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 613

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           + P+LS      + +  ++     +  VL+  IP  A L+ML   I+Q L++RG F +Q 
Sbjct: 324 MFPQLSRLDAAGDHEGFNQTTRNTLGTVLWAIIPAAAGLIMLATPIVQVLFQRGNFDSQS 383

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           T+ V   L +Y+T +  F  + +L+  FYAR +   P    ++++ +
Sbjct: 384 TLWVVQALMMYATALPAFGAAEILIRGFYARQETTIPVVIGVVTVAL 430


>gi|320161992|ref|YP_004175217.1| hypothetical protein ANT_25910 [Anaerolinea thermophila UNI-1]
 gi|319995846|dbj|BAJ64617.1| hypothetical membrane protein [Anaerolinea thermophila UNI-1]
          Length = 526

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 2/117 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP  S+   L    +       A+  VLF  +P    L+++   +I+ LYE G+FTAQ
Sbjct: 295 AALPTFSTQAALGKWDELRSALAGALRGVLFLSLPAAVGLILIRTPLIRLLYESGSFTAQ 354

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
            T +V+  L  Y+  +    L  V++  FYA +D +TP    +  + MG  IA+  F
Sbjct: 355 STKMVTWALLWYAVGLPAHCLLEVIVRAFYALHDTRTPVGVGV--VAMGLNIALSFF 409


>gi|240081556|ref|ZP_04726099.1| MviN [Neisseria gonorrhoeae FA19]
 gi|240118793|ref|ZP_04732855.1| MviN [Neisseria gonorrhoeae PID1]
 gi|268597653|ref|ZP_06131820.1| virulence factor MviN [Neisseria gonorrhoeae FA19]
 gi|268604505|ref|ZP_06138672.1| virulence factor MviN [Neisseria gonorrhoeae PID1]
 gi|268551441|gb|EEZ46460.1| virulence factor MviN [Neisseria gonorrhoeae FA19]
 gi|268588636|gb|EEZ53312.1| virulence factor MviN [Neisseria gonorrhoeae PID1]
          Length = 512

 Score = 58.2 bits (139), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P  A L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAAGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|239999810|ref|ZP_04719734.1| MviN [Neisseria gonorrhoeae 35/02]
 gi|240014966|ref|ZP_04721879.1| MviN [Neisseria gonorrhoeae DGI18]
 gi|240017414|ref|ZP_04723954.1| MviN [Neisseria gonorrhoeae FA6140]
 gi|240122035|ref|ZP_04734997.1| MviN [Neisseria gonorrhoeae PID24-1]
 gi|268595621|ref|ZP_06129788.1| virulence factor MviN [Neisseria gonorrhoeae 35/02]
 gi|293398080|ref|ZP_06642285.1| integral membrane protein MviN [Neisseria gonorrhoeae F62]
 gi|268549010|gb|EEZ44428.1| virulence factor MviN [Neisseria gonorrhoeae 35/02]
 gi|291611343|gb|EFF40413.1| integral membrane protein MviN [Neisseria gonorrhoeae F62]
 gi|317165101|gb|ADV08642.1| hypothetical protein NGTW08_1685 [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 512

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P  A L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAAGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|59802039|ref|YP_208751.1| hypothetical protein NGO1718 [Neisseria gonorrhoeae FA 1090]
 gi|194099612|ref|YP_002002743.1| MviN [Neisseria gonorrhoeae NCCP11945]
 gi|240113835|ref|ZP_04728325.1| MviN [Neisseria gonorrhoeae MS11]
 gi|240116569|ref|ZP_04730631.1| MviN [Neisseria gonorrhoeae PID18]
 gi|240124333|ref|ZP_04737289.1| MviN [Neisseria gonorrhoeae PID332]
 gi|240126544|ref|ZP_04739430.1| MviN [Neisseria gonorrhoeae SK-92-679]
 gi|254494593|ref|ZP_05107764.1| virulence factor MviN [Neisseria gonorrhoeae 1291]
 gi|260439670|ref|ZP_05793486.1| MviN [Neisseria gonorrhoeae DGI2]
 gi|268599904|ref|ZP_06134071.1| virulence factor MviN [Neisseria gonorrhoeae MS11]
 gi|268602239|ref|ZP_06136406.1| virulence factor MviN [Neisseria gonorrhoeae PID18]
 gi|268682959|ref|ZP_06149821.1| virulence factor MviN [Neisseria gonorrhoeae PID332]
 gi|268685125|ref|ZP_06151987.1| virulence factor MviN [Neisseria gonorrhoeae SK-92-679]
 gi|291042910|ref|ZP_06568651.1| virulence factor mviN [Neisseria gonorrhoeae DGI2]
 gi|59718934|gb|AAW90339.1| putative virulence factor MviN protein [Neisseria gonorrhoeae FA
           1090]
 gi|193934902|gb|ACF30726.1| MviN [Neisseria gonorrhoeae NCCP11945]
 gi|226513633|gb|EEH62978.1| virulence factor MviN [Neisseria gonorrhoeae 1291]
 gi|268584035|gb|EEZ48711.1| virulence factor MviN [Neisseria gonorrhoeae MS11]
 gi|268586370|gb|EEZ51046.1| virulence factor MviN [Neisseria gonorrhoeae PID18]
 gi|268623243|gb|EEZ55643.1| virulence factor MviN [Neisseria gonorrhoeae PID332]
 gi|268625409|gb|EEZ57809.1| virulence factor MviN [Neisseria gonorrhoeae SK-92-679]
 gi|291013344|gb|EFE05310.1| virulence factor mviN [Neisseria gonorrhoeae DGI2]
          Length = 512

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P  A L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAAGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|300690574|ref|YP_003751569.1| Virulence factor MVIN-like, inner membrane protein [Ralstonia
           solanacearum PSI07]
 gi|299077634|emb|CBJ50270.2| Virulence factor MVIN-like, inner membrane protein [Ralstonia
           solanacearum PSI07]
          Length = 503

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    ++++ S L +  +   +   +P    L +    +  TL+  G F   D
Sbjct: 278 LLPSLSKASAENHREEYSSLLDWGLRLTVLLAVPSAVALFIFGGPLTATLFHYGRFNGLD 337

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYAR D++TP K  ++ + +  +  +   P  G
Sbjct: 338 VEMTRQALVSYGVGLIGLIVIKILAPGFYARQDIRTPVKIALVVLAVTQLSNMVFVPMFG 397

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N   L + L +R
Sbjct: 398 HAGLALSISFGATINAALLFLGLRRR 423


>gi|325272197|ref|ZP_08138620.1| integral membrane protein MviN [Pseudomonas sp. TJI-51]
 gi|324102663|gb|EGC00087.1| integral membrane protein MviN [Pseudomonas sp. TJI-51]
          Length = 512

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP K  + ++V
Sbjct: 347 AAMTQRALMAYSVGLLAIILVKVLAPGFYAQQNIRTPVKIAVFTLV 392


>gi|163785026|ref|ZP_02179757.1| virulence factor protein [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879704|gb|EDP73477.1| virulence factor protein [Hydrogenivirga sp. 128-5-R1-1]
          Length = 439

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 73/143 (51%), Gaps = 4/143 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALL  LS     +N+    +  N  +   +   +P +  +++L KEII+ L++RG F+  
Sbjct: 221 ALLVSLSKYYAEKNQNAFDKDLNNGLRLAVVISLPASIGMIVLGKEIIEILFQRGQFSQT 280

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT      L  Y+  ++ + L+R   S F+A+ DVKTP    I  I+   + A+ +F FI
Sbjct: 281 DTNYTYQALIGYAVGLLFYTLTRPFKSAFFAKEDVKTPLYSTIAGILGSILFAV-VFVFI 339

Query: 123 ---GGYGIATAEVSWVWVNTICL 142
              G +G+A A  +   +N I L
Sbjct: 340 LNFGVFGLALASSTAGIINLIYL 362


>gi|240129006|ref|ZP_04741667.1| MviN [Neisseria gonorrhoeae SK-93-1035]
 gi|268687387|ref|ZP_06154249.1| virulence factor MviN [Neisseria gonorrhoeae SK-93-1035]
 gi|268627671|gb|EEZ60071.1| virulence factor MviN [Neisseria gonorrhoeae SK-93-1035]
          Length = 512

 Score = 58.2 bits (139), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P  A L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAAGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|307730808|ref|YP_003908032.1| integral membrane protein MviN [Burkholderia sp. CCGE1003]
 gi|307585343|gb|ADN58741.1| integral membrane protein MviN [Burkholderia sp. CCGE1003]
          Length = 516

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F    
Sbjct: 291 LLPSLSKAHVDADPHEYSSLLDWGLRVTFLLAGPSAVALFFFAQPLTATLFHYGKFDGHA 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++V   L+ Y   ++G +L ++L   FYA+ D+KTP K  I  +V+
Sbjct: 351 VVMVGRALAAYGIGLIGIILVKILAPGFYAKQDIKTPVKIGIGVLVL 397


>gi|87198611|ref|YP_495868.1| integral membrane protein MviN [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134292|gb|ABD25034.1| integral membrane protein MviN [Novosphingobium aromaticivorans DSM
           12444]
          Length = 523

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 57/110 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +       + E +NR +E  L   +P T  L++  + I   L+  G F A D
Sbjct: 293 LLPTISRQLGGGEDAAAMETQNRGMELALLLTLPATVALVLCGEPIAAALFGYGKFDALD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           T   +  L+ +S  +  ++L +VL   FYAR D KTP +F  +S+V+  V
Sbjct: 353 THYTAQALAAFSIGLPSYILVKVLTPGFYARQDTKTPVRFATISMVVNLV 402


>gi|42523761|ref|NP_969141.1| virulence factor MviN-like protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39575968|emb|CAE80134.1| virulence factor MviN homolog [Bdellovibrio bacteriovorus HD100]
          Length = 520

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 12/160 (7%)

Query: 2   AALLPKLSSAI--QLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           AA LP +S A     E +       N+ +E + FF IP  A  L+L   I+  +++ G F
Sbjct: 283 AAELPAMSQATGSDEEIRHYLQGRLNKGLEQIAFFIIPSVAGFLILGDLIVGAVFQTGEF 342

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--------MG 111
           TAQ+T  V   L  Y+  ++   L R+  S F++  D +TP +F I+ ++        +G
Sbjct: 343 TAQNTHYVWMVLVGYTVGLLASTLGRLYSSTFFSLKDTRTPLQFAIVRVIFATLLGAMLG 402

Query: 112 FVI--AIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKR 149
           F +  A+G     G  G+  A     W+    L  +L KR
Sbjct: 403 FYVPQALGFDSQWGTVGLTAAAGMAGWIEFYLLRKSLNKR 442


>gi|308273596|emb|CBX30198.1| hypothetical protein N47_D30070 [uncultured Desulfobacterium sp.]
          Length = 540

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 78/162 (48%), Gaps = 16/162 (9%)

Query: 2   AALLPKLSSAIQLENKQQ-SSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           AA LP +S A  L N Q+ ++ LR R    +  + FF +P     L++   I+  +Y+ G
Sbjct: 307 AAELPLMSGA--LGNDQEVANMLRARIDSGLRQIAFFVLPSVVAFLLVGDVIVAAIYQTG 364

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYI----LSIVMGFV 113
            F   D I V   L+  +  ++     R+  S +YA  D KTP +F I    L+ V+G++
Sbjct: 365 KFMRADVIYVWGILAGATVGLLASTFGRLYSSAYYALRDTKTPLRFAIIRVVLTTVLGYL 424

Query: 114 IAIGLFPFIG---GYGIATAEVS---WVWVNTICLAVALLKR 149
            A+ L P IG    +G+A   VS     WV    L   L +R
Sbjct: 425 CAVPLPPAIGISPRWGVAGLTVSAGIAAWVEFALLRRTLNRR 466


>gi|229843975|ref|ZP_04464116.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae 6P18H1]
 gi|229812969|gb|EEP48657.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae 6P18H1]
          Length = 524

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSDKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|189184016|ref|YP_001937801.1| virulence factor MviN [Orientia tsutsugamushi str. Ikeda]
 gi|189180787|dbj|BAG40567.1| virulence factor MviN [Orientia tsutsugamushi str. Ikeda]
          Length = 504

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 4/211 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+LS   +     ++  L+ + I    F  +P   ++ ML   I + +Y+ GAFT ++
Sbjct: 284 LLPELSKLYKQGLVDKAIILQKKTINISCFLALPAAVVIGMLSYPIAELVYQHGAFTQEN 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   S  ++I +  +  ++L++V+   FYA  D KTP K  + S ++   ++I    F  
Sbjct: 344 TQKTSLVIAISAFGLPTYILAKVITPAFYANCDTKTPMKIAVCSSLLNITLSIFFAQFFD 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP-C 182
              I  +    +  N I + +A  K         T   IL + +S  +M + I +     
Sbjct: 404 YISIVLSNAISLLANIIFVLIAANKFSYYKFTKATAVFILKLLVSCVIMAITIYYLNNVV 463

Query: 183 LFNQLSAETAFSPFKNLAIILSGAVLVYLCS 213
           L+N+      F  F  L  I +G  LVYL S
Sbjct: 464 LYNK--TTLLFKIFSLLICIAAGG-LVYLVS 491


>gi|148244660|ref|YP_001219354.1| virulence factor MviN [Candidatus Vesicomyosocius okutanii HA]
 gi|146326487|dbj|BAF61630.1| virulence factor MviN [Candidatus Vesicomyosocius okutanii HA]
          Length = 508

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 17/221 (7%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           L KLS     +N ++  +  + A+   L  G+P    L++L K +I TL++   F A   
Sbjct: 291 LAKLSHHFTDKNHEKFLQTIDNALTIGLLLGLPACVGLILLAKPLIITLFQYDQFDAFAA 350

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
           +  S  L  Y + ++ F+  +VL   F +  D KTP K  I+++V    + I L  +   
Sbjct: 351 LQSSLSLMAYGSGLMAFIFVKVLAPIFLSIGDTKTPVKAGIIAMVSNIFLNIILGFYFAH 410

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLP---FQTIYRILSIFISSGLMGMFIVFFKP 181
            G+A A      +N   L   L K+   ++    +QT ++ L   +SS +M +FI+ FK 
Sbjct: 411 VGLAIATSISALINASLLYFYLNKQSIFNISKNLYQTFFKAL---VSSFIMAIFILIFKS 467

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLV-----YLCSISLL 217
                  AE       N  IIL G  +V     Y  S+ LL
Sbjct: 468 ------EAELYLRASVNSRIILLGTTIVLSSIIYFSSLKLL 502


>gi|34499203|ref|NP_903418.1| inner membrane virulence factor protein [Chromobacterium violaceum
           ATCC 12472]
 gi|34105054|gb|AAQ61410.1| inner membrane virulence factor protein [Chromobacterium violaceum
           ATCC 12472]
          Length = 497

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++  + S L +  I   L   +P T  L +L   ++ T++  G FTA D
Sbjct: 273 LLPSLSKHAASKSDAEFSVLLDWGIRLSLLLAVPATVGLGLLSGPLLYTMFMYGKFTAHD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            ++    +  YS  ++G +L +VL   FYAR D+KTP +  + +++
Sbjct: 333 ALMSQQAVIAYSFGLLGLILVKVLAPGFYARQDIKTPVRIAVATLI 378


>gi|120601364|ref|YP_965764.1| integral membrane protein MviN [Desulfovibrio vulgaris DP4]
 gi|120561593|gb|ABM27337.1| integral membrane protein MviN [Desulfovibrio vulgaris DP4]
          Length = 562

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 67/146 (45%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP L+S       +    L  + +   LF  +P  A L+ +   ++Q L+  GAF A 
Sbjct: 335 ASLPVLASLHAAGRWEHFETLLGQGVRLSLFVTLPAAAGLMAVAHPLVQVLFGHGAFDAA 394

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                 + L  Y+  +  F L R LL+  +AR D +TP    ++S+ +  V  + L   +
Sbjct: 395 AVAGTVTALCAYAPGLPAFALGRTLLAAAHARGDTRTPVLAALVSLAVVLVAGLALSGPL 454

Query: 123 GGYGIATAEVSWVWVNTICLAVALLK 148
           G  G   A     W NT+ L +++++
Sbjct: 455 GVAGPPLAASLGAWCNTLLLHLSIVR 480


>gi|149377784|ref|ZP_01895517.1| integral membrane protein MviN [Marinobacter algicola DG893]
 gi|149357956|gb|EDM46445.1| integral membrane protein MviN [Marinobacter algicola DG893]
          Length = 497

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 104/215 (48%), Gaps = 5/215 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E+  Q +   + A+  VL  G+P    L +L + +I TL+  G  T +D
Sbjct: 275 ILPSLSRKHAAESADQFAATLDWAVRAVLLIGLPAALALALLAEPLIATLFHYGEVTDRD 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPF 121
             + +  L  YS  ++ F+L +VL   ++AR D KTP K  I+++V  M F +A+ +FP 
Sbjct: 335 VTMAAQSLRAYSAGLLAFMLIKVLAPGYFARQDTKTPVKIGIIAMVANMAFNLAL-IFP- 392

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
           +   G+A A     W+NT  L   L++             ++ I +++  +   I++ +P
Sbjct: 393 LAHAGLALATSLSAWLNTALLWRGLIREGAWKWQPGWTRFLVQIGLANAALAAVILWLQP 452

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
            +   L A        ++ I++   V VY   ++L
Sbjct: 453 PVGQWLMA-GGLQRATDMGILVVSGVAVYFIVLAL 486


>gi|260581955|ref|ZP_05849751.1| integral membrane protein MviN [Haemophilus influenzae NT127]
 gi|260095148|gb|EEW79040.1| integral membrane protein MviN [Haemophilus influenzae NT127]
          Length = 524

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|145628098|ref|ZP_01783899.1| 30S ribosomal protein S20 [Haemophilus influenzae 22.1-21]
 gi|145638213|ref|ZP_01793823.1| 30S ribosomal protein S20 [Haemophilus influenzae PittII]
 gi|144979873|gb|EDJ89532.1| 30S ribosomal protein S20 [Haemophilus influenzae 22.1-21]
 gi|145272542|gb|EDK12449.1| 30S ribosomal protein S20 [Haemophilus influenzae PittII]
          Length = 524

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|254495988|ref|ZP_05108895.1| putative virulence factor MviN [Legionella drancourtii LLAP12]
 gi|254354790|gb|EET13418.1| putative virulence factor MviN [Legionella drancourtii LLAP12]
          Length = 525

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 68/147 (46%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  Q S+  +  +  +L  GIP    L +    +I + +  G FT  D
Sbjct: 300 ILPHLSRRHAEQSITQYSQALDWGLRSILLIGIPAGLGLCLFSMPLIVSCFAYGKFTLND 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   ++ +  F++ +VL S FYAR D+ TP K   +S+++  ++   L     
Sbjct: 360 VLQTQKSLITLASGVPAFMMVKVLASGFYARQDISTPVKVGAISMIVNTLLCSILVWHFA 419

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR 150
             G+  A     +VN   L   L+KRR
Sbjct: 420 HAGLTLASALAGYVNCGALLFLLVKRR 446


>gi|148828141|ref|YP_001292894.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae PittGG]
 gi|148719383|gb|ABR00511.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae PittGG]
          Length = 524

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|319775100|ref|YP_004137588.1| putative virulence factor MviN [Haemophilus influenzae F3047]
 gi|317449691|emb|CBY85898.1| Putative virulence factor MviN [Haemophilus influenzae F3047]
          Length = 525

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 311 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 370

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 371 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 424


>gi|145637269|ref|ZP_01792930.1| putative virulence factor MviN [Haemophilus influenzae PittHH]
 gi|145269521|gb|EDK09463.1| putative virulence factor MviN [Haemophilus influenzae PittHH]
          Length = 524

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|316931559|ref|YP_004106541.1| integral membrane protein MviN [Rhodopseudomonas palustris DX-1]
 gi|315599273|gb|ADU41808.1| integral membrane protein MviN [Rhodopseudomonas palustris DX-1]
          Length = 518

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 107/218 (49%), Gaps = 4/218 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A L+P+L+ A++  ++   S+  +R +E  +   +P T  L++L +  ++ L+E GAF+A
Sbjct: 283 AVLVPELARAVRGGDRTALSDAASRGLELAVGVALPATFGLIVLAEPTVRLLFEHGAFSA 342

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
            D+   +  L++ +  +   +L++   + F+AR D  TP    ++S+ +    A+ L   
Sbjct: 343 ADSAATAQALAVLAIGLPAQVLAKNWSAAFFAREDTHTPLMATLISVTVALAAAVVLGRL 402

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR--RQIDLPFQTIYRILSIFISSGLMGMFIVFF 179
            G  G+A A     W N   L    ++R    ID P Q   R++ I +++G MG  +   
Sbjct: 403 FGASGVAVAISLGAWSNAALLLGRGVQRFGVTIDAPAQ--RRLMLIVLAAGAMGALLWQA 460

Query: 180 KPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
              +     A +       LA+++ G V VY  ++ LL
Sbjct: 461 SGFVLPIAVAGSTLVQAAVLAVLVGGGVTVYAAALILL 498


>gi|94311837|ref|YP_585047.1| integral membrane protein MviN [Cupriavidus metallidurans CH34]
 gi|93355689|gb|ABF09778.1| Integral membrane protein MviN; MviN family of virulence factors
           [Cupriavidus metallidurans CH34]
          Length = 534

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   +N+++ S L +  +       +PC A L++    I   L+  G F A  
Sbjct: 309 LLPSLSRASAEDNREEYSGLLDWGLRLTFLLALPCAAGLMLFGTPITSVLFHYGRFDAHA 368

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L+ Y   ++  +L ++L   FYAR D++TP K  IL +++
Sbjct: 369 VEMTQQALTTYGVGLLALILIKILTPGFYARQDIRTPVKIAILVLII 415


>gi|319897522|ref|YP_004135719.1| virulence factor mvin [Haemophilus influenzae F3031]
 gi|317433028|emb|CBY81399.1| putative virulence factor MviN [Haemophilus influenzae F3031]
          Length = 525

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 311 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 370

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 371 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 424


>gi|15606844|ref|NP_214224.1| 'virulence factor' homolog MviB [Aquifex aeolicus VF5]
 gi|7387911|sp|O67658|MVIN_AQUAE RecName: Full=Virulence factor mviN homolog
 gi|2984083|gb|AAC07622.1| virulence factor homolog MviB [Aquifex aeolicus VF5]
          Length = 499

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 86/162 (53%), Gaps = 7/162 (4%)

Query: 14  LENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSI 73
           +  K+   +  + A++  L   IP +  L  L +EI+  LY+RG F+ +D    S  LS+
Sbjct: 285 VSTKKDKEKDTDTALKLTLMLSIPSSFGLFFLSREIVSVLYKRGNFSEEDLFYTSGLLSL 344

Query: 74  YSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVS 133
           Y+  +  + L  +L + +Y++ +V+ P K   LS+ +  +    +F F+  +G+ +  ++
Sbjct: 345 YAFSVPFYSLQHILKTVYYSKKNVEIPTKSAFLSVFLEALFG-SVFIFLLNFGVYSFPLA 403

Query: 134 WVWVNTICLAVALLKR--RQIDLPFQTIYRILSIFISSGLMG 173
            + +++  + V L ++  +++ +PF  + + L   I+S  MG
Sbjct: 404 AL-ISSSSVLVYLYQKLPQKVSIPFGNLIKYL---IASSFMG 441


>gi|42522981|ref|NP_968361.1| putative virulence factor [Bdellovibrio bacteriovorus HD100]
 gi|45477153|sp|Q8VNZ2|MVIN_BDEBA RecName: Full=Virulence factor mviN homolog
 gi|39574177|emb|CAE79354.1| putative virulence factor [Bdellovibrio bacteriovorus HD100]
          Length = 523

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 82/175 (46%), Gaps = 2/175 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           AALLP LS       K++  E    +    LF   P    L +L + II+ L+ RG FT 
Sbjct: 298 AALLPTLSDFANRGLKEKFQETAEESFLMNLFLAWPAALGLYILAEPIIEVLFLRGKFTV 357

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           QD  + ++ L IY+  ++    SRVL+  +Y+  + K P    ++S+ +   +A  L   
Sbjct: 358 QDVQMTAAILRIYAVSLLLVSCSRVLMPLYYSVKNTKVPMVLALVSLAVHVSLAPVLMRQ 417

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
            G  G+  + V    +N + L + LLK+    +    + R    F+ +G  GM I
Sbjct: 418 WGLEGLMISGVVAALINAVLL-MGLLKKYSPGIRMSVLLRPALKFVLAG-AGMVI 470


>gi|301169689|emb|CBW29290.1| predicted inner membrane protein [Haemophilus influenzae 10810]
          Length = 510

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 296 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 356 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 409


>gi|18073060|emb|CAD12355.1| putative mvin protein [Bdellovibrio bacteriovorus]
          Length = 502

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 81/175 (46%), Gaps = 2/175 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           AALLP LS       K++  E    +    LF   P    L +L + II+ L+ RG FT 
Sbjct: 277 AALLPTLSDFASQGLKEKFQETAEESFLMNLFLAWPAALGLYILAEPIIEVLFLRGKFTV 336

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           QD  + ++ L IY+  ++    SRVL+  +Y+  + K P    ++S+     +A  L   
Sbjct: 337 QDVQMTAAILRIYAVSLLLVSCSRVLMPLYYSVKNTKVPMVLALVSLAAHVSLAPVLMRQ 396

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
            G  G+  + V+   +N + L +  LKR    +    + R    F+ +G  GM I
Sbjct: 397 WGLEGLMISGVAAALINAVLL-MGFLKRYSPGIRMSVLLRPALKFVLAG-AGMVI 449


>gi|218961105|ref|YP_001740880.1| hypothetical protein CLOAM0792 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729762|emb|CAO80674.1| conserved hypothetical protein; putative membrane protein
           [Candidatus Cloacamonas acidaminovorans]
          Length = 524

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 1/157 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP  S  +  EN Q+ SE    +   + +  +P T I+L L ++ ++ L+E GAF   
Sbjct: 295 AVLPFYSRCVSTENYQELSESIRFSGLNLAYIMLPVTTIILALGEDFVRILFESGAFQED 354

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
              + S  L  YS  ++ + L++ +   FYA  D KTP K     + +   +   L  F+
Sbjct: 355 AVWMTSQALVFYSLGLIFYGLNQTITPVFYAYKDTKTPVKIAAGMVALNITLNFILMQFM 414

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
              G+A +      VN   L   L++++  ++ F  I
Sbjct: 415 AHRGLALSTSITACVNFFILR-TLIRKKMPEISFSGI 450


>gi|51246251|ref|YP_066135.1| virulence factor (MviN) [Desulfotalea psychrophila LSv54]
 gi|50877288|emb|CAG37128.1| related to virulence factor (MviN) [Desulfotalea psychrophila
           LSv54]
          Length = 530

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP L+    L+   +  E    ++  V    +P T  L+ L + II  ++E GAFTA 
Sbjct: 298 AMLPLLAQQASLKKIDEMKETMTSSLTMVFALTLPATFGLIFLSRPIIMLIFEHGAFTAA 357

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           DT+  +  L +Y+  +  +  +++L+  FYA N  K P
Sbjct: 358 DTMATAQTLGLYAVGLFAYSANKILVPAFYAINKTKYP 395


>gi|309751368|gb|ADO81352.1| Peptidoglycan lipid II flippase [Haemophilus influenzae R2866]
          Length = 510

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 296 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 356 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 409


>gi|209521019|ref|ZP_03269753.1| integral membrane protein MviN [Burkholderia sp. H160]
 gi|209498553|gb|EDZ98674.1| integral membrane protein MviN [Burkholderia sp. H160]
          Length = 516

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 73/180 (40%), Gaps = 13/180 (7%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +   L+  G F    
Sbjct: 291 LLPSLSKAHVDADSHEYSSLLDWGLRVTFLLAAPSAIALFFFAQPLTAVLFNYGKFDGNS 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++VS  L+ Y   ++G ++ ++L   FYA+ D+KTP K  I  +V+  +      P   
Sbjct: 351 VVMVSRALAAYGVGLIGLIMIKILAPGFYAKQDIKTPVKIGIGVLVVTQLSNYVFVPVFA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  +      VN + L +  L++R I +P            SSG +  F      CL
Sbjct: 411 HAGLTLSVGLGACVNALLLFIG-LRKRGIYMP------------SSGWLKFFAQLLGACL 457


>gi|27375914|ref|NP_767443.1| virulence factor [Bradyrhizobium japonicum USDA 110]
 gi|27349052|dbj|BAC46068.1| bll0803 [Bradyrhizobium japonicum USDA 110]
          Length = 510

 Score = 57.8 bits (138), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 4/109 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+L+ A+   ++   +   +RA+E      +P T  L++L + I++ L++ GAF A D
Sbjct: 284 LVPELTRAVTGGDRDAVAHAESRALELATGLALPATLGLIVLAEPIVRLLFQHGAFGADD 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF 112
           +   +  L   +  +   +L + L   FYAR+D  TP    +L+   GF
Sbjct: 344 STATARALMWLALGLPAHVLIKALSPAFYARSDTMTP----LLATAKGF 388


>gi|329122986|ref|ZP_08251557.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Haemophilus aegyptius ATCC 11116]
 gi|327471917|gb|EGF17357.1| MOP superfamily multidrug/oligosaccharidyl-lipid/polysaccharide
           flippase transporter [Haemophilus aegyptius ATCC 11116]
          Length = 510

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +L  G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 296 DSAKSAVDFRNTMDWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 356 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 409


>gi|149194601|ref|ZP_01871697.1| Virulence factor MVIN-like protein [Caminibacter mediatlanticus
           TB-2]
 gi|149135345|gb|EDM23825.1| Virulence factor MVIN-like protein [Caminibacter mediatlanticus
           TB-2]
          Length = 440

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 72/129 (55%), Gaps = 2/129 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L PK++ AI  EN  ++  L  ++  Y+L+       + ++  KEI+  L+ERG FT++D
Sbjct: 258 LFPKITKAISKENFDEAKILMKKSFWYLLYALSLALIVTIIANKEIVSILFERGEFTSKD 317

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
           T + +  L +Y   I+ F L+++  S  YA +     AKF  +S+++  + +I L FP +
Sbjct: 318 TQITAVVLIMYMIGIIPFGLNKLFSSYLYATHKHLKAAKFSAISLIVNIIFSIILIFP-L 376

Query: 123 GGYGIATAE 131
             YG+A A 
Sbjct: 377 KVYGLALAS 385


>gi|297380085|gb|ADI34972.1| integral membrane protein MviN [Helicobacter pylori v225d]
          Length = 486

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 61/114 (53%), Gaps = 2/114 (1%)

Query: 9   SSAIQLENKQQSSELRNRAIEYVLFFGIP--CTAILLMLPKEIIQTLYERGAFTAQDTIL 66
           S AI ++N QQ   L+     +    G+   C    +ML KEI + L+ERG F+ +DT++
Sbjct: 299 SIAIAIKNNQQDLILQRLQKAWFFLVGVLLFCGIGGIMLSKEITELLFERGQFSPKDTLI 358

Query: 67  VSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            S   S+Y   ++ F L+++     YA+ + K  AK  ++S+ +G   ++ L P
Sbjct: 359 TSQVFSLYLLGLLPFGLTKLFSLWLYAKLEQKKAAKISLISLFLGLAASLSLMP 412


>gi|206901162|ref|YP_002250299.1| integral membrane protein MviN [Dictyoglomus thermophilum H-6-12]
 gi|206740265|gb|ACI19323.1| integral membrane protein MviN [Dictyoglomus thermophilum H-6-12]
          Length = 535

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+   L+   Q EN  Q     N+++   LFF IP +  L+ L K I++  +ERGAF A 
Sbjct: 297 AIYTDLAFQAQSENLDQFKLSLNKSLRAALFFLIPASFGLIFLAKPIVRLAFERGAFDAL 356

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
            T   S  L  YS  +V   ++ ++   F+A +D KTP K  I++++   V+
Sbjct: 357 ATKRTSESLIFYSLGLVFMSINMIITRGFFALHDTKTPVKNSIIALLFNIVL 408


>gi|52842841|ref|YP_096640.1| putative virulence factor MviN [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629952|gb|AAU28693.1| integral membrane protein (putative virulence factor) MviN,
           possible role in motility [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 523

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 96/217 (44%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 298 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 358 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFIFVWHLA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN + L   L+KR         +   + + I++  +G+++ F     
Sbjct: 418 HAGLTLASALAGYVNCVILLFLLIKRGLFKPSPGWLKYSMQLLIANFAIGVYLYFMS--- 474

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 475 -GTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 510


>gi|312134759|ref|YP_004002097.1| integral membrane protein mvin [Caldicellulosiruptor owensensis OL]
 gi|311774810|gb|ADQ04297.1| integral membrane protein MviN [Caldicellulosiruptor owensensis OL]
          Length = 518

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 103/233 (44%), Gaps = 26/233 (11%)

Query: 9   SSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           S+   L+ K      R     A+  ++   +P     +++ KEI + +Y+RG FT + T+
Sbjct: 291 STLSNLQAKGDKENFRKFFVSAVNSIILMMMPFAIGGMIMAKEITRLIYQRGNFTTESTL 350

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +S L  Y    VG  L  +L    Y   D KT  K  +++I+   ++ +         
Sbjct: 351 LTASPLMFYCLGFVGLGLRDILNRTLYVLKDSKTAVKNGVIAIICNIILDVIFIHKFKHT 410

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKP 181
           G A A  +  ++  + L ++L K+    L      RI  +F    ++S +MG+F+  FK 
Sbjct: 411 GAAMAFATANYIAAVLLFISLRKK----LGSIGWKRIAGVFVKALVASLVMGVFVYAFKQ 466

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
             F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 467 K-FIYLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|187478598|ref|YP_786622.1| membrane protein [Bordetella avium 197N]
 gi|115423184|emb|CAJ49715.1| putative membrane protein [Bordetella avium 197N]
          Length = 519

 Score = 57.4 bits (137), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A   E++   S L +  +   L  G+P    +++L   ++ TL+  GAF A D
Sbjct: 293 LLPSLSAAHAREDRAAYSALLDWGLRMTLLLGLPAALGMMLLSDGLVATLFHYGAFQASD 352

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
                  +  YS  ++G L  ++L   FYA+ D++TP K  +L +V+
Sbjct: 353 VQQTRLAVIAYSVGLIGLLSVKILAPGFYAKQDIRTPVKIAVLVLVL 399


>gi|304312041|ref|YP_003811639.1| Virulence factor MviN [gamma proteobacterium HdN1]
 gi|301797774|emb|CBL45996.1| Virulence factor MviN [gamma proteobacterium HdN1]
          Length = 520

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 64/125 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP+L+ A    + QQ S+L +  +  VL   +P    LL+  K ++  LY  G F++ D
Sbjct: 297 LLPQLARAQAGADPQQFSKLLDWGLRLVLLLALPSAIALLLFSKPLVSVLYHYGKFSSLD 356

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                S L+ Y   ++G +  +VL   FYA  D++TP K  I  +++  ++ +   P+  
Sbjct: 357 VEKTVSALACYGVGLMGLIGVKVLAPGFYATQDIRTPVKIGIAVLIITQMLNVLFVPYFQ 416

Query: 124 GYGIA 128
             G+A
Sbjct: 417 HAGLA 421


>gi|330722375|gb|EGH00226.1| Proposed peptidoglycan lipid II flippase MurJ [gamma
           proteobacterium IMCC2047]
          Length = 237

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + +Q     + A+  V     P    L +L + +I TL++ GA TAQD
Sbjct: 16  ILPSLSRQHVSASAEQFRATLDWALRLVCLLAFPAALALFVLAEPLITTLFQYGAMTAQD 75

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  ++ F+L +VL   +Y+R D KTP K  I ++V   V+ + L   + 
Sbjct: 76  VEMAAMSLRAYSVGLLAFMLIKVLAPGYYSRQDTKTPVKIGIWAMVANMVMNLILIWPLQ 135

Query: 124 GYGIATA 130
             G+A A
Sbjct: 136 HAGLALA 142


>gi|289548307|ref|YP_003473295.1| integral membrane protein MviN [Thermocrinis albus DSM 14484]
 gi|289181924|gb|ADC89168.1| integral membrane protein MviN [Thermocrinis albus DSM 14484]
          Length = 494

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 6/107 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           +LL  LS    ++N          A+  +L   +P    LL+L + I+  LY RG F++Q
Sbjct: 279 SLLSVLSRGGHIKNNT------TLAVSVILGLSLPSAVGLLLLAEPIVSLLYGRGRFSSQ 332

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           D I+ S  L  YS  +V F + + + S F+AR D KTP    +L+++
Sbjct: 333 DVIVASHVLMAYSLGLVFFSVQKAISSVFFARGDTKTPVMASLLAVM 379


>gi|210622224|ref|ZP_03293014.1| hypothetical protein CLOHIR_00961 [Clostridium hiranonis DSM 13275]
 gi|210154358|gb|EEA85364.1| hypothetical protein CLOHIR_00961 [Clostridium hiranonis DSM 13275]
          Length = 516

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 86/174 (49%), Gaps = 2/174 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           PKL+  I  + K+       ++   +L   +P T   ++L + I++ L++RGAF A+ T 
Sbjct: 284 PKLARMINADKKEDFVNTIVKSSNCILLLVLPITVGAIVLAEPIVRILFQRGAFDAESTN 343

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +  + L +YS  +    +  V+   FY+ +D KTP     +++VM  ++ + L   +G  
Sbjct: 344 MTYNALRLYSLGLAAMGVRDVITRVFYSLSDTKTPMINASIALVMNIIMNLILIKPLGYK 403

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVF 178
           G+A +  S   + T+ L    LK+R        I +  L   +SS +MG+  VF
Sbjct: 404 GLAIST-SIASIVTVMLLFRSLKKRTGYFGGDKIVKTGLKSLVSSVIMGVCTVF 456


>gi|313496976|gb|ADR58342.1| Integral membrane protein MviN [Pseudomonas putida BIRD-1]
          Length = 512

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP K  + ++V
Sbjct: 347 AAMTQRALIAYSVGLLAIILIKVLAPGFYAQQNIRTPVKIAVFTLV 392


>gi|26987338|ref|NP_742763.1| MviN family membrane protein [Pseudomonas putida KT2440]
 gi|24981989|gb|AAN66227.1|AE016251_3 membrane protein, MviN family [Pseudomonas putida KT2440]
          Length = 512

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP K  + ++V
Sbjct: 347 AAMTQRALIAYSVGLLAIILIKVLAPGFYAQQNIRTPVKIAVFTLV 392


>gi|148545892|ref|YP_001265994.1| integral membrane protein MviN [Pseudomonas putida F1]
 gi|148509950|gb|ABQ76810.1| integral membrane protein MviN [Pseudomonas putida F1]
          Length = 512

 Score = 57.4 bits (137), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP K  + ++V
Sbjct: 347 AAMTQRALIAYSVGLLAIILIKVLAPGFYAQQNIRTPVKIAVFTLV 392


>gi|121608741|ref|YP_996548.1| integral membrane protein MviN [Verminephrobacter eiseniae EF01-2]
 gi|121553381|gb|ABM57530.1| integral membrane protein MviN [Verminephrobacter eiseniae EF01-2]
          Length = 521

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P+L++A    + Q  S + +  +  V+   +PC   LL     ++ TL+  G     D
Sbjct: 298 LTPQLTAAKAAGDGQAYSAMLDWGLRIVVLLTVPCAVALLTFSTPLVATLFHHGKLVGSD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
              ++  LS Y T ++G +  +VL   +YA  D+ TP +  +  +V+
Sbjct: 358 VGQIAVALSGYGTGLLGLVAIKVLAPGYYASQDMGTPVRIALAVLVI 404


>gi|149195837|ref|ZP_01872894.1| Virulence factor MVIN-like protein [Lentisphaera araneosa HTCC2155]
 gi|149141299|gb|EDM29695.1| Virulence factor MVIN-like protein [Lentisphaera araneosa HTCC2155]
          Length = 509

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 70/167 (41%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP LSS++   N         +A+    F  IPC+    +L   +++TL+ RGAF  +  
Sbjct: 286 LPSLSSSLAKGNLNDVQRDFEKALSQAFFLSIPCSVFFYLLGDTLLKTLFLRGAFDLESL 345

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
                    +   I  F   +VLLS +YA  + KTP K  +  I +  V+ I   P +  
Sbjct: 346 QFTLKAFLWFLPGIPFFTALKVLLSLYYANKNTKTPLKISLAMITLNLVLGISFIPLLSH 405

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGL 171
             +A A      +N + L  +  K   I    Q +   L   I++ L
Sbjct: 406 ASLAMASSVTALLNFVFLLTSAKKLSYIQNLSQIVQTNLPTIIAASL 452


>gi|78043430|ref|YP_359404.1| integral membrane protein MviN [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77995545|gb|ABB14444.1| integral membrane protein MviN [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 512

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (51%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           +A+ P LS       K +  EL    ++      +P    L++L   I+  L+ERGAF A
Sbjct: 283 SAIFPSLSILAAQGEKTRLLELTRFGLKLSTVISLPAQVGLMVLATPIVAVLFERGAFDA 342

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           + T L +  L  YS  IV ++++ VL   FYA+ND  TP K   L+++
Sbjct: 343 RATELTAGALFFYSLAIVFYVINAVLTRLFYAQNDTLTPLKVGALAVL 390


>gi|253995903|ref|YP_003047967.1| integral membrane protein MviN [Methylotenera mobilis JLW8]
 gi|253982582|gb|ACT47440.1| integral membrane protein MviN [Methylotenera mobilis JLW8]
          Length = 514

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   ++  + S+L +  +        P    L +L   ++ TL+  G FT  D
Sbjct: 287 LLPSLSKAYAGKDDSEYSQLLDWGLRLTFILAAPAAVALAVLATPLVATLFNYGKFTPLD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
            ++    L  YS  ++G +L ++L   FYAR ++KTP K  + ++VM
Sbjct: 347 VLMTQQALIAYSVGLLGLILVKILAPGFYARQNIKTPVKIAVFTLVM 393


>gi|169831805|ref|YP_001717787.1| integral membrane protein MviN [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638649|gb|ACA60155.1| integral membrane protein MviN [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 521

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 110/241 (45%), Gaps = 16/241 (6%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P LS  I   +  +      R ++ VL   +P    L++L   I+  L+ERGAF  +
Sbjct: 285 AIFPTLSRHIAEGDPAEMVRTLRRGVKVVLLLTVPAVTGLVLLRIPIVTLLFERGAFDER 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T + ++ L  ++  +VG  L  ++   F+A  D++TP    + ++ +    ++ L   +
Sbjct: 345 ATAMTAAALLFFAIGLVGHCLVMLISRGFFAMQDMRTPVMVTVGTLTVKGGASLLLVGPM 404

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL-SIFISSGLMGMFIVFFKP 181
              G+A A      +N + L   L +R +  L    + R L  + +++G+MG+ +V    
Sbjct: 405 AHAGLALATSITAVLNAVLLIYLLQRRLRGGLITADLVRFLGGVLVATGVMGLVVVTVDA 464

Query: 182 CLFNQLSAETAFSPFKNLAI-------ILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
            L        AF P   L +       I++GA++ +   I + L +  L  L Y+ +T  
Sbjct: 465 AL-------AAFFPAGGLGLLARVGLTIVTGAIVYFFAGILIRLDE-LLNILGYARRTIA 516

Query: 235 G 235
           G
Sbjct: 517 G 517


>gi|83589846|ref|YP_429855.1| integral membrane protein MviN [Moorella thermoacetica ATCC 39073]
 gi|83572760|gb|ABC19312.1| integral membrane protein MviN [Moorella thermoacetica ATCC 39073]
          Length = 531

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 2/128 (1%)

Query: 4   LLPKLSSAIQLENKQQS-SELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           LLP L+  + LE  Q + +   + ++  VLF  IP T  L++L + +I+ L++ G FT+ 
Sbjct: 289 LLPALTR-MYLEGDQAAFTRYLSGSLRAVLFISIPATVGLVVLGQPVIRVLFQHGNFTSA 347

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT+  +  L  YS  I  +    +L   FYA  D  TP    ++++  G  +   L P  
Sbjct: 348 DTMATTEALVFYSLGISAYGTYEILSRAFYAIKDTVTPLWIGLITLAAGTALNFTLGPAF 407

Query: 123 GGYGIATA 130
           G  G+A A
Sbjct: 408 GIRGLALA 415


>gi|241760645|ref|ZP_04758737.1| integral membrane protein MviN [Neisseria flavescens SK114]
 gi|241318826|gb|EER55352.1| integral membrane protein MviN [Neisseria flavescens SK114]
          Length = 512

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAASQDTEQFSGLLDWGLRLCMLLTLPAAVGLAVLSFPLVTTLFMYREFTLHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKVAIFTLI 392


>gi|261379550|ref|ZP_05984123.1| integral membrane protein MviN [Neisseria subflava NJ9703]
 gi|284798022|gb|EFC53369.1| integral membrane protein MviN [Neisseria subflava NJ9703]
          Length = 512

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAASQDTEQFSGLLDWGLRLCMLLTLPAAVGLAVLSFPLVTTLFMYREFTLHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKVAIFTLI 392


>gi|294789480|ref|ZP_06754716.1| integral membrane protein MviN [Simonsiella muelleri ATCC 29453]
 gi|294482560|gb|EFG30251.1| integral membrane protein MviN [Simonsiella muelleri ATCC 29453]
          Length = 514

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      N  + S L +  I+  L   +P    L +L   ++ TL+    FT  D
Sbjct: 288 LLPSLSKHAAANNMTEYSALLDWGIKLCLLLILPAAVGLAVLAYPLVATLFMYHRFTIHD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
             +    L  YS  ++  ++ R+L   FYA+ DVKTP +  I+S+
Sbjct: 348 AHMTQYALMAYSIGLLPMIMVRILAPAFYAKKDVKTPMRIAIISL 392


>gi|237653344|ref|YP_002889658.1| integral membrane protein MviN [Thauera sp. MZ1T]
 gi|237624591|gb|ACR01281.1| integral membrane protein MviN [Thauera sp. MZ1T]
          Length = 512

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +  ++ S L +  +   L   +P    L +L   ++ TL+  GAFT  D
Sbjct: 287 LLPSLSKLHADDKAEEFSSLLDWGLRLTLMLTLPAALGLALLAVPLVATLFNYGAFTPAD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
            +   S L  YS  + G +L +VL   FYAR D++TP K  IL++
Sbjct: 347 VMQTRSALVAYSVGLTGLILVKVLAPGFYARQDIRTPVKIAILTL 391


>gi|225077054|ref|ZP_03720253.1| hypothetical protein NEIFLAOT_02106 [Neisseria flavescens
           NRL30031/H210]
 gi|224951611|gb|EEG32820.1| hypothetical protein NEIFLAOT_02106 [Neisseria flavescens
           NRL30031/H210]
          Length = 512

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAASQDTEQFSGLLDWGLRLCMLLTLPAAVGLAVLSFPLVTTLFMYREFTLHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKVAIFTLI 392


>gi|68304939|gb|AAY89950.1| predicted virulence factor MviN [uncultured bacterium BAC13K9BAC]
          Length = 523

 Score = 57.0 bits (136), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 67/143 (46%), Gaps = 9/143 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS   Q       S   +++I+  +   IP    L++L   II TL+  G F   D
Sbjct: 295 MLPVLSQHFQKNESVLYSSTLSKSIKLSMLIAIPSMVGLIILSGSIISTLFMYGNFDMFD 354

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF---- 119
             +    L  YS  +  F+  ++L++ FY+R D KTP  + ++ I +  +  + +     
Sbjct: 355 VSMTVLSLMTYSLGLPAFIFLKILVTAFYSRQDTKTPVIYSLIGISINIIFNLAVLYFYL 414

Query: 120 --PFIGGY---GIATAEVSWVWV 137
             PF G +    +AT+  +WV V
Sbjct: 415 KSPFEGAHALVALATSLSAWVQV 437


>gi|291276654|ref|YP_003516426.1| integral membrane protein MviN [Helicobacter mustelae 12198]
 gi|290963848|emb|CBG39684.1| integral membrane protein (MviN homolog) [Helicobacter mustelae
           12198]
          Length = 483

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 68/129 (52%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL P ++ AI+   + ++ +L  +A   +L     C    ++L  E+I  L+ERG F  Q
Sbjct: 296 ALFPTIARAIKNLEEHKARDLMKKAFWVLLILLSLCVCGGIVLKNEVIYVLFERGKFLRQ 355

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT++ ++  ++Y   +V F L++V     +A       A    +S+++G + ++ L  +I
Sbjct: 356 DTLIAANVFALYLLGLVPFGLAKVFALWLFAHKKQGVVALCSGISLLVGLLCSLILMQYI 415

Query: 123 GGYGIATAE 131
           G YG+A A 
Sbjct: 416 GVYGLALAS 424


>gi|260580054|ref|ZP_05847884.1| integral membrane protein MviN [Haemophilus influenzae RdAW]
 gi|260093338|gb|EEW77271.1| integral membrane protein MviN [Haemophilus influenzae RdAW]
          Length = 524

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 RAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|209883680|ref|YP_002287537.1| integral membrane protein MviN [Oligotropha carboxidovorans OM5]
 gi|209871876|gb|ACI91672.1| integral membrane protein MviN [Oligotropha carboxidovorans OM5]
          Length = 519

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 66/113 (58%), Gaps = 4/113 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+ + AIQ +++   +  ++R +E  L   +P T  L++L + I+  L++ GAFTA D
Sbjct: 286 LMPEFTHAIQNDDRAALTHAQSRGVELALGLVLPATLGLMLLSQPIVGILFQHGAFTATD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
           T   +  LS+ +  +  ++L +VL   F+AR D +TP    +L+ + G  +A+
Sbjct: 346 TAATAEALSVLALGLPAYVLVKVLAPAFFAREDTRTP----LLATLAGIALAV 394


>gi|302875069|ref|YP_003843702.1| integral membrane protein MviN [Clostridium cellulovorans 743B]
 gi|307690307|ref|ZP_07632753.1| integral membrane protein MviN [Clostridium cellulovorans 743B]
 gi|302577926|gb|ADL51938.1| integral membrane protein MviN [Clostridium cellulovorans 743B]
          Length = 512

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 78/151 (51%), Gaps = 5/151 (3%)

Query: 9   SSAIQLENKQQSSELRNRAIEYVLF---FGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           +  ++  NK +  +L+   +  ++F   F +P + I+++   EI++ L+E GAFTA+DT 
Sbjct: 290 NEMVEAVNKNELVKLKKILVNTLIFCIIFILPISFIMIIFRTEIVRVLFEGGAFTAEDTQ 349

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
             +    +    ++ F+L  +L   FY+  D KT  K  I+  ++  ++++ L  ++G  
Sbjct: 350 NTAKVFFMLIPTMMLFILRDLLSRVFYSLKDTKTSMKNGIMVTIINVILSVILSRYMGVV 409

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPF 156
           G+A A       + I L + L    +ID+ F
Sbjct: 410 GVALATTLSTLFSVIALTIRL--NSKIDISF 438


>gi|16272901|ref|NP_439125.1| virulence factor [Haemophilus influenzae Rd KW20]
 gi|1171085|sp|P44958|MVIN_HAEIN RecName: Full=Virulence factor mviN homolog
 gi|1573989|gb|AAC22623.1| virulence factor (mviN) [Haemophilus influenzae Rd KW20]
          Length = 510

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 97/208 (46%), Gaps = 9/208 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 296 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIGGYGIAT 129
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++   G+A 
Sbjct: 356 RAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYV---GLAI 412

Query: 130 AEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLFNQLSA 189
           A      +N   L   L K        ++    + + +++  MG  + ++ P + NQ + 
Sbjct: 413 ASAMSATLNAYLLYRGLAKADVYHFSRKSAVFFVKVLLAAIAMGAAVWYYVPEI-NQWAK 471

Query: 190 ETAFSPFKNLAIILSGAVLVYLCSISLL 217
              F     L  ++  A +VY  ++ LL
Sbjct: 472 MDFFMRVYWLVWLIVLAAIVYGATLILL 499


>gi|170723722|ref|YP_001751410.1| integral membrane protein MviN [Pseudomonas putida W619]
 gi|169761725|gb|ACA75041.1| integral membrane protein MviN [Pseudomonas putida W619]
          Length = 512

 Score = 56.6 bits (135), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++++ S + +  +       +PCT  L +L + +   L++ G F+A D
Sbjct: 287 LLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++  +L +VL   FYA+ +++TP +  I +++
Sbjct: 347 AAMTQQALIAYSVGLLAIILVKVLAPGFYAQQNIRTPVRIAIFTLI 392


>gi|75908889|ref|YP_323185.1| virulence factor MVIN-like protein [Anabaena variabilis ATCC 29413]
 gi|75702614|gb|ABA22290.1| Virulence factor MVIN-like protein [Anabaena variabilis ATCC 29413]
          Length = 534

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (48%), Gaps = 3/133 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L   +   +L+ R  + +L   +   P  A+L+ L   I+Q +YERGAF 
Sbjct: 299 LLPLLPIFAKLAEPENWPDLKLRIRQGLLLTAVTMLPLGALLISLSVPIVQVVYERGAFK 358

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + T LVSS L  Y   +  +L   VL+  FYA  D +TP +  I +I +  V+      
Sbjct: 359 QEATQLVSSLLVAYGIGMFVYLGRDVLVRVFYALGDGQTPFRISIFNIFLNVVLDWFFVK 418

Query: 121 FIGGYGIATAEVS 133
             G  G+  A VS
Sbjct: 419 PFGAPGLVLATVS 431


>gi|254281999|ref|ZP_04956967.1| integral membrane protein MviN [gamma proteobacterium NOR51-B]
 gi|219678202|gb|EED34551.1| integral membrane protein MviN [gamma proteobacterium NOR51-B]
          Length = 531

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 81/154 (52%), Gaps = 8/154 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+     + Q  +   + AI  VL   +P TA LL+L + I+ TL++ G F A D
Sbjct: 298 ILPALSAQRAQSDAQAYAATLDWAIRTVLLIALPATAALLLLAEPILTTLFQYGEFGADD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI-AIGLFPF- 121
             + S  L  Y+  +  F+L +VL   FYA+ D+KTP +  I+++V   V+  + +FP  
Sbjct: 358 VAMASHSLRAYTLGLGAFMLVKVLAPGFYAQEDMKTPVRIGIIAMVSNMVMNPLFVFPLM 417

Query: 122 ----IGGYGIATAEVSWVWVNTICLAVALLKRRQ 151
               +G  G+A A  +  W+N   L   L  RRQ
Sbjct: 418 WQFNLGHVGLALATSASAWLNVALLYRGL--RRQ 449


>gi|85859584|ref|YP_461786.1| virulence factor protein [Syntrophus aciditrophicus SB]
 gi|85722675|gb|ABC77618.1| virulence factor protein [Syntrophus aciditrophicus SB]
          Length = 527

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 89/174 (51%), Gaps = 4/174 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP  S+ +      +     + ++  +L+  +P T  L+ L + I+  L++RGAF + 
Sbjct: 293 ASLPSFSAQVARGLFDEFKRTISFSLRLILYITVPATVALIALREPIVSVLFQRGAFDSH 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPF 121
            T++ +  L  Y+  +  F + RV+ S F++  D K+P K   +S+++   ++I L FP 
Sbjct: 353 STLMTAQALLYYTLGLWAFSVIRVIDSAFFSLQDRKSPLKAAFVSLLVNVGLSILLMFPL 412

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS-IFISSGLMGM 174
             G G+A A  +   VN + L+  L K+  I L  Q  Y  L   F +S LMG+
Sbjct: 413 KHG-GLALATSAASAVNVLMLSFILRKKIGIFLD-QKFYSSLGKTFFASALMGI 464


>gi|300870523|ref|YP_003785394.1| integral membrane protein MviN putative virulence factor
           [Brachyspira pilosicoli 95/1000]
 gi|300688222|gb|ADK30893.1| integral membrane protein MviN putative virulence factor
           [Brachyspira pilosicoli 95/1000]
          Length = 535

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 75/152 (49%), Gaps = 4/152 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS  I  E   ++ +  + ++  V    IP T   ++L +EI+  +++ GAF+ + 
Sbjct: 300 MLPTLSKLIANEKYDEAKDTLSYSLRLVALITIPATFGFMILGREIVAMIFQYGAFSEKS 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+LVS+ L   S  +      R+++  FYA  D+KTP      + ++   I+  L  +I 
Sbjct: 360 TLLVSNALRYLSISLFFVASYRIVVQSFYAMKDMKTPVYIAFFAFIIN-AISNYLCVYIF 418

Query: 124 GYGIATAEVSWVWVNTIC---LAVALLKRRQI 152
            + I    +S V  N I    L + L+KR  +
Sbjct: 419 HFDIIGISISSVLANIISFIILYILLMKRMNM 450


>gi|145634141|ref|ZP_01789852.1| putative virulence factor MviN [Haemophilus influenzae PittAA]
 gi|145268585|gb|EDK08578.1| putative virulence factor MviN [Haemophilus influenzae PittAA]
          Length = 420

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           SA+   N        +  +  +L  G+P    + +L + ++ TL+ RG F   D    S 
Sbjct: 210 SAVDFHNTM------DWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASY 263

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
            L  ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 264 SLWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 319


>gi|307611512|emb|CBX01186.1| hypothetical protein LPW_28851 [Legionella pneumophila 130b]
          Length = 517

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 292 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 351

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 352 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFVFVWHLA 411

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN   L   L+KR         +   + + I++  +G+++ F     
Sbjct: 412 HAGLTLASALAGYVNCAILLFLLIKRGLFKPSPGWLKYSMQLLIANFAIGVYLYFMS--- 468

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 469 -GTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 504


>gi|261364072|ref|ZP_05976955.1| integral membrane protein MviN [Neisseria mucosa ATCC 25996]
 gi|288568116|gb|EFC89676.1| integral membrane protein MviN [Neisseria mucosa ATCC 25996]
          Length = 513

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +N +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAANQNTEQFSGLLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|293391730|ref|ZP_06636064.1| integral membrane protein MviN [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952264|gb|EFE02383.1| integral membrane protein MviN [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 525

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 74/159 (46%), Gaps = 1/159 (0%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  +  +L  G+P    + +L + ++  L+ RG+F   D    S  L  ++  ++ F+L 
Sbjct: 322 DWGVRMILLLGVPAMIGIAVLAQPMLLVLFMRGSFNFSDVQAASYSLWGFNAGLLSFMLI 381

Query: 85  RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAV 144
           ++L + +YAR D KTP K  I+++V      +   PF    G+A A      +N   L  
Sbjct: 382 KILANGYYARQDTKTPVKIGIIAMVSNMAFNLLAIPF-SYVGLAIASAMSATLNAFLLYR 440

Query: 145 ALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
            L K    +   Q+    L +  ++ +MG+ + +  P L
Sbjct: 441 GLAKADVYNFSQQSAVFFLKVLFAAVIMGLLVWYNSPSL 479


>gi|134296735|ref|YP_001120470.1| integral membrane protein MviN [Burkholderia vietnamiensis G4]
 gi|134139892|gb|ABO55635.1| integral membrane protein MviN [Burkholderia vietnamiensis G4]
          Length = 516

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +VS  L+ Y   +VG +L ++L   FYA+ D+KTP K  I+ +++  +      P IG
Sbjct: 351 VTMVSRALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIIVLIVTQISNYVFVPLIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+  +      +N++ L   L KR
Sbjct: 411 HAGLTLSIGVGACLNSLLLFFGLRKR 436


>gi|257466196|ref|ZP_05630507.1| virulence factor mviN [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917354|ref|ZP_07913594.1| virulence factor mviN [Fusobacterium gonidiaformans ATCC 25563]
 gi|313691229|gb|EFS28064.1| virulence factor mviN [Fusobacterium gonidiaformans ATCC 25563]
          Length = 486

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 1/173 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           + P LS A   ++  +      R +  +LF  +P   + ++  KE+I+ L+  G F    
Sbjct: 281 VFPSLSKAAAKKDYTKIQRELERGLNILLFLVVPSMVVCILYAKEVIRLLFSYGKFGEDA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  +  ++  + L   FYA  D K PA++ I++IV+   +   L   + 
Sbjct: 341 VTITAQALLFYSIGLYAYVGVQFLSKGFYALGDNKRPARYSIMAIVINIALNALLIQKME 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N I L V    ++ I L F +  +I  + I++ L   FI
Sbjct: 401 YRGLALATSVASCCNFIALVVT-FHKKYISLAFLSCIKIAMLSIAASLFAYFI 452


>gi|229846024|ref|ZP_04466136.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae 7P49H1]
 gi|229811028|gb|EEP46745.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Haemophilus
           influenzae 7P49H1]
          Length = 524

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           SA+   N        +  +  +L  G+P    + +L + ++ TL+ RG F   D    S 
Sbjct: 314 SAVDFHNTM------DWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASY 367

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
            L  ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 368 SLWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|150388059|ref|YP_001318108.1| integral membrane protein MviN [Alkaliphilus metalliredigens QYMF]
 gi|149947921|gb|ABR46449.1| integral membrane protein MviN [Alkaliphilus metalliredigens QYMF]
          Length = 521

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 60/130 (46%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +  L P LS      N  +   +    +  +L   +P T  +++L + I++  +ERGAF 
Sbjct: 283 VTVLFPLLSQKADKNNHDEFKSVFRYGVNTILLITVPATVGMIVLAEPIVRLSFERGAFD 342

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           A  + + +  L  YS  IVG  L   L   +YA  D KTP     ++I +  V+   L  
Sbjct: 343 ATASYMTAGALIFYSIGIVGMGLKSFLNRAYYALQDTKTPMYNGFIAIGVNIVLNFILVQ 402

Query: 121 FIGGYGIATA 130
           F+   G+A A
Sbjct: 403 FMAHRGLALA 412


>gi|34556869|ref|NP_906684.1| hypothetical protein WS0442 [Wolinella succinogenes DSM 1740]
 gi|34482584|emb|CAE09584.1| INTEGRAL MEMBRANE PROTEIN (MVIN HOMOLOG) [Wolinella succinogenes]
          Length = 493

 Score = 56.6 bits (135), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 68/128 (53%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL P ++ AI+ +N  ++     R+  ++L+  +  T   ++L KEII  L+ERG FT  
Sbjct: 309 ALFPTVARAIKNQNSTEALFHLKRSFWFLLYMLVFSTLGGILLSKEIIWMLFERGEFTRN 368

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DTI  +  LS+Y   ++ F ++++     Y+ +     AK    +++ G ++++    F 
Sbjct: 369 DTIESARVLSMYMIGLLPFGIAKIFSLWLYSHSKQGLAAKISAKALLGGTILSVIFMQFW 428

Query: 123 GGYGIATA 130
           G  G+A A
Sbjct: 429 GASGLALA 436


>gi|309973534|gb|ADO96735.1| Peptidoglycan lipid II flippase [Haemophilus influenzae R2846]
          Length = 510

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 10  SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSS 69
           SA+   N        +  +  +L  G+P    + +L + ++ TL+ RG F   D    S 
Sbjct: 300 SAVDFHNTM------DWGVRMILLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASY 353

Query: 70  YLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
            L  ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 354 SLWAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 409


>gi|186685195|ref|YP_001868391.1| integral membrane protein MviN [Nostoc punctiforme PCC 73102]
 gi|186467647|gb|ACC83448.1| integral membrane protein MviN [Nostoc punctiforme PCC 73102]
          Length = 534

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVL---FFGIPCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L   +   +L+ R  + +L   F  +P  A+++ L   I+Q +YERGAF 
Sbjct: 299 LLPLLPIFAKLAGPENWPDLKLRIRQGLLLTAFTMLPLGALMVALSVPIVQVVYERGAFK 358

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
            + T LVSS L  Y   +  +L   VL+  FYA  D +TP +  I +I++  ++
Sbjct: 359 PEATELVSSLLVAYGIGMFVYLGRDVLVRVFYALGDGQTPFRISIFNILLNIIL 412


>gi|90022213|ref|YP_528040.1| peptidase M24A [Saccharophagus degradans 2-40]
 gi|89951813|gb|ABD81828.1| integral membrane protein MviN [Saccharophagus degradans 2-40]
          Length = 533

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS        +      + A+  V+   +P    L++L K ++ TL++ G  +  D
Sbjct: 302 VLPTLSRQFSKNTHEGYGTTLDWALRMVMLIAVPAAIALIVLAKPVLFTLFQYGKTSVND 361

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG--------FVIA 115
             + +  L  YS  +  F+L +VL S +++R D +TP +  I  I MG        FV+ 
Sbjct: 362 VNMAALSLCAYSLGLTAFMLIKVLASAYFSRQDTRTPVRIGI--IAMGANMVLNLLFVVP 419

Query: 116 IGLFPFIGGYGIATAEVSWVWVNT 139
           +     IG  G+A A     ++N 
Sbjct: 420 LHFIYQIGHMGLAMATACSAFLNA 443


>gi|54295474|ref|YP_127889.1| hypothetical protein lpl2560 [Legionella pneumophila str. Lens]
 gi|53755306|emb|CAH16800.1| hypothetical protein lpl2560 [Legionella pneumophila str. Lens]
          Length = 523

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 7/217 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     +N  Q S   +  +  +L  GIP    L      +I + +  G FTA D
Sbjct: 298 ILPHLSRKHTEQNINQYSRALDWGLRSILLIGIPAGLGLSFFALPLIASCFAYGKFTAYD 357

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L   +  +  F++ +VL S FYAR D+ TP K   +++V+  ++       + 
Sbjct: 358 LLQTQKSLITLAMGVPAFMVVKVLASGFYARQDISTPVKVGAIAMVVNTLLCFVFVWHLA 417

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     +VN   L   L+KR         +   + + I++  +G+++ F     
Sbjct: 418 HAGLTLASALAGYVNCAILLFLLIKRGLFKPSPGWLKYSMQLLIANFAIGVYLYFMS--- 474

Query: 184 FNQLSAETAFSPFKNLAIILSG---AVLVYLCSISLL 217
               +    FSP   L+++L+     V++YL  + ++
Sbjct: 475 -GTATYWLGFSPLMRLSLLLAHVFVTVVIYLLVLGII 510


>gi|325145271|gb|EGC67550.1| integral membrane protein MviN [Neisseria meningitidis M01-240013]
          Length = 512

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|261868574|ref|YP_003256496.1| integral membrane protein MviN [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413906|gb|ACX83277.1| integral membrane protein MviN [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 525

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 1/159 (0%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           +  +  +L  G+P    + +L + ++  L+ RG+F   D    S  L  ++  ++ F+L 
Sbjct: 322 DWGVRMILLLGVPAMIGIAVLAQPMLLVLFMRGSFNFSDVQAASYSLWGFNAGLLSFMLI 381

Query: 85  RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAV 144
           ++L + +YAR D KTP K  I+++V      +   PF    G+A A      +N   L  
Sbjct: 382 KILANGYYARQDTKTPVKIGIIAMVSNMAFNLLAIPF-SYVGLAIASAMSATLNAFLLYR 440

Query: 145 ALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
            L K        Q+    L +  ++ +MG+ + +  P L
Sbjct: 441 GLAKADVYHFSRQSAVFFLKVLFAAVIMGLLVWYNNPSL 479


>gi|302390341|ref|YP_003826162.1| integral membrane protein MviN [Thermosediminibacter oceani DSM
           16646]
 gi|302200969|gb|ADL08539.1| integral membrane protein MviN [Thermosediminibacter oceani DSM
           16646]
          Length = 521

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 85/165 (51%), Gaps = 7/165 (4%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           L +LS+   +E  +++     RA+ +V+   +P +A  ++L   I++ L+ERGAF ++ T
Sbjct: 293 LSRLSAEGDMEGFKRT---LGRALGFVIAIVMPLSAGAMVLRVPIVRFLFERGAFDSRAT 349

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
            + ++ L  +S  +VGF L  VL   FY+  D  TP     +++ +  V+ + L  F+G 
Sbjct: 350 FMTATALLYFSAGMVGFGLRDVLSRAFYSLRDTATPMVNGAVAVGINVVLNLILVKFMGL 409

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
            G+A A        T  L  +L  RR+I  P     RIL  F+ S
Sbjct: 410 GGLALATSISALAGTAMLFYSL--RRKIG-PLGG-RRILMSFVKS 450


>gi|86610160|ref|YP_478922.1| integral membrane protein MviN [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558702|gb|ABD03659.1| integral membrane protein MviN [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 548

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 72/151 (47%), Gaps = 4/151 (2%)

Query: 16  NKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLS 72
           +  +  ELR R  + ++   I   P + +L+ L + I+Q  Y+RG FT + T  V++ L 
Sbjct: 316 DGSRWPELRQRIRQGLMLTAIVTLPLSMLLVALAEPIVQVAYQRGRFTPEVTQEVAALLM 375

Query: 73  IYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEV 132
            Y   + G+LL  VL+  FYA  D  TP +   ++I +  ++        G  GIA A  
Sbjct: 376 AYGLGMTGYLLRDVLVRIFYALEDGATPLRISSMAIGLNALLDFLFLQAFGAPGIALATA 435

Query: 133 SWVWVNTICLAVALLKRRQIDLPFQTIYRIL 163
               +  I L +  L R    +P+Q + + L
Sbjct: 436 GVNLIAVIGLGIR-LHRHLPGIPWQEMGQAL 465


>gi|212711954|ref|ZP_03320082.1| hypothetical protein PROVALCAL_03029 [Providencia alcalifaciens DSM
           30120]
 gi|212685476|gb|EEB45004.1| hypothetical protein PROVALCAL_03029 [Providencia alcalifaciens DSM
           30120]
          Length = 493

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N Q+   L +  +   L   +PC   L ML + +  +L++   FTA D
Sbjct: 268 LLPSLSKSFTSGNHQEYRHLMDWGLRLCLLLALPCAIGLAMLSEALTVSLFQYDKFTAHD 327

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           +++    L  Y   + G +L ++L   FY+R D++TP +  I++++M
Sbjct: 328 SLMTQYALMAYCVGLTGMILVKILAPGFYSRQDIRTPVRIAIVTLIM 374


>gi|145640634|ref|ZP_01796217.1| putative virulence factor MviN [Haemophilus influenzae R3021]
 gi|145274560|gb|EDK14423.1| putative virulence factor MviN [Haemophilus influenzae 22.4-21]
          Length = 524

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|116620651|ref|YP_822807.1| integral membrane protein MviN [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223813|gb|ABJ82522.1| integral membrane protein MviN [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 510

 Score = 56.2 bits (134), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 14/150 (9%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGA 58
           AA LP +SSA+  E +  +S LR R    +  + FF +P       L   I   LYE G 
Sbjct: 276 AAQLPAMSSALGTEAEVNAS-LRRRLDTGLRQIAFFIVPSAMAFFTLGGVIAAALYEGGE 334

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYI----LSIVMGFVI 114
           FT  +++ V   ++  +  ++   L R+  S +YA  D +TP ++ +    L++ +G+V 
Sbjct: 335 FTHANSLYVWGIVAGSAVGLLASTLGRLYASTYYALRDTRTPLRYAVVRVALTVGLGYVS 394

Query: 115 A------IGLFPFIGGYGIATAEVSWVWVN 138
           A      IGL P  G  G+  +     WV 
Sbjct: 395 ALPLPRWIGLDPHWGATGLTVSAGVAGWVE 424


>gi|254805682|ref|YP_003083903.1| putative virulence factor [Neisseria meningitidis alpha14]
 gi|254669224|emb|CBA08052.1| putative virulence factor [Neisseria meningitidis alpha14]
          Length = 512

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|145630060|ref|ZP_01785842.1| putative virulence factor MviN [Haemophilus influenzae R3021]
 gi|144984341|gb|EDJ91764.1| putative virulence factor MviN [Haemophilus influenzae R3021]
          Length = 524

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|145632350|ref|ZP_01788085.1| putative virulence factor MviN [Haemophilus influenzae 3655]
 gi|144987257|gb|EDJ93787.1| putative virulence factor MviN [Haemophilus influenzae 3655]
          Length = 524

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 310 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 369

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 370 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 423


>gi|119476951|ref|ZP_01617232.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2143]
 gi|119449758|gb|EAW30995.1| integral membrane protein MviN [marine gamma proteobacterium
           HTCC2143]
          Length = 514

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 6/133 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++++  S   + AI+ VL  G+P    L++L   I+ TL++    T  D
Sbjct: 281 ILPSLSRQQANKSREGFSATLDWAIKMVLLIGLPSAVALIILATPILMTLFQYDKLTVGD 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG------FVIAIG 117
             + +  L  YS  ++ F+L +VL   ++++ D KTP    I ++V        FV+ + 
Sbjct: 341 VGMAAMSLQAYSLGLLAFMLIKVLAPGYFSQLDTKTPVTIGIKAMVANMMMNVIFVVPLH 400

Query: 118 LFPFIGGYGIATA 130
            F  IG  G+A A
Sbjct: 401 YFWQIGHVGLAFA 413


>gi|254785205|ref|YP_003072633.1| integral membrane protein MviN [Teredinibacter turnerae T7901]
 gi|237684100|gb|ACR11364.1| integral membrane protein MviN [Teredinibacter turnerae T7901]
          Length = 530

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 1/113 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS    +   Q  S   + A+  +L  G+P    L++L + I+  L++   F   D
Sbjct: 301 ILPALSRQ-HVRGGQAFSHTLDWAMRLILLIGLPAAVALIVLAEPILFALFQYDQFRPTD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
            ++    L  Y+  +  F+L +VL S F++R D +TP +  I+++    V+ I
Sbjct: 360 VMMAKYSLWAYAFGVTAFMLIKVLASGFFSRQDTRTPVRIGIIAMATNMVLNI 412


>gi|210622010|ref|ZP_03292953.1| hypothetical protein CLOHIR_00899 [Clostridium hiranonis DSM 13275]
 gi|210154455|gb|EEA85461.1| hypothetical protein CLOHIR_00899 [Clostridium hiranonis DSM 13275]
          Length = 520

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 87/175 (49%), Gaps = 3/175 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LL KLSS     N + ++ +  +++  V+   IP    +++L   I+Q  +ERG F    
Sbjct: 285 LLSKLSSE---GNSKAATGIIRKSVNVVIVLMIPIAVGIMVLSIPIVQLAFERGKFDHSA 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T+L ++ LS Y+  +    L  +L + FY+  D KTP +  ++++ M   + +    F+G
Sbjct: 342 TLLTAAALSYYALGLPASGLRNILGNVFYSFGDTKTPMRNGMIAMFMNICMNLVFIKFMG 401

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
             G+A A      +  + L ++L K+ +     + I   +   IS+ +MG+ + F
Sbjct: 402 HCGLAFATSISATICILLLFMSLKKKIKYFGQDKIIITTIKSVISAAIMGVVVYF 456


>gi|311693401|gb|ADP96274.1| integral membrane protein MviN [marine bacterium HP15]
          Length = 497

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 79/166 (47%), Gaps = 3/166 (1%)

Query: 52  TLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG 111
           TL+  GA T +D  + +  L  YS  ++ F+L +VL   F+AR D KTP K  I+++V  
Sbjct: 323 TLFHYGAVTDRDVAMSAQSLRAYSAGLLAFMLIKVLAPGFFAREDTKTPVKIGIIAMVAN 382

Query: 112 FVIA-IGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSG 170
            V   I +FP +   G+A A     W+N   L   L K             +L +  ++G
Sbjct: 383 MVFNLILIFP-LAHAGLALATSISAWLNGYLLWRGLRKEGAWQSQPGWPRFLLQLLFANG 441

Query: 171 LMGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISL 216
            +   IV+    +   L A   +    ++A++++  V VY  +++L
Sbjct: 442 ALAAVIVWLNAPVSVWL-ANGGYQRAADMAMLVAAGVAVYFVALAL 486


>gi|68249552|ref|YP_248664.1| putative virulence factor MviN [Haemophilus influenzae 86-028NP]
 gi|68057751|gb|AAX88004.1| putative virulence factor MviN [Haemophilus influenzae 86-028NP]
          Length = 510

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 60/114 (52%), Gaps = 5/114 (4%)

Query: 15  ENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYL 71
           ++ + + + RN     +  +   G+P    + +L + ++ TL+ RG F   D    S  L
Sbjct: 296 DSAKSAVDFRNTMDWGVRMIFLLGVPAAIGIAVLAQPMLLTLFMRGNFMLNDVYAASYSL 355

Query: 72  SIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV--MGFVIAIGLFPFIG 123
             ++  ++ F+L ++L + +YAR D KTP K  I+++V  MGF +    F ++G
Sbjct: 356 WAFNAGLLSFMLIKILANGYYARQDTKTPVKIGIIAMVSNMGFNLLAIPFSYVG 409


>gi|319638847|ref|ZP_07993605.1| virulence factor MviN [Neisseria mucosa C102]
 gi|317399751|gb|EFV80414.1| virulence factor MviN [Neisseria mucosa C102]
          Length = 512

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAASQDTEQFSGLLDWGLRLCMLLTLPAAVGLAVLSFPLVTTLFMYREFTLHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQYALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKVAIFTLI 392


>gi|121634146|ref|YP_974391.1| putative inner membrane protein [Neisseria meningitidis FAM18]
 gi|120865852|emb|CAM09585.1| putative inner membrane protein [Neisseria meningitidis FAM18]
 gi|325131578|gb|EGC54285.1| integral membrane protein MviN [Neisseria meningitidis M6190]
 gi|325139167|gb|EGC61713.1| integral membrane protein MviN [Neisseria meningitidis ES14902]
          Length = 512

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL S FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLASGFYARQNIKTPVKIAIFTLI 392


>gi|289209717|ref|YP_003461783.1| integral membrane protein MviN [Thioalkalivibrio sp. K90mix]
 gi|288945348|gb|ADC73047.1| integral membrane protein MviN [Thioalkalivibrio sp. K90mix]
          Length = 522

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+L+      +        + A+   +   +P    L++L   I+ TL +  AFT  D
Sbjct: 289 ILPRLARQYNQADPAAFGRTLDWALRLAMLVALPSMVGLVVLAVPILATLIQYQAFTQWD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
           T + +  L+ Y+  + GF+L +VL   F+AR D +TP K  I++++   V+
Sbjct: 349 TYMSAMALAAYALGLPGFILIKVLAPGFFARQDTRTPVKIAIIAMLANIVL 399


>gi|254517162|ref|ZP_05129220.1| integral membrane protein MviN [gamma proteobacterium NOR5-3]
 gi|219674667|gb|EED31035.1| integral membrane protein MviN [gamma proteobacterium NOR5-3]
          Length = 540

 Score = 56.2 bits (134), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 76/151 (50%), Gaps = 6/151 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           ++P L++       +  ++  + A+  VL  G+P +  LL+L + I+ +L+  GA + +D
Sbjct: 297 IMPTLAAHRSAARDEDYAKTLDWAVRSVLLVGVPASLALLLLAEPILISLFHYGALSERD 356

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMG------FVIAIG 117
             + +  L  YS  +  F+L +VL   FYAR D+ TP +  I ++V        FV+ + 
Sbjct: 357 IAMSALSLRAYSLGLCAFMLIKVLAPGFYARQDMVTPVRIGIKAMVANMVMNVIFVLPLM 416

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLK 148
            +  +G  G+A A     ++N   L   LL+
Sbjct: 417 FYFGVGHVGLALATSLSAFLNAALLWKGLLR 447


>gi|255526127|ref|ZP_05393048.1| integral membrane protein MviN [Clostridium carboxidivorans P7]
 gi|255510176|gb|EET86495.1| integral membrane protein MviN [Clostridium carboxidivorans P7]
          Length = 516

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 87/173 (50%), Gaps = 4/173 (2%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P +S     E+K +      RAI  ++   +P    + +L + +I  +++RGAFT+    
Sbjct: 287 PTMSELAAREDKTEYKIAVKRAINIIVLIMVPAAVAIAVLRQPLISIIFKRGAFTSSAAK 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L SS L  Y   ++ + +  +L   FY+  D KTP     + I++  VI I +  ++   
Sbjct: 347 LTSSALLFYCPAMIFYGIRDILNKAFYSIKDTKTPMINSFVGILINIVINIFIAKYMQVS 406

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFI-SSGLMGMFI 176
           G+  A      + TI + ++L K+   ID+  + I+ +L+  I +S +MG+FI
Sbjct: 407 GLTLATTISSIIVTIGMLISLNKKIGNIDV--RKIFNVLAKTIFASLIMGVFI 457


>gi|302871480|ref|YP_003840116.1| integral membrane protein MviN [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574339|gb|ADL42130.1| integral membrane protein MviN [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 518

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 105/231 (45%), Gaps = 20/231 (8%)

Query: 8   LSSAIQLENKQQSSELRN---RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
            S+   L+ K      R     A+  ++   +P     +++ KEI + +Y+RG FT + T
Sbjct: 290 FSTLSNLQAKGDKENFRKFFVSAVNSIILMMMPFAIGGMIMAKEITRLIYQRGNFTTEST 349

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
           +L +S L  Y    VG  L  +L    Y   D KT  K  +++I+   ++ +        
Sbjct: 350 LLTASPLMFYCLGFVGLGLRDILNRTLYVLKDSKTAVKNGVIAIICNIILDVIFIHKFKH 409

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFISSGLMGMFIVFFKPCL 183
            G A A  +  ++  + L ++L K+    + ++ I  + +  F++S +MG+F+  FK   
Sbjct: 410 TGAAMAFATANYIAAVLLFISLRKKLG-SIGWKRIAGVFVKAFVASLIMGVFVYVFKQR- 467

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
           F  L+      P K+ A         +  + ++LLG G  A + Y LK ++
Sbjct: 468 FIYLTM-----PLKHFA---------FFTTANILLGMGIYAGIIYLLKVEE 504


>gi|86606678|ref|YP_475441.1| integral membrane protein MviN [Synechococcus sp. JA-3-3Ab]
 gi|86555220|gb|ABD00178.1| integral membrane protein MviN [Synechococcus sp. JA-3-3Ab]
          Length = 544

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 74/154 (48%), Gaps = 10/154 (6%)

Query: 16  NKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLS 72
           +  +  ELR R  + ++   I   P   +L+ L + I+Q  Y+RG FT + T  V++ L 
Sbjct: 311 DGSRWPELRQRIRQGLMVTAILTLPLAMVLVALAEPIVQVAYQRGRFTPEVTQEVAALLM 370

Query: 73  IYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEV 132
            Y   +  +LL  VL+  FYA  D  TP     L+I +  ++     P  G  GIA A  
Sbjct: 371 AYGLGMTCYLLRDVLVRIFYALEDGATPLHISGLAIGLNALLDFLFLPTFGAPGIALATA 430

Query: 133 SWVWVNTICLAVAL---LKRRQIDLPFQTIYRIL 163
               VN + L + L   L +R  ++P+Q + + L
Sbjct: 431 G---VNLMAL-IGLGIRLHQRLPEIPWQEMGQAL 460


>gi|270159209|ref|ZP_06187865.1| integral membrane protein MviN [Legionella longbeachae D-4968]
 gi|289165966|ref|YP_003456104.1| Virulence factor mviN homolog [Legionella longbeachae NSW150]
 gi|269987548|gb|EEZ93803.1| integral membrane protein MviN [Legionella longbeachae D-4968]
 gi|288859139|emb|CBJ13068.1| Virulence factor mviN homolog [Legionella longbeachae NSW150]
          Length = 525

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 96/216 (44%), Gaps = 5/216 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++  Q S   +  +  +L  GIP    L +    +I + +  G F+A D
Sbjct: 300 ILPHLSRRYSEQSISQYSSALDWGLRLILLIGIPAGLGLCLFAMPLIASCFAYGKFSAYD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            +     L      +  F++ +VL S FYA+ D+ TP K   +S++M  ++      +  
Sbjct: 360 VLQTQKSLITLGAGVPAFMMVKVLASGFYAQQDISTPVKVGAISMIMNTLLCFLFIRYFA 419

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  A     ++N   L   L+KR         +   + +  ++  + ++++F     
Sbjct: 420 HAGLTLASALAGYINCGSLLYLLIKRGVFKHSSGWLKYSIQLICANIAISVYLIFTT--- 476

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLG 219
              +S   +FSP K L+ +LS  VLV +    L+LG
Sbjct: 477 -GTVSYWLSFSPIKRLS-VLSLHVLVAVVIYLLVLG 510


>gi|312795226|ref|YP_004028148.1| virulence factor mviN [Burkholderia rhizoxinica HKI 454]
 gi|312167001|emb|CBW74004.1| Virulence factor mviN [Burkholderia rhizoxinica HKI 454]
          Length = 516

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 73/152 (48%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L +  + +  TL+  G F+  D
Sbjct: 291 LLPSLSKAHADADASEYSALLDWGLRLTFLLAAPSAVALFVYAEPLTATLFNYGRFSGHD 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++VS  L+ Y   ++G +L ++L   FYA+ D+KTP K  +  +V+  +  +   P + 
Sbjct: 351 VMMVSRALAAYGAGLLGLILIKILAPGFYAKQDIKTPVKIALAVLVVTQLCNVVFVPHLA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G++ +      VN + L  A L+RR I +P
Sbjct: 411 HAGLSLSIGIGACVNALLL-FAGLRRRSIYVP 441


>gi|317151856|ref|YP_004119904.1| integral membrane protein MviN [Desulfovibrio aespoeensis Aspo-2]
 gi|316942107|gb|ADU61158.1| integral membrane protein MviN [Desulfovibrio aespoeensis Aspo-2]
          Length = 515

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 69/152 (45%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP L+         +     + ++   LF  +P  A L+ L   +I  L+ERGAFT +
Sbjct: 291 AALPSLARLAARGEMDEYDSAMSLSLGLTLFIALPSAAGLIALAAPMISLLFERGAFTIE 350

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                S  L  YS  +    L+R L++ FYA  D +TP +  +L +     + + L   +
Sbjct: 351 AVTATSRALIAYSVGLPFIALARPLVAGFYALEDTRTPVRIAVLCLAANIGLGLLLMRPL 410

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKRRQIDL 154
              G+A A      +N + L V L ++R+  L
Sbjct: 411 AHVGLALAVSLSSMLNFVLLHVYLSRKRKASL 442


>gi|292487932|ref|YP_003530807.1| integral membrane protein mviN [Erwinia amylovora CFBP1430]
 gi|292899151|ref|YP_003538520.1| membrane protein [Erwinia amylovora ATCC 49946]
 gi|291198999|emb|CBJ46110.1| putative membrane protein [Erwinia amylovora ATCC 49946]
 gi|291553354|emb|CBA20399.1| integral membrane protein mviN homolog [Erwinia amylovora CFBP1430]
          Length = 512

 Score = 55.8 bits (133), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ + S L +  +       +P    L +L K +   L++ G F+A D
Sbjct: 287 LLPSLAKSFASGNQIEYSRLMDWGLRLCFLLALPSAVALGILAKPLTVALFQYGKFSAFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FY+R D+ TP K  + +++
Sbjct: 347 AAMTQRALVAYSVGLMGLIVVKVLAPGFYSRQDIITPVKIAMFTLL 392


>gi|71892231|ref|YP_277964.1| putative virulence factor [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|71796337|gb|AAZ41088.1| putative virulence factor [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
          Length = 515

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P LS  I  +N      L N  I       +P   IL +L + ++ TL++ G F   D
Sbjct: 288 LVPYLSRFISKKNYGDYFYLMNWGIRLCFILSLPSALILGVLSEPLVITLFKYGKFLEFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
            ++    +  Y+  + G + ++VL S FYA  D+KTPA  YI+ IV+ F   I L
Sbjct: 348 VLMTQYSVIAYAIGLPGLIFTKVLTSGFYALRDIKTPA--YIVVIVLFFTQFINL 400


>gi|83952471|ref|ZP_00961202.1| integral membrane protein MviN [Roseovarius nubinhibens ISM]
 gi|83836144|gb|EAP75442.1| integral membrane protein MviN [Roseovarius nubinhibens ISM]
          Length = 515

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 74/122 (60%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++  S E  +RA E  L   +P    L+++P  ++  L+ERGAFTA D
Sbjct: 287 LLPDLSRRLKSGDEAGSREALSRAGEMSLALTLPAAVALVVVPLPLVSVLFERGAFTADD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  ++IY   +  F+L +V+   F+AR D ++P ++ I+++V+  VIA+GL P IG
Sbjct: 347 TAATALAVAIYGLGLPAFVLQKVVQPVFFAREDTRSPFRYAIVAMVVNAVIAVGLAPVIG 406

Query: 124 GY 125
            +
Sbjct: 407 WF 408


>gi|75674416|ref|YP_316837.1| virulence factor MVIN-like [Nitrobacter winogradskyi Nb-255]
 gi|74419286|gb|ABA03485.1| virulence factor MVIN-like protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 533

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 94/207 (45%), Gaps = 1/207 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P++S A+  +++  +    +R IE      +P T  L++L + I++ L+E GAFT  D
Sbjct: 299 LVPEMSRALSKDDRTAAVHAESRGIELAAALALPATLGLIVLSEPIVRVLFEHGAFTTAD 358

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L   +  +   +L + L   F+AR D   P    +  I +  V A+ L   +G
Sbjct: 359 TRATALALGCLALGLPAHILIKALSPAFFARGDTMMPLIATLKGIAVAIVSAVALGWMVG 418

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A     W +   LA ++       +  +   R+  I +++ +MG  +++    L
Sbjct: 419 VCGVALAMALGAWSSAASLARSMAAGFGFSIDTEARRRLPRITLAALVMG-GVLWLALRL 477

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVY 210
              +S          L I+++  V VY
Sbjct: 478 LAPISGAHGLLQAATLIILIAAGVAVY 504


>gi|297588538|ref|ZP_06947181.1| integral membrane protein MviN [Finegoldia magna ATCC 53516]
 gi|297573911|gb|EFH92632.1| integral membrane protein MviN [Finegoldia magna ATCC 53516]
          Length = 507

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 78/162 (48%), Gaps = 9/162 (5%)

Query: 16  NKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYS 75
           NK + S +++ ++  +L   IP T  LL+L   I + L+ RGAFT  D  + S  +  Y+
Sbjct: 295 NKMKDSIMKSMSMICILV--IPATIGLLVLSYPITKMLFFRGAFTMNDVDMTSVCMFFYA 352

Query: 76  TEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWV 135
             I+G  +  +L   FYA ND KTP    ++ + +  +  I L    G  G+A A     
Sbjct: 353 LGIIGTAIRDILSKSFYAMNDTKTPTINSVIMVAINIIGNIILSRIFGLVGLAVATSFAN 412

Query: 136 WVNTICLAVALLKR----RQIDLPFQTIYRILSIFISSGLMG 173
            +  I + + L K+          F  I+++L   ISS +MG
Sbjct: 413 LIGAIMIIMRLHKKIGDFSSTKSSFVNIFKML---ISSLIMG 451


>gi|224372979|ref|YP_002607351.1| virulence factor MviN protein [Nautilia profundicola AmH]
 gi|223589346|gb|ACM93082.1| virulence factor MviN protein [Nautilia profundicola AmH]
          Length = 333

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 69/129 (53%), Gaps = 2/129 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L PK++  +    ++++ E   +    + +  I  T + ++  KEII+ L+E GAFTA+D
Sbjct: 152 LFPKITKNLNDGREKEAFESMKKVFWVLFYLLITATVVAIISSKEIIRLLFEHGAFTAKD 211

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-FPFI 122
           T   S  L +Y   ++ + L+++  S  YA +     AK   +S+++  V ++ L FP +
Sbjct: 212 TEFTSVVLIMYMIGLIPYGLNKLFSSYLYATHKHLKAAKISAISLLVNIVFSVALIFP-L 270

Query: 123 GGYGIATAE 131
             YG+A A 
Sbjct: 271 KVYGLALAS 279


>gi|42525858|ref|NP_970956.1| integral membrane protein MviN [Treponema denticola ATCC 35405]
 gi|41815908|gb|AAS10837.1| integral membrane protein MviN [Treponema denticola ATCC 35405]
          Length = 537

 Score = 55.8 bits (133), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 109/227 (48%), Gaps = 19/227 (8%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP++S+    ++ +   ++  +AI+ +    IP T   L+  + +I  +Y+   F   D
Sbjct: 305 ILPEMSALALRKDWEAFQKVLLQAIKVIALITIPATFFSLLSGENLIILIYKSNKF---D 361

Query: 64  TILVSSYLSIYSTEIVGFL---LSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           +  V   L I++  I+G     ++R++   FYA++D K+P    I+   +  ++A+ L  
Sbjct: 362 SASVKLTLGIFNFHIIGLFAIAVNRIIAPAFYAQSDSKSPTIAGIICFAVNILLALILVG 421

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQID---LPFQTIYRILSIFISSGLMGMFIV 177
            +GG GIA A      +NTI L + L K + +D   L F  +  I  IF+ S    + + 
Sbjct: 422 PMGGNGIALALTIASVINTIILLIFLKKNKALDVKNLIFPALLFIAKIFVFSITASIPLY 481

Query: 178 FFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL-LGKGFL 223
           F K         +  +SPF +   ++   V +++  I    LG GFL
Sbjct: 482 FLK---------DKIYSPFASFGKLIGQGVPLFISFIIFAGLGAGFL 519


>gi|296840795|ref|ZP_06863462.2| integral membrane protein MviN [Neisseria polysaccharea ATCC 43768]
 gi|296839942|gb|EFH23880.1| integral membrane protein MviN [Neisseria polysaccharea ATCC 43768]
          Length = 513

 Score = 55.5 bits (132), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P  A + +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAAGMAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|92115644|ref|YP_575373.1| integral membrane protein MviN [Nitrobacter hamburgensis X14]
 gi|91798538|gb|ABE60913.1| integral membrane protein MviN [Nitrobacter hamburgensis X14]
          Length = 529

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 66/140 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P++S A+   ++       +R IE      +P T  L++L + I++ L+E GAFTA D
Sbjct: 295 LVPEMSRALNKGDRLALVHAESRGIELAAALALPATFGLIVLSEPIVRVLFEHGAFTAAD 354

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L      +  ++L + L   F+AR +  TP    +  I +  V+A+      G
Sbjct: 355 TQATALALGCLGLGLPAYVLIKALSPAFFARGNTMTPLLAALTGIAVAIVLALVFGRLFG 414

Query: 124 GYGIATAEVSWVWVNTICLA 143
             GIA A     W N   LA
Sbjct: 415 IGGIAVAVAVGAWSNAASLA 434


>gi|198282851|ref|YP_002219172.1| integral membrane protein MviN [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667171|ref|YP_002425051.1| integral membrane protein MviN [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198247372|gb|ACH82965.1| integral membrane protein MviN [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519384|gb|ACK79970.1| integral membrane protein MviN [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 517

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 71/139 (51%), Gaps = 1/139 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     E   +  +  + A+      G+P T  LL+L + ++ +L+  GA+TA+D
Sbjct: 290 VLPLLSRQAA-ERSPRFPQTLDWALRLTWLIGLPATVGLLILAQPLLISLFRYGAYTAED 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  L  Y   I+  + +RVL   FYA  + +TP +F ++S+V+   I++ L   + 
Sbjct: 349 ARQSALSLIGYGLGILPIIAARVLAPAFYAHQNTRTPVRFAMISVVVNMGISLILAWPLQ 408

Query: 124 GYGIATAEVSWVWVNTICL 142
             G+A A  +   VN + L
Sbjct: 409 QLGLALATSTAALVNALML 427


>gi|302380330|ref|ZP_07268800.1| integral membrane protein MviN [Finegoldia magna ACS-171-V-Col3]
 gi|302311820|gb|EFK93831.1| integral membrane protein MviN [Finegoldia magna ACS-171-V-Col3]
          Length = 508

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 78/162 (48%), Gaps = 9/162 (5%)

Query: 16  NKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYS 75
           NK + S +++ ++  +L   IP T  LL+L   I + L+ RGAFT  D  + S  +  Y+
Sbjct: 295 NKMKDSIMKSMSMICILV--IPATIGLLVLSYPITKMLFFRGAFTMNDVDMTSVCMFFYA 352

Query: 76  TEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWV 135
             I+G  +  +L   FYA ND KTP    ++ + +  +  I L   +G  G+A A     
Sbjct: 353 LGIIGTAIRDILSKSFYAMNDTKTPTINSVIMVAINIIGNIILSRILGLVGLAVATSVAN 412

Query: 136 WVNTICLAVALLKR----RQIDLPFQTIYRILSIFISSGLMG 173
            +    + + L K+          F  I+++L   ISS +MG
Sbjct: 413 LIGAAMIIIRLHKKIGDFSSTKSSFVNIFKML---ISSLIMG 451


>gi|162452047|ref|YP_001614414.1| virulence factor MviN-like protein [Sorangium cellulosum 'So ce
           56']
 gi|161162629|emb|CAN93934.1| virulence factor MviN homolog [Sorangium cellulosum 'So ce 56']
          Length = 503

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 73/155 (47%), Gaps = 6/155 (3%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNR----AIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           A  LP+++      +  + +E  +R    ++  +    +P  A+ ++L +E+I  L + G
Sbjct: 279 AVALPEMARDTAEADVARRNEALSRRLGASLARITVLTVPAAAVFMVLGRELITLLLQTG 338

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
            F    T  V   +  Y   ++G    RVL++  +A  D +TPA++ +  +V+   +A+ 
Sbjct: 339 TFDRASTARVEPLVCAYGLALLGNAAGRVLITASFALGDTRTPARYALYRVVVSTAVALL 398

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQI 152
           L  ++   G+    V   WV  I L   +  RR+I
Sbjct: 399 LMQWLDVLGVVLGAVIAGWVEAIALGRRV--RREI 431


>gi|254251594|ref|ZP_04944912.1| hypothetical protein BDAG_00786 [Burkholderia dolosa AUO158]
 gi|124894203|gb|EAY68083.1| hypothetical protein BDAG_00786 [Burkholderia dolosa AUO158]
          Length = 546

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 74/169 (43%), Gaps = 1/169 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 321 LLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 380

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 381 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPLIG 440

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLM 172
             G+  +      +N++ L  A L+RR I  P     R  +  + + L+
Sbjct: 441 HAGLTLSIGVGACLNSLLL-FAGLRRRGIYQPSPGWLRFFAQLVGAALV 488


>gi|313673165|ref|YP_004051276.1| integral membrane protein mvin [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939921|gb|ADR19113.1| integral membrane protein MviN [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 494

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 92/181 (50%), Gaps = 12/181 (6%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           L ++S A+  ++K ++ ++ +++I  + F  IP T  L +L  +I   +Y+R +F   + 
Sbjct: 288 LTEMSKALASDDKVRAYKIIDKSIISLCFIVIPATMGLFLLSYDITALIYKRKSFGITEA 347

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKF-YILSIVMGFVIAIGLFPFIG 123
            L S  L +YS  ++ + L  +    FY R D  TP +  + +SI+   +  I +F F G
Sbjct: 348 QLTSEALKMYSIGLLFYSLVGLFTRVFYTRKDTITPVRIAFFMSILNALLNYIFMFRF-G 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR----ILSIFISSGLMGMFIVFF 179
             GIA +      +NTI     +L ++  D  F +IY     +L I +SS +M  FI+  
Sbjct: 407 HAGIALSSSVVAMINTI-----ILYKKIGDYRF-SIYENGGLMLKIVLSSIIMSCFIILG 460

Query: 180 K 180
           K
Sbjct: 461 K 461


>gi|297537729|ref|YP_003673498.1| integral membrane protein MviN [Methylotenera sp. 301]
 gi|297257076|gb|ADI28921.1| integral membrane protein MviN [Methylotenera sp. 301]
          Length = 514

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 1/119 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A   +++ + S+L +  +        P    L +L   ++  L+  G FT  D
Sbjct: 287 LLPSLSKAYAGKDESEYSQLLDWGLRLTFILAAPAAVALAVLATPLVTALFHYGKFTPID 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            ++    L  YS  ++G +L ++L   FYAR ++KTP K  + ++V+  ++  GLF F+
Sbjct: 347 VVMTQQALVAYSVGLLGLILVKILAPGFYARQNIKTPVKIAVFTLVITQLMN-GLFIFV 404


>gi|229112679|ref|ZP_04242215.1| Virulence factor mviN [Bacillus cereus Rock1-15]
 gi|228670811|gb|EEL26119.1| Virulence factor mviN [Bacillus cereus Rock1-15]
          Length = 379

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 70/153 (45%), Gaps = 1/153 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
             + P LS       K + +     A++      +P T +++ L + II  L+ERG FT 
Sbjct: 150 TVVFPTLSELAARNEKGEFTNTLQNAVKMTSLVIVPITILIIALKEPIISILFERGKFTH 209

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T+  +  L  YS  ++      +    FY+  D KTP    IL +V+  V+ +    +
Sbjct: 210 EATLETAKVLLFYSPAMIFITFREIFNRSFYSLADTKTPMYISILGVVINIVLKLIFVQY 269

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDL 154
           +   GIA A    V + TI L +  LK +++ L
Sbjct: 270 LSLSGIALATSLSVMIVTI-LQMKYLKTKRVIL 301


>gi|298292240|ref|YP_003694179.1| integral membrane protein MviN [Starkeya novella DSM 506]
 gi|296928751|gb|ADH89560.1| integral membrane protein MviN [Starkeya novella DSM 506]
          Length = 516

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 76/147 (51%), Gaps = 1/147 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I  E+   +   ++RAIE  L   +P  A  L +P+ I++ L+ RGAFT + 
Sbjct: 284 LLPEMSRRIAAEDLDGARYAQSRAIELTLLLVLPFLAAALTIPEIIMRGLFLRGAFTGEA 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y   +  F+++R  +S FYAR D +TP    + + V+   + I L     
Sbjct: 344 AAAAGATLAAYGIGLAPFVVTRAFMSPFYARGDTRTPVLATLGAAVVNIALKIALMDQFA 403

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR 150
             G+A A     W+  I LAV L KRR
Sbjct: 404 QVGLAFATSVGGWITVIVLAV-LAKRR 429


>gi|91776562|ref|YP_546318.1| integral membrane protein MviN [Methylobacillus flagellatus KT]
 gi|91710549|gb|ABE50477.1| integral membrane protein MviN [Methylobacillus flagellatus KT]
          Length = 513

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS ++  + + + S L +  +   L   +P    L +L   ++ +L+  GAFT  D
Sbjct: 288 LLPSLSKSVADKAEHEYSSLLDWGLRLTLMLALPAAVALAVLSVPLVTSLFHYGAFTEHD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYAR +VKTP K  +++++
Sbjct: 348 VWMTRQALIAYSLGLLGLILVKVLAPGFYARQNVKTPVKIAVVTLI 393


>gi|167835688|ref|ZP_02462571.1| integral membrane protein MviN [Burkholderia thailandensis MSMB43]
          Length = 516

 Score = 55.5 bits (132), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    K +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAKPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|116330878|ref|YP_800596.1| mviN-related protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116124567|gb|ABJ75838.1| mviN-related protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 535

 Score = 55.5 bits (132), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 76/160 (47%), Gaps = 7/160 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           ++LP L   +Q   K   S LR     A+E+ LF  +P    ++ L   I+ ++Y  G +
Sbjct: 291 SILPAL---LQSLKKDGLSSLRRELAAALEFALFLTVPAAIGMVFLAGPILDSIYFGGKW 347

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
               T   +  L  YS  I  F ++++L+S +YA  D KTP +   +S  +  ++++ L 
Sbjct: 348 DRLATDTATQPLIFYSLAIPFFSINKILISSYYAFQDTKTPLRIQSVSFTINIILSLSLV 407

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
            F+    IA +      +    L +  LK+ +I  P+Q +
Sbjct: 408 WFLKHSAIALSSAVSAMITFFLLGI-FLKKHKIGFPWQEL 446


>gi|78067351|ref|YP_370120.1| virulence factor MVIN-like [Burkholderia sp. 383]
 gi|77968096|gb|ABB09476.1| Virulence factor MVIN-like protein [Burkholderia sp. 383]
          Length = 516

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQISNYVFVPLIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+  +      +N++ L + L KR
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIGLRKR 436


>gi|213026066|ref|ZP_03340513.1| virulence factor MviN [Salmonella enterica subsp. enterica serovar
           Typhi str. 404ty]
          Length = 125

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%)

Query: 33  FFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFY 92
              +P    L +L K +  +L++ G FTA D  +    L  YS  ++G ++ +VL   FY
Sbjct: 9   LLALPSAVALGILAKPLTVSLFQYGKFTAFDAAMTQRALIAYSVGLIGLIVVKVLAPGFY 68

Query: 93  ARNDVKTPAKFYILSIVM 110
           +R D+KTP K  I++++M
Sbjct: 69  SRQDIKTPVKIAIVTLIM 86


>gi|237752876|ref|ZP_04583356.1| virulence factor MviN [Helicobacter winghamensis ATCC BAA-430]
 gi|229375143|gb|EEO25234.1| virulence factor MviN [Helicobacter winghamensis ATCC BAA-430]
          Length = 479

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 65/128 (50%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           AL P ++  I+   ++++ +   ++   +L     CT   ++L  EII  L+ERG F  +
Sbjct: 292 ALFPIVAKFIKESKEKEALKALTKSFWLLLILLSICTLGGILLKNEIIWLLFERGKFMRE 351

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT++ +S    Y   ++ F LSR+     Y++N     AK    S++ G + ++ L  F 
Sbjct: 352 DTLICASVFGAYLIGLLPFGLSRIFSLWLYSQNKQALAAKISAFSLLTGTIFSLILMQFF 411

Query: 123 GGYGIATA 130
           G  G+A A
Sbjct: 412 GAVGLALA 419


>gi|218782243|ref|YP_002433561.1| integral membrane protein MviN [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763627|gb|ACL06093.1| integral membrane protein MviN [Desulfatibacillum alkenivorans
           AK-01]
          Length = 525

 Score = 55.1 bits (131), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 55/107 (51%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP  S     ++ +   +    AI  ++F  +P T  L++L + I+  L+ERGAF A+
Sbjct: 290 AALPSFSRQAANKDMEGLKDSFGYAIRIIMFVNLPATVGLIVLAQPIVGLLFERGAFGAE 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            TI  +  L  +   +     +R+++S  YA  D  TP +  ILS++
Sbjct: 350 ATIHTAQALIYFVLGLCAISGARIVVSMLYALQDTVTPVRVAILSLI 396


>gi|167561810|ref|ZP_02354726.1| integral membrane protein MviN [Burkholderia oklahomensis EO147]
 gi|167569033|ref|ZP_02361907.1| integral membrane protein MviN [Burkholderia oklahomensis C6786]
          Length = 516

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 97/226 (42%), Gaps = 7/226 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 351 VTMVARALAAYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+  +      +N+  L V  L+RR I  P     R       + L+   ++ +    
Sbjct: 411 TAGLTLSIGVGACLNSFLLFVG-LRRRGIYQPSPGWLRFFVQLTGASLVLAGVMHWLALN 469

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYS 229
           F+  +      PF+ +A++  GA LV     +L  G  +L   KY+
Sbjct: 470 FDWTAMRAV--PFERIALM--GACLVLFA--ALYFGMLWLMGFKYA 509


>gi|83953367|ref|ZP_00962089.1| putative virulence factor, MviN [Sulfitobacter sp. NAS-14.1]
 gi|83842335|gb|EAP81503.1| putative virulence factor, MviN [Sulfitobacter sp. NAS-14.1]
          Length = 530

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 2/133 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++Q S    +RA E  L   IP    L+++P  +   L++RGA T  D
Sbjct: 303 LLPDLSRRLKAGDEQGSHTQISRAAEVSLALTIPSAVALMVIPFTLATVLFQRGATTTDD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L ++L   +YAR D + P  F ++++V+  V+A+GL P IG
Sbjct: 363 AAAIAIAVAIYGLGLPAFVLQKILQPLYYAREDTRRPFYFAVVAMVVNVVLAVGLSPVIG 422

Query: 124 --GYGIATAEVSW 134
                IAT    W
Sbjct: 423 WIAPAIATTLAGW 435


>gi|319941610|ref|ZP_08015934.1| integral membrane protein MviN [Sutterella wadsworthensis 3_1_45B]
 gi|319804840|gb|EFW01694.1| integral membrane protein MviN [Sutterella wadsworthensis 3_1_45B]
          Length = 513

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 76/152 (50%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS+A    N+ + + L +  +  V+  G+P    L +  + ++  L++  +FT  D
Sbjct: 290 LLPSLSAAYAKGNEVRYNALLDHGLRLVVLVGVPAAVGLWLTAELLVSFLFQGRSFTPTD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               +  +  Y+  ++G +  +++   FYAR D++TP +  + S+V    I + + P   
Sbjct: 350 VHQTAIAVVGYAVGLIGLIGLKIIAPAFYARKDIRTPVRAAMASLVAVQAINLVVVPLFA 409

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A +      VN+  L + +L+RR I  P
Sbjct: 410 HAGLALSVGLGSLVNSGIL-LCVLRRRGIYSP 440


>gi|83944325|ref|ZP_00956780.1| putative virulence factor, MviN [Sulfitobacter sp. EE-36]
 gi|83844869|gb|EAP82751.1| putative virulence factor, MviN [Sulfitobacter sp. EE-36]
          Length = 530

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 2/133 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  ++  ++Q S    +RA E  L   IP    L+++P  +   L++RGA T  D
Sbjct: 303 LLPDLSRRLKAGDEQGSHTQISRAAEVSLALTIPSAVALMVIPFTLATVLFQRGATTTDD 362

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
              ++  ++IY   +  F+L ++L   +YAR D + P  F ++++V+  V+A+GL P IG
Sbjct: 363 AAAIAIAVAIYGLGLPAFVLQKILQPLYYAREDTRRPFYFAVVAMVVNVVLAVGLSPVIG 422

Query: 124 --GYGIATAEVSW 134
                IAT    W
Sbjct: 423 WIAPAIATTLAGW 435


>gi|70732628|ref|YP_262391.1| integral membrane protein MviN [Pseudomonas fluorescens Pf-5]
 gi|68346927|gb|AAY94533.1| integral membrane protein MviN [Pseudomonas fluorescens Pf-5]
          Length = 561

 Score = 55.1 bits (131), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++ + S + +  +       +PC+  L +L + +  +L++ G F+A D
Sbjct: 336 LLPTLAKTYASKDRHEYSRILDWGLRLCFILVLPCSLALGILAEPLTVSLFQYGEFSAFD 395

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  Y+  ++G ++ +VL   FYA+ +++TP K  I ++++
Sbjct: 396 ASMTQRALVAYAVGLLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLIV 442


>gi|242310190|ref|ZP_04809345.1| virulence factor MviN [Helicobacter pullorum MIT 98-5489]
 gi|239523487|gb|EEQ63353.1| virulence factor MviN [Helicobacter pullorum MIT 98-5489]
          Length = 469

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 4/130 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI--PCTAILLMLPKEIIQTLYERGAFT 60
           AL P ++    L+ KQ+   LR     + L   +   C    ++L KEII  L+ERG F 
Sbjct: 287 ALFPLVAK--YLKEKQEQKALRELVRSFWLLCVLLGACVIGGILLQKEIIWLLFERGQFG 344

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT+  ++  S Y   ++ F LSR+     Y++N     AK    S+ +G + ++ L  
Sbjct: 345 REDTLQTAAVFSAYMIGLLPFGLSRIFSLWLYSQNKQALAAKITAFSLGVGTIFSLVLMQ 404

Query: 121 FIGGYGIATA 130
           F+G  G+A A
Sbjct: 405 FLGAVGLALA 414


>gi|322807399|emb|CBZ04973.1| transmembrane protein involved in the export of teichoic acid
           lipoteichoic acids [Clostridium botulinum H04402 065]
          Length = 518

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 96/213 (45%), Gaps = 3/213 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      NK+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNNKKQYKMELGRAINIILIIMVPAAVGIATLREPLINVIFKRGAFSEDAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLIKYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
             L  ET  S    L  ++ G +  Y  SI LL
Sbjct: 467 LSLGNETKGSAISILICMIIGGI-SYTLSIYLL 498


>gi|257452003|ref|ZP_05617302.1| virulence factor mviN [Fusobacterium sp. 3_1_5R]
 gi|317058552|ref|ZP_07923037.1| virulence factor mviN [Fusobacterium sp. 3_1_5R]
 gi|313684228|gb|EFS21063.1| virulence factor mviN [Fusobacterium sp. 3_1_5R]
          Length = 486

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 1/173 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           + P LS A   ++  +      R +  +LF  +P   + ++  KE+I+ L+  G F    
Sbjct: 281 VFPSLSKAAAKKDYTKIQRELERGLNILLFLVVPSMVVCILYAKEVIRLLFSYGKFGEDA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  YS  +  ++  + L   FYA  D K PA++ I++IV+   +   L   + 
Sbjct: 341 VTITAQALLFYSIGLYAYVGVQFLSKGFYALGDNKRPARYSIMAIVINIALNALLIQKLE 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
             G+A A       N I L V    ++ I L F +  +I  + I++ L   FI
Sbjct: 401 YRGLALATSVASCCNFIAL-VFTFHKKYISLAFLSCIKIAMLSIAASLFAYFI 452


>gi|222528886|ref|YP_002572768.1| integral membrane protein MviN [Caldicellulosiruptor bescii DSM
           6725]
 gi|222455733|gb|ACM59995.1| integral membrane protein MviN [Caldicellulosiruptor bescii DSM
           6725]
          Length = 518

 Score = 54.7 bits (130), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 100/231 (43%), Gaps = 29/231 (12%)

Query: 14  LENKQQSSELRN------RAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILV 67
           L N Q   +  N       A+  ++   +P     ++L KEI + +Y+RG FT + T+L 
Sbjct: 293 LSNLQAKGDKENFRKFFVSALNSIILMMMPFAIGGVILSKEITRLIYQRGNFTIESTLLT 352

Query: 68  SSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGI 127
           +S L  Y    VG  L  +L    Y   D KT  K  +++I    V+ I         G 
Sbjct: 353 ASPLMFYCLGFVGLGLRDMLNRTLYVLKDSKTAVKNGVIAIACNIVLDIIFIYKFKHTGA 412

Query: 128 ATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIF----ISSGLMGMFIVFFKPCL 183
           A A  S  ++  + L ++L K+    L      RI  +F    ++S  MG+F+  FK   
Sbjct: 413 AMAFASANYIAAVLLFISLRKK----LGSIGWKRIAGVFVKALVASLAMGVFVYAFKQK- 467

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLKTDK 234
           F  L+      PFK  AI           S S+LLG G  A L Y LK ++
Sbjct: 468 FIYLTM-----PFKYFAI---------YTSASILLGMGIYAGLIYLLKVEE 504


>gi|229897458|ref|ZP_04512614.1| virulence factor mviN-like protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229693795|gb|EEO83844.1| virulence factor mviN-like protein [Yersinia pestis biovar
           Orientalis str. PEXU2]
          Length = 204

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 46/71 (64%)

Query: 40  AILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKT 99
            IL +L K +I +L++ G F+A DT++    L  YS  ++G ++ +VL   FY+R ++KT
Sbjct: 16  GILGILAKPLIVSLFQYGKFSAFDTLMTQRALVAYSVGLMGLIVVKVLAPGFYSRQNIKT 75

Query: 100 PAKFYILSIVM 110
           P K  I+++++
Sbjct: 76  PVKIAIITLIL 86


>gi|262277772|ref|ZP_06055565.1| integral membrane protein MviN [alpha proteobacterium HIMB114]
 gi|262224875|gb|EEY75334.1| integral membrane protein MviN [alpha proteobacterium HIMB114]
          Length = 509

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 95/214 (44%), Gaps = 1/214 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS  I  E +     ++NR++E  +F   P    +++  ++II  L+  G+F    
Sbjct: 283 VLPVLSKVIINETQNNVYFIQNRSVELSVFLSAPAAMGIIVGAEQIISCLFGYGSFDLDS 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L I+   +  F L ++  + ++AR D   P K  + ++V   +I+I  F   G
Sbjct: 343 INNTANALVIFGFGLPAFSLLKLYSNFYFARGDTNFPFKVSVFTVVTNILISIIFFKKYG 402

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
              IA       W+ T       LK+ +  L  +      S  I+S L+   I++F+   
Sbjct: 403 FLSIAAGTTISCWLATFIYKFN-LKKDKFHLSDKLFVERFSKIIASSLIMGAILYFQFFY 461

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
           F +    T+ S    L  ++  +++VY    SL 
Sbjct: 462 FREEFFSTSVSKVFYLFFVVGDSIIVYFLITSLF 495


>gi|320536987|ref|ZP_08036969.1| integral membrane protein MviN [Treponema phagedenis F0421]
 gi|320146156|gb|EFW37790.1| integral membrane protein MviN [Treponema phagedenis F0421]
          Length = 520

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 8/155 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP ++S    +N      L  +A + +    IP T   L+  + +I  +Y+   FT + 
Sbjct: 290 ILPDMTSYAMKKNWAAFQNLLIQATKIIALITIPATVFSLLSGEHVITLIYKNRTFTDES 349

Query: 64  TILVSSYLSIYSTEIVGFL---LSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL-F 119
             L    L  +   IVG     L+R++   FYA+ND K+P    I S  +  ++A+ L  
Sbjct: 350 VRLT---LDAFRWHIVGLFAIALNRIIAPAFYAQNDPKSPTIAGIASFAVNILLALTLVL 406

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDL 154
           P  GG GIA A       NTI L V L ++  ID+
Sbjct: 407 PMRGG-GIALALTLASIANTILLFVFLRRKETIDI 440


>gi|261400507|ref|ZP_05986632.1| integral membrane protein MviN [Neisseria lactamica ATCC 23970]
 gi|269209767|gb|EEZ76222.1| integral membrane protein MviN [Neisseria lactamica ATCC 23970]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHAANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|325202895|gb|ADY98349.1| integral membrane protein MviN [Neisseria meningitidis M01-240149]
 gi|325207306|gb|ADZ02758.1| integral membrane protein MviN [Neisseria meningitidis NZ-05/33]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|325131004|gb|EGC53731.1| integral membrane protein MviN [Neisseria meningitidis OX99.30304]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|316985208|gb|EFV64160.1| integral membrane protein MviN [Neisseria meningitidis H44/76]
 gi|325199481|gb|ADY94936.1| integral membrane protein MviN [Neisseria meningitidis H44/76]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|254674140|emb|CBA09924.1| putative virulence factor [Neisseria meningitidis alpha275]
          Length = 513

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|261391808|emb|CAX49263.1| putative MviN-like protein [Neisseria meningitidis 8013]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|253998231|ref|YP_003050294.1| integral membrane protein MviN [Methylovorus sp. SIP3-4]
 gi|253984910|gb|ACT49767.1| integral membrane protein MviN [Methylovorus sp. SIP3-4]
          Length = 512

 Score = 54.7 bits (130), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +   +   + S+L +  +       +P    L ++   ++ +L+  GAF+ QD
Sbjct: 287 LLPSLSKSFADKADGEYSQLLDWGLRLTFILALPAAVALAVIAVPLVASLFHYGAFSEQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FY+R D+KTP K  I +++
Sbjct: 347 VWMTRQALMAYSLGLLGMILVKVLAPAFYSRQDIKTPVKIAIFTLL 392


>gi|325143117|gb|EGC65464.1| integral membrane protein MviN [Neisseria meningitidis 961-5945]
 gi|325197562|gb|ADY93018.1| integral membrane protein MviN [Neisseria meningitidis G2136]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|254671561|emb|CBA09201.1| putative virulence factor [Neisseria meningitidis alpha153]
          Length = 513

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|15676201|ref|NP_273333.1| virulence factor MviN [Neisseria meningitidis MC58]
 gi|7225502|gb|AAF40731.1| virulence factor MviN [Neisseria meningitidis MC58]
          Length = 513

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|313200304|ref|YP_004038962.1| integral membrane protein mvin [Methylovorus sp. MP688]
 gi|312439620|gb|ADQ83726.1| integral membrane protein MviN [Methylovorus sp. MP688]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +   +   + S+L +  +       +P    L ++   ++ +L+  GAF+ QD
Sbjct: 287 LLPSLSKSFADKADGEYSQLLDWGLRLTFILALPAAVALAVIAVPLVASLFHYGAFSEQD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FY+R D+KTP K  I +++
Sbjct: 347 VWMTRQALMAYSLGLLGLILVKVLAPAFYSRQDIKTPVKIAIFTLL 392


>gi|325141114|gb|EGC63617.1| integral membrane protein MviN [Neisseria meningitidis CU385]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|307297302|ref|ZP_07577108.1| integral membrane protein MviN [Thermotogales bacterium
           mesG1.Ag.4.2]
 gi|306916562|gb|EFN46944.1| integral membrane protein MviN [Thermotogales bacterium
           mesG1.Ag.4.2]
          Length = 505

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 74/156 (47%), Gaps = 14/156 (8%)

Query: 5   LPKLSSAIQLENKQQSSELRNR-------AIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           LP+LS       K   S+ R+R       ++  + F  IP T  LL+L + I++ L+ERG
Sbjct: 284 LPRLS-------KLSGSDARDRFRKALWDSLTVLAFLIIPSTLGLLVLGEGIVRILFERG 336

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
           +FT  DT   +S L  Y+  +  +    VL   +YAR   +TP     + + +   + I 
Sbjct: 337 SFTPSDTAFTTSLLYGYTLGLPFYGSYGVLSRAYYARKSPRTPTIISAIMVSVNVALDIL 396

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQID 153
           L   IG  G+A A      V T+ ++VAL +    D
Sbjct: 397 LGFTIGPLGVALATSVAGIVGTVTVSVALFRWSGYD 432


>gi|161870786|ref|YP_001599959.1| inner membrane virulence factor protein [Neisseria meningitidis
           053442]
 gi|161596339|gb|ABX73999.1| inner membrane virulence factor protein [Neisseria meningitidis
           053442]
          Length = 498

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 273 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 333 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 378


>gi|115377079|ref|ZP_01464295.1| integral membrane protein MviN [Stigmatella aurantiaca DW4/3-1]
 gi|310821330|ref|YP_003953688.1| integral membrane protein mvin [Stigmatella aurantiaca DW4/3-1]
 gi|115365918|gb|EAU64937.1| integral membrane protein MviN [Stigmatella aurantiaca DW4/3-1]
 gi|309394402|gb|ADO71861.1| Integral membrane protein MviN [Stigmatella aurantiaca DW4/3-1]
          Length = 537

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGA 58
           AA LP+++ A     ++ ++ LR R       V FF +P  A  L +   +   L + G 
Sbjct: 278 AAELPEMARATGGATEEVNTRLRERIEAGARRVAFFVVPSAAAFLFIGDVVGAALLQTGR 337

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG- 117
           FTA D+  V   L   +  +V   + R+  S +YA  D  TP +F ++ + +G ++A G 
Sbjct: 338 FTAADSRYVWYLLMGSAVGLVSGTVGRIYSSTYYAMKDPATPLRFALVRVSLGALLAWGV 397

Query: 118 ---LFPFIG 123
              L P+IG
Sbjct: 398 GLHLAPWIG 406


>gi|261378508|ref|ZP_05983081.1| integral membrane protein MviN [Neisseria cinerea ATCC 14685]
 gi|269145057|gb|EEZ71475.1| integral membrane protein MviN [Neisseria cinerea ATCC 14685]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|224436532|ref|ZP_03657541.1| hypothetical protein HcinC1_01210 [Helicobacter cinaedi CCUG 18818]
          Length = 494

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 4/128 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAIL--LMLPKEIIQTLYERGAFT 60
           AL P ++ AI+  N +Q+  L+     +     I C  ++  +ML +EII  LYE G FT
Sbjct: 300 ALFPLVAKAIK--NNEQTKALQALKKSFWFLCVILCACVVGGVMLSEEIISLLYEWGNFT 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            ++TI+V+   S Y   +V F LSR+     Y+       AK   +S++ G   ++ L  
Sbjct: 358 KENTIIVAGVFSAYMIGLVPFGLSRIFSLWLYSHQMQGKAAKISAISLLCGIGFSLILMH 417

Query: 121 FIGGYGIA 128
             G  G+A
Sbjct: 418 PFGAMGLA 425


>gi|217966963|ref|YP_002352469.1| integral membrane protein MviN [Dictyoglomus turgidum DSM 6724]
 gi|217336062|gb|ACK41855.1| integral membrane protein MviN [Dictyoglomus turgidum DSM 6724]
          Length = 534

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+   L+   Q ++  Q     N+++   LFF IP +  L++L K I+Q  +ERGAF A 
Sbjct: 297 AIYTDLAFQAQSDDLDQFKNSLNKSLRAGLFFLIPASLGLILLAKPIVQLAFERGAFDAL 356

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T   S  L  YS  +    ++ +++  FYA +D +TP    I++++   V+       +
Sbjct: 357 ATKRTSEALIFYSLGLTFMSINIIIVRGFYALHDTRTPTMNSIIALLSNIVLNAIFIKPL 416

Query: 123 GGYGIATAEVSWVWVNTICLAVAL 146
              G+A A      ++TI L  +L
Sbjct: 417 AHMGLALATSLASLISTILLVRSL 440


>gi|325137103|gb|EGC59699.1| integral membrane protein MviN [Neisseria meningitidis M0579]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|313143035|ref|ZP_07805228.1| virulence factor MviN [Helicobacter cinaedi CCUG 18818]
 gi|313128066|gb|EFR45683.1| virulence factor MviN [Helicobacter cinaedi CCUG 18818]
          Length = 473

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 64/128 (50%), Gaps = 4/128 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAIL--LMLPKEIIQTLYERGAFT 60
           AL P ++ AI+  N +Q+  L+     +     I C  ++  +ML +EII  LYE G FT
Sbjct: 279 ALFPLVAKAIK--NNEQTKALQALKKSFWFLCVILCACVVGGVMLSEEIISLLYEWGNFT 336

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            ++TI+V+   S Y   +V F LSR+     Y+       AK   +S++ G   ++ L  
Sbjct: 337 KENTIIVAGVFSAYMIGLVPFGLSRIFSLWLYSHQMQGKAAKISAISLLCGIGFSLILMH 396

Query: 121 FIGGYGIA 128
             G  G+A
Sbjct: 397 PFGAMGLA 404


>gi|325135081|gb|EGC57709.1| integral membrane protein MviN [Neisseria meningitidis M13399]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|308388496|gb|ADO30816.1| virulence factor MviN [Neisseria meningitidis alpha710]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|304389103|ref|ZP_07371147.1| integral membrane protein MviN [Neisseria meningitidis ATCC 13091]
 gi|304336976|gb|EFM03166.1| integral membrane protein MviN [Neisseria meningitidis ATCC 13091]
          Length = 513

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|325128987|gb|EGC51838.1| integral membrane protein MviN [Neisseria meningitidis N1568]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|53724741|ref|YP_102195.1| integral membrane protein MviN [Burkholderia mallei ATCC 23344]
 gi|126439289|ref|YP_001057972.1| integral membrane protein MviN [Burkholderia pseudomallei 668]
 gi|166998446|ref|ZP_02264306.1| integral membrane protein MviN [Burkholderia mallei PRL-20]
 gi|167737447|ref|ZP_02410221.1| integral membrane protein MviN [Burkholderia pseudomallei 14]
 gi|167823038|ref|ZP_02454509.1| integral membrane protein MviN [Burkholderia pseudomallei 9]
 gi|167901590|ref|ZP_02488795.1| integral membrane protein MviN [Burkholderia pseudomallei NCTC
           13177]
 gi|167909830|ref|ZP_02496921.1| integral membrane protein MviN [Burkholderia pseudomallei 112]
 gi|167917856|ref|ZP_02504947.1| integral membrane protein MviN [Burkholderia pseudomallei BCC215]
 gi|254296380|ref|ZP_04963837.1| integral membrane protein MviN [Burkholderia pseudomallei 406e]
 gi|52428164|gb|AAU48757.1| integral membrane protein MviN [Burkholderia mallei ATCC 23344]
 gi|126218782|gb|ABN82288.1| integral membrane protein MviN [Burkholderia pseudomallei 668]
 gi|157806050|gb|EDO83220.1| integral membrane protein MviN [Burkholderia pseudomallei 406e]
 gi|243065502|gb|EES47688.1| integral membrane protein MviN [Burkholderia mallei PRL-20]
          Length = 516

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|284929609|ref|YP_003422131.1| hypothetical protein UCYN_10750 [cyanobacterium UCYN-A]
 gi|284810053|gb|ADB95750.1| integral membrane protein MviN [cyanobacterium UCYN-A]
          Length = 532

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 80/157 (50%), Gaps = 4/157 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    QL   +  +EL+ R  + +    +   P TAI + L  +II+ +Y+RGAF 
Sbjct: 298 LVPFMPIFSQLTAPENWNELKLRIRQGIFLSALTMLPLTAIFIALAPKIIRVIYQRGAFE 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
             D  +V+  L  Y   +  +L+  VL+  FYA  D +TP +  + +I + F++   L+ 
Sbjct: 358 MDDVFIVTPVLIAYGMGMFFYLVRDVLVRVFYALGDGETPFRISLFNIFLNFLLDFLLYK 417

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
             G  G+  A +  V + +I + + +L RR   LP +
Sbjct: 418 PFGTPGLVFATI-LVNLISILIFLVILNRRLQKLPIK 453


>gi|167844599|ref|ZP_02470107.1| integral membrane protein MviN [Burkholderia pseudomallei B7210]
          Length = 430

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 205 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 264

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 265 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 324

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 325 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 355


>gi|24214435|ref|NP_711916.1| MviN-like protein [Leptospira interrogans serovar Lai str. 56601]
 gi|45657917|ref|YP_002003.1| cytoplasmic membrane protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24195380|gb|AAN48934.1| MviN-related protein [Leptospira interrogans serovar Lai str.
           56601]
 gi|45601158|gb|AAS70640.1| cytoplasmic membrane protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 531

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 79/162 (48%), Gaps = 3/162 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L  +++ E      +    A+E+ LF  +P    +  L   I+ ++Y  G +    
Sbjct: 292 ILPALLQSLKKEEWSSIHQELAGALEFALFLTVPAALGMAFLAGPILDSIYFGGKWDHIA 351

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L  YS  I  F ++++L+S +YA  D KTP +   +S  +  ++ + L  F+ 
Sbjct: 352 THTATQPLVFYSIAIPFFSINKILISSYYAFQDTKTPLRIQSISFTINIILNLSLIWFLK 411

Query: 124 GYGIA-TAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILS 164
              IA ++ +S ++  T  L    LK+ +I  P+  +++ +S
Sbjct: 412 HSAIALSSAISAIF--TFLLLGIFLKKHKIGFPWIELFKKIS 451


>gi|325205362|gb|ADZ00815.1| integral membrane protein MviN [Neisseria meningitidis M04-240196]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    L +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGLAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|239906331|ref|YP_002953072.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239796197|dbj|BAH75186.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 63/145 (43%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP L+         +  +  N ++   LF  +P  A L+ L   +++ L+ RGAF     
Sbjct: 293 LPGLAKLASAGKTGEFVDTLNASLRLTLFICLPAAAGLIALADPMVRVLFGRGAFGEAAI 352

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
              +  L  Y   +  F   R L S ++A +D +TPA    + +V+  +  + L    G 
Sbjct: 353 AATAGALVAYGVGLPAFACVRPLYSAYFALSDTRTPAIVAAVCLVVYVIAGLALMGPTGH 412

Query: 125 YGIATAEVSWVWVNTICLAVALLKR 149
            G+A A     WVN   L + L K+
Sbjct: 413 VGLALATSISSWVNIAALGLVLRKK 437


>gi|330831175|ref|YP_004394127.1| integral membrane protein MviN [Aeromonas veronii B565]
 gi|328806311|gb|AEB51510.1| Integral membrane protein MviN [Aeromonas veronii B565]
          Length = 506

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 106/228 (46%), Gaps = 26/228 (11%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+      +    S   +  +  V+  G+P    + ++ + I++ L+ RG F   +
Sbjct: 282 ILPALAKKHVDADPADFSRTMDWGVRMVMLLGLPAMIGIAVMREPILRVLFMRGEFGLHE 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
             + S+ L   +T ++  +L +VL   +YAR D KTP +  ++S++   V   I ++P +
Sbjct: 342 VSMSSASLLASTTGLLSLMLIKVLAPGYYARQDTKTPVRIGVMSMIANMVCNLIFIYP-L 400

Query: 123 GGYGIATAEVSWVWVNTIC---LAVALLKRRQIDLPFQTIYR--------ILSIFISSGL 171
           G  G+A        ++T C   L  ALL +    L  Q++YR         L + ++S L
Sbjct: 401 GYVGLA--------LSTACSGTLNAALLFK---GLYQQSVYRPSRHTGVFCLKLLVASVL 449

Query: 172 MGMFIVFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLG 219
           MG  + +  P L  Q  A +       L ++LS    VY   + LLLG
Sbjct: 450 MGGVLAYLSPDL-AQWGAWSMGKASLQLTMLLSLGAAVY-AVVLLLLG 495


>gi|257459528|ref|ZP_05624637.1| integral membrane protein MviN [Campylobacter gracilis RM3268]
 gi|257442953|gb|EEV18087.1| integral membrane protein MviN [Campylobacter gracilis RM3268]
          Length = 465

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 2/130 (1%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVL-FFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+ P++S  ++  +  Q+  L  R   ++L   G+     + ML  EI Q L+ERG FT 
Sbjct: 283 AIFPRMSKFVKAHDDAQALALVERGFYFLLALLGLSAIGGV-MLRNEITQLLFERGEFTR 341

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           Q++I  ++ L  Y   +V F LSR+     YA    K  AK  I  + +   +    F  
Sbjct: 342 QNSIECAAVLGAYMVGLVPFGLSRIFSHWLYANMKQKLSAKISIWCVFINVALCALFFKP 401

Query: 122 IGGYGIATAE 131
            G  G+A A 
Sbjct: 402 FGAVGLAFAS 411


>gi|53718511|ref|YP_107497.1| MviN-like protein [Burkholderia pseudomallei K96243]
 gi|167814566|ref|ZP_02446246.1| integral membrane protein MviN [Burkholderia pseudomallei 91]
 gi|52208925|emb|CAH34864.1| MviN-like protein [Burkholderia pseudomallei K96243]
          Length = 516

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|301165875|emb|CBW25448.1| putative membrane protein [Bacteriovorax marinus SJ]
          Length = 522

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 68/157 (43%), Gaps = 2/157 (1%)

Query: 15  ENKQQSSELRNRAIEYVLFFG--IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLS 72
           +N ++   +   +  Y L F   +P  A+L  L KE I  ++ERGAF   DT +    L 
Sbjct: 307 KNSEKEKAINYLSTSYFLSFLTIVPAMALLFALAKESIHLVFERGAFDGHDTAMTYQALK 366

Query: 73  IYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEV 132
            Y   +  + L ++    F+A +  K P K  I SI    +  +   P  G + +A    
Sbjct: 367 YYLVGLPCYGLYKIFAPTFFALDRPKIPVKISIFSIFCNIIFCVYFTPKYGFWILALGTS 426

Query: 133 SWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISS 169
             + +N++  AV L     I   F    RIL I +S 
Sbjct: 427 LSMILNSVLQAVFLRNLLDISWSFFFKLRILKIIVSG 463


>gi|325267454|ref|ZP_08134110.1| integral membrane protein MviN [Kingella denitrificans ATCC 33394]
 gi|324981095|gb|EGC16751.1| integral membrane protein MviN [Kingella denitrificans ATCC 33394]
          Length = 525

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 73/152 (48%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      ++ + S L +  +   L   +P    L +L   ++ TL+    F+  D
Sbjct: 299 LLPNLSKHASANSQAEFSALLDWGLRLCLLLILPAAVGLAVLGFPLVATLFMYRQFSVHD 358

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  YS  +   +L R+L S FYA+ +VKTP K  ++S+    +  + L   + 
Sbjct: 359 AQMTHYALLAYSVGLPAMILPRILASGFYAQKNVKTPTKIALISLACTQLFNLILVWNLK 418

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+A A     WVN + L +++L+ R++  P
Sbjct: 419 HIGLALATALGAWVNALLL-LSMLRIRELYTP 449


>gi|121600325|ref|YP_992024.1| integral membrane protein MviN [Burkholderia mallei SAVP1]
 gi|254196335|ref|ZP_04902759.1| integral membrane protein MviN [Burkholderia pseudomallei S13]
 gi|254298204|ref|ZP_04965656.1| integral membrane protein MviN [Burkholderia pseudomallei 406e]
 gi|121229135|gb|ABM51653.1| integral membrane protein MviN [Burkholderia mallei SAVP1]
 gi|157808101|gb|EDO85271.1| integral membrane protein MviN [Burkholderia pseudomallei 406e]
 gi|169653078|gb|EDS85771.1| integral membrane protein MviN [Burkholderia pseudomallei S13]
          Length = 539

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 314 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 373

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 374 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 433

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 434 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 464


>gi|167718400|ref|ZP_02401636.1| integral membrane protein MviN [Burkholderia pseudomallei DM98]
          Length = 516

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|183598984|ref|ZP_02960477.1| hypothetical protein PROSTU_02430 [Providencia stuartii ATCC 25827]
 gi|188021201|gb|EDU59241.1| hypothetical protein PROSTU_02430 [Providencia stuartii ATCC 25827]
          Length = 511

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS +    N Q+   L +  +   L   +PC   L +L + +  +L++   FTA D
Sbjct: 287 LLPSLSKSFTSGNHQEYRHLMDWGLRLCLLLALPCAIGLAILSEALTVSLFQYDKFTAHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           +++    L  Y   + G +L ++L   FY+R D+KTP K  I+++++
Sbjct: 347 SLMTQYALMAYCVGLTGMILVKILAPGFYSRQDIKTPVKIAIVTLIL 393


>gi|224418858|ref|ZP_03656864.1| hypothetical protein HcanM9_06240 [Helicobacter canadensis MIT
           98-5491]
 gi|253828154|ref|ZP_04871039.1| Virulence factor mviN [Helicobacter canadensis MIT 98-5491]
 gi|313142375|ref|ZP_07804568.1| virulence factor MviN [Helicobacter canadensis MIT 98-5491]
 gi|253511560|gb|EES90219.1| Virulence factor mviN [Helicobacter canadensis MIT 98-5491]
 gi|313131406|gb|EFR49023.1| virulence factor MviN [Helicobacter canadensis MIT 98-5491]
          Length = 469

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 4/130 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELR--NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           AL P +  A  L+ K++S  LR  +R+   + F    C    ++L  EII  L+ERG F 
Sbjct: 287 ALFPLV--AKYLKEKEESKALRELSRSFWLLCFLLGACVIGGVLLQNEIIWLLFERGQFG 344

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +DT+  ++  S Y   ++ F LSR+     Y++N     AK    S+ +G + ++ L  
Sbjct: 345 REDTLETAAVFSAYMLGLLPFGLSRIFSLWLYSQNKQALAAKITAFSLGVGTICSLVLMR 404

Query: 121 FIGGYGIATA 130
           F G  G+A A
Sbjct: 405 FYGAVGLAIA 414


>gi|74317873|ref|YP_315613.1| virulence factor MVIN-like protein [Thiobacillus denitrificans ATCC
           25259]
 gi|74057368|gb|AAZ97808.1| virulence factor MVIN-like protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 2/130 (1%)

Query: 50  IQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           I TL+  GAFTA D  +    L  YS  +VG +L +VL   FYAR +++TP K  + ++V
Sbjct: 333 ITTLFHYGAFTAADVTMTQRALVAYSLGLVGLILVKVLAPGFYARQNIRTPVKIALFTLV 392

Query: 110 MGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRI-LSIFIS 168
              ++ +     +G  G+A A      +N   L + LLK++ I  P    +   L + ++
Sbjct: 393 ATQLMNLAFIVPLGHAGLALAIGLGACLNAGWL-LHLLKKQGIYRPQPGWFGYSLRLTVA 451

Query: 169 SGLMGMFIVF 178
            G+MG  + F
Sbjct: 452 VGIMGAALFF 461


>gi|77461075|ref|YP_350582.1| virulence factor MVIN-like [Pseudomonas fluorescens Pf0-1]
 gi|77385078|gb|ABA76591.1| putative membrane protein [Pseudomonas fluorescens Pf0-1]
          Length = 512

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 56/107 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+     +++ + S + +  +       +PC   L +L + +  +L++ G F+  D
Sbjct: 287 LLPTLAKTYASKDRHEYSRILDWGLRLCFVLVLPCALALGILAEPLTVSLFQYGQFSGFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             +    L  YS  ++G ++ +VL   FYA+ +++TP K  I ++V+
Sbjct: 347 AEMTQRALIAYSVGLLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLVV 393


>gi|82702165|ref|YP_411731.1| integral membrane protein MviN [Nitrosospira multiformis ATCC
           25196]
 gi|82410230|gb|ABB74339.1| integral membrane protein MviN [Nitrosospira multiformis ATCC
           25196]
          Length = 511

 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      +  + S L +  +   +   +P    L +L   +I TL+  G F+A D
Sbjct: 287 LLPSLSRHYADNSTDEYSRLLDWGLRLTMLLTLPAALALALLATPLITTLFHHGEFSAND 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +  + L  YS  ++G +L +VL   FYAR ++KTP K  ++++V
Sbjct: 347 VWMTRNALIAYSVGLLGLILVKVLAPGFYARQNIKTPVKIALITLV 392


>gi|282896195|ref|ZP_06304218.1| Virulence factor MVIN-like protein [Raphidiopsis brookii D9]
 gi|281198884|gb|EFA73762.1| Virulence factor MVIN-like protein [Raphidiopsis brookii D9]
          Length = 474

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 6/134 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAF 59
           +LLP  +   +L   Q   +L+ R  + ++   +   P   +++ L   I+Q +Y+RGAF
Sbjct: 303 SLLPMFA---KLAEPQSWPDLKLRIRQGIILTAVTMLPLGGLMIGLSTPIVQVVYQRGAF 359

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
             Q T LV+S L  Y   +  +L   VL+  FYA  D +TP K    +I +  V+   L 
Sbjct: 360 NQQATELVASLLIAYGIGMFAYLGRDVLVRVFYALGDGQTPFKISAFNIFLNVVLDFVLV 419

Query: 120 PFIGGYGIATAEVS 133
              G  G+  A V 
Sbjct: 420 KPFGAPGLVLATVG 433


>gi|309379768|emb|CBX21544.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|254427350|ref|ZP_05041057.1| integral membrane protein MviN [Alcanivorax sp. DG881]
 gi|196193519|gb|EDX88478.1| integral membrane protein MviN [Alcanivorax sp. DG881]
          Length = 521

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 72/145 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS     + +  S   + AI  VL  G+P    L  L + ++ TL++ G F+A D
Sbjct: 300 ILPSLSSKHADASPEAFSRTLDWAIRMVLLIGLPAALALFALAEPLLSTLFQYGEFSAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L  YS  ++  +L +VL   FYAR D +TP +  +L+++   ++   L     
Sbjct: 360 VTQTAASLRAYSAGLLAAMLIKVLAPGFYARQDTRTPVRIGVLAMLANMLLGALLVWEWR 419

Query: 124 GYGIATAEVSWVWVNTICLAVALLK 148
             G+A+A     W+N   L + L +
Sbjct: 420 HVGLASAMALSAWLNAGLLYLGLRR 444


>gi|28211856|ref|NP_782800.1| virulence factor mviN [Clostridium tetani E88]
 gi|28204298|gb|AAO36737.1| virulence factor mviN [Clostridium tetani E88]
          Length = 518

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS     ENK++     N++I  +L   +P    + +L + +I  +++RGAFT +   
Sbjct: 287 PTLSKLGNKENKKEYKIALNKSINMILLIMVPAAFGIAILREPLINIIFKRGAFTDEAAK 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           L S  L +Y+  ++ + +  +L   FYA  D KTP
Sbjct: 347 LTSQALLLYTPAMIAYGVRDILNKAFYAIKDTKTP 381


>gi|313669252|ref|YP_004049536.1| hypothetical protein NLA_19870 [Neisseria lactamica ST-640]
 gi|313006714|emb|CBN88184.1| putative inner membrane protein [Neisseria lactamica 020-06]
          Length = 513

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 288 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 348 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 393


>gi|167580069|ref|ZP_02372943.1| integral membrane protein MviN [Burkholderia thailandensis TXDOH]
 gi|167618135|ref|ZP_02386766.1| integral membrane protein MviN [Burkholderia thailandensis Bt4]
 gi|257140038|ref|ZP_05588300.1| integral membrane protein MviN [Burkholderia thailandensis E264]
          Length = 516

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLVVTQLSNYVFVPIIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|330813334|ref|YP_004357573.1| proposed peptidoglycan lipid II flippase MurJ [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486429|gb|AEA80834.1| proposed peptidoglycan lipid II flippase MurJ [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 511

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 80/171 (46%), Gaps = 4/171 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS  I       +  L+NR+IE  LF   P T  ++M  + II TL+  G+F  + 
Sbjct: 283 ILPSLSKEIFQNKDGNNFFLQNRSIELSLFLSAPATVGIIMATEPIISTLFGYGSFDLES 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L ++   +  F L ++  S ++AR + K P    +L++++  +I+I LF  +G
Sbjct: 343 VRQTSKALFVFGFGLPAFSLLKIYSSFYFARGNTKFPFYISVLTVIINILISIILFNRLG 402

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR--RQIDLPFQTIYRILSIFISSGLM 172
              IA       W   +     LL     + D  F T  R+  IF+ S +M
Sbjct: 403 FVSIALGTTISCWCAILIYQFFLLTNGMHKFDKIFAT--RVSKIFVCSFIM 451


>gi|325203393|gb|ADY98846.1| integral membrane protein MviN [Neisseria meningitidis M01-240355]
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|323343006|ref|ZP_08083237.1| MviN family protein [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463070|gb|EFY08265.1| MviN family protein [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 503

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 75/151 (49%), Gaps = 3/151 (1%)

Query: 1   MAALL-PKL-SSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGA 58
           MA +L P L  +A++ E +Q    +  + +  V    IP +  +++L K I+  L   G 
Sbjct: 275 MATVLYPTLVGNAVRNETEQLKGTV-TKILNVVNLLMIPASIGIMVLSKPIVMMLLGHGQ 333

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
           F  Q  ++  + L  Y+  +V F + +VL   FYA  D KTP +  ++S+V   ++ + L
Sbjct: 334 FDDQAIVVTGTILFFYALGLVAFGMRQVLTKTFYALEDTKTPVRIGVVSVVANILLNLVL 393

Query: 119 FPFIGGYGIATAEVSWVWVNTICLAVALLKR 149
              +G  G+A A     ++ ++ L  AL  R
Sbjct: 394 SKIMGVTGLALATTLAAFIGSLLLYNALRIR 424


>gi|218768941|ref|YP_002343453.1| putative inner membrane virulence factor protein [Neisseria
           meningitidis Z2491]
 gi|121052949|emb|CAM09303.1| putative inner membrane virulence factor protein [Neisseria
           meningitidis Z2491]
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|326386375|ref|ZP_08207998.1| integral membrane protein MviN [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209036|gb|EGD59830.1| integral membrane protein MviN [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 543

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S  +   ++  + E +NR +E  L   +P T  L++  + I   L+  G +T  D
Sbjct: 307 LLPTISRQLGAGDELDALETQNRGMELALLLTLPATMALVVCGEPIAVALFGYGRYTPAD 366

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           +   +  L+ +S  +  ++L +VL   FYAR D +TP +F ++S+ +  V
Sbjct: 367 SHFTAQALAAFSIGLPSYILVKVLTPGFYARQDTRTPVRFAMISMAVNLV 416


>gi|319411239|emb|CBY91646.1| putative MviN-like protein [Neisseria meningitidis WUE 2594]
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     ++ +Q S L +  +   +   +P    + +L   ++ TL+    FT  D
Sbjct: 287 LLPTLSKHSANQDTEQFSALLDWGLRLCMLLTLPAAVGMAVLSFPLVATLFMYREFTLFD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 347 AQMTQHALIAYSFGLIGLIMIKVLAPGFYARQNIKTPVKIAIFTLI 392


>gi|237739578|ref|ZP_04570059.1| integral membrane protein MviN [Fusobacterium sp. 2_1_31]
 gi|229423186|gb|EEO38233.1| integral membrane protein MviN [Fusobacterium sp. 2_1_31]
          Length = 495

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 87/173 (50%), Gaps = 8/173 (4%)

Query: 1   MAALLPKLSSAIQLENKQQSSELR---NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERG 57
           ++ L PK+S    L ++++ +EL+    + +  V+ F +P +  +++  KEII  ++ RG
Sbjct: 276 ISILFPKIS---LLVSERKINELKLYIKKTVNLVIIFCLPLSLWIMVYSKEIIAVVFGRG 332

Query: 58  AFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIG 117
            F      + S  L  Y++  +  +L  V+   +Y+  D KTP     + I++  V+ I 
Sbjct: 333 KFDENMIYITSKCLFYYTSGFIFMVLREVITKIYYSFKDTKTPVINSGIGIILNIVLNIV 392

Query: 118 LFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ-TIYRILSIFISS 169
           L  ++G  GIA A    + V TI L    LK++  D   Q  I+  L +F+ S
Sbjct: 393 LSIYMGISGIAFATSISLVVTTILLTYK-LKKKYGDFYIQEIIFTFLKVFVIS 444


>gi|189485477|ref|YP_001956418.1| cytoplasmic membrane protein MviN [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287436|dbj|BAG13957.1| cytoplasmic membrane protein MviN [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 513

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 74/149 (49%), Gaps = 4/149 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A LP +S A   ++        N +I + +F  +P  A L+++   I++ L+E G F   
Sbjct: 291 ASLPAMSKAYIQKDITALKNSLNYSIRFTVFILLPAAAGLMVIGLPIVKLLFEHGKFNYS 350

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PF 121
            +++  + L  YS  +  +  +++  + FY+  D K P K  I ++++  ++   L  P 
Sbjct: 351 GSLMTYNALFYYSLGLPAYGAAKIFANVFYSFQDTKMPVKIAISAMILHVILCFLLMRPM 410

Query: 122 -IGGYGIATAEVSWVWVNTICLAVALLKR 149
            +GG+ +ATA  S  + N   LA  L KR
Sbjct: 411 GVGGFALATAASS--YFNLFLLAAYLRKR 437


>gi|319786581|ref|YP_004146056.1| integral membrane protein MviN [Pseudoxanthomonas suwonensis 11-1]
 gi|317465093|gb|ADV26825.1| integral membrane protein MviN [Pseudoxanthomonas suwonensis 11-1]
          Length = 538

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 54/107 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS     +    S   +      +  G+P T  L++  + ++ TL++ G F  +D
Sbjct: 290 ILPHLSSRHASADPDGFSRGLDWGFRLCVLVGVPATLGLVLCAQPLVATLFQYGQFGPED 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
             + +  L   S  +  FLL +VL   FY+R D ++P +  ++S+++
Sbjct: 350 ARMSALSLVTQSLAVPAFLLVKVLAPAFYSRQDTRSPVRAAVVSVLV 396


>gi|83719259|ref|YP_441292.1| integral membrane protein MviN [Burkholderia thailandensis E264]
 gi|83653084|gb|ABC37147.1| integral membrane protein MviN [Burkholderia thailandensis E264]
          Length = 539

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 314 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 373

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +V+  +      P IG
Sbjct: 374 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLVVTQLSNYVFVPIIG 433

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 434 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 464


>gi|329904090|ref|ZP_08273668.1| putative peptidoglycan lipid II flippase MurJ [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327548144|gb|EGF32859.1| putative peptidoglycan lipid II flippase MurJ [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 516

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +       +P    L  L + +  TL+  G F A+ 
Sbjct: 291 LLPSLSKAHANGDAAEYSALLDWGMRLTFLLALPAAVGLATLSEPLTATLFHYGKFDARA 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +    L  Y   ++G ++ ++L   FYA+ D++TP K  I  ++   ++ +   P + 
Sbjct: 351 VSMTGQALIAYGVGLIGLIVVKILAPGFYAKQDIRTPVKIAIGVLIATQLMNLVFVPRLA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKR 149
             G+A +      +N I L + L +R
Sbjct: 411 LAGLALSIGLGACINAIFLYLGLRRR 436


>gi|110833318|ref|YP_692177.1| MviN family membrane protein [Alcanivorax borkumensis SK2]
 gi|110646429|emb|CAL15905.1| membrane protein, MviN family [Alcanivorax borkumensis SK2]
          Length = 521

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 72/145 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LSS     + +  S   + AI  VL  G+P    L  L + ++ TL++ G F+A D
Sbjct: 300 ILPSLSSKHADASAEAFSRTLDWAIRMVLLVGLPAALALFALAEPLLSTLFQYGEFSAFD 359

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L  YS  ++  +L +VL   FYAR D +TP +  +L+++   ++   L     
Sbjct: 360 VTKTAASLRAYSAGLLAAMLIKVLAPGFYARQDTRTPVRIGVLAMLANMLLGALLVWEWR 419

Query: 124 GYGIATAEVSWVWVNTICLAVALLK 148
             G+A+A     W+N   L + L +
Sbjct: 420 HVGLASAMALSAWLNAGLLYLGLRR 444


>gi|237811120|ref|YP_002895571.1| integral membrane protein MviN [Burkholderia pseudomallei MSHR346]
 gi|237503301|gb|ACQ95619.1| integral membrane protein MviN [Burkholderia pseudomallei MSHR346]
          Length = 592

 Score = 53.9 bits (128), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|157363360|ref|YP_001470127.1| integral membrane protein MviN [Thermotoga lettingae TMO]
 gi|157313964|gb|ABV33063.1| integral membrane protein MviN [Thermotoga lettingae TMO]
          Length = 480

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 93/176 (52%), Gaps = 16/176 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP +S+ +Q  +K+ +SE    +I   LF  +P    L+ L + +I  +Y+ GAFT +D
Sbjct: 275 VLPVISNEMQ-NSKKYTSE----SIRLSLFLTVPSAVGLMALSERLISLVYQHGAFTYED 329

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI--AIGLFPF 121
           TI  S+ L  YS  +  + +  VL    +A+ D++TP    ++S ++  V+   +GL   
Sbjct: 330 TIKTSAVLFYYSIGLPFYSIMAVLSRVCHAKKDMRTPFIATVISFIVNSVLDFVLGLTMN 389

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIV 177
           I G  +AT+      +  +C  + L  R +  + ++ I +IL   ++S  MG+ I+
Sbjct: 390 IIGIALATS------LAGLCGMIYLAFRIKPTIDWKHIAKIL---VASSAMGIIIM 436


>gi|164688707|ref|ZP_02212735.1| hypothetical protein CLOBAR_02354 [Clostridium bartlettii DSM
           16795]
 gi|164602183|gb|EDQ95648.1| hypothetical protein CLOBAR_02354 [Clostridium bartlettii DSM
           16795]
          Length = 512

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           PKLS  +  ++     ++  ++   ++   +P     ++L + I++ L ERG+F+A+ T 
Sbjct: 284 PKLSQFVNNKDTINFKKIIVKSSNCIILVVVPIVLGAIILAEPIVRVLLERGSFSAESTA 343

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           + S+ L +Y+  I+G+ +  +L   FY+  D KTP
Sbjct: 344 MTSNALKLYAIGIIGYAVKEILSRGFYSLGDTKTP 378


>gi|134279947|ref|ZP_01766659.1| integral membrane protein MviN [Burkholderia pseudomallei 305]
 gi|134249147|gb|EBA49229.1| integral membrane protein MviN [Burkholderia pseudomallei 305]
          Length = 592

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|261343880|ref|ZP_05971525.1| integral membrane protein MviN [Providencia rustigianii DSM 4541]
 gi|282568267|gb|EFB73802.1| integral membrane protein MviN [Providencia rustigianii DSM 4541]
          Length = 500

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N Q+   L +  +   L   +PC   L +L + +  +L++ G FTA D
Sbjct: 275 LLPSLAKSFTSGNHQEYRHLMDWGLRLCLLLALPCAVGLAILSEALTVSLFQYGNFTAHD 334

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           +++    L  Y   + G +L ++L   FY+R +++TP K  I+++++
Sbjct: 335 SLMTQYALMAYCVGLTGMILVKILAPGFYSRQNIRTPVKIAIVTLIL 381


>gi|254258778|ref|ZP_04949832.1| integral membrane protein MviN [Burkholderia pseudomallei 1710a]
 gi|254217467|gb|EET06851.1| integral membrane protein MviN [Burkholderia pseudomallei 1710a]
          Length = 592

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|149202527|ref|ZP_01879499.1| integral membrane protein MviN [Roseovarius sp. TM1035]
 gi|149143809|gb|EDM31843.1| integral membrane protein MviN [Roseovarius sp. TM1035]
          Length = 502

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 63/127 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP +     L ++     + +RA+   L  G+P   ++  L    ++ L+ RGAF    
Sbjct: 282 ILPDIGRRAGLGDEMGMRAVLDRALLICLAVGVPVAVMMATLGDWALRILFVRGAFDLAA 341

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               ++ L+ Y+  +V  L  R L++ F+ R D +TP +  + + V+   + I L P++G
Sbjct: 342 AEASAAILAAYALGLVPALALRSLVAGFHGRGDTRTPLRLLVAATVVNIALKIALTPWLG 401

Query: 124 GYGIATA 130
             G+A A
Sbjct: 402 AAGLAVA 408


>gi|254181540|ref|ZP_04888137.1| integral membrane protein MviN [Burkholderia pseudomallei 1655]
 gi|184212078|gb|EDU09121.1| integral membrane protein MviN [Burkholderia pseudomallei 1655]
          Length = 586

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 361 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 420

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 421 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 480

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 481 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 511


>gi|217420231|ref|ZP_03451737.1| integral membrane protein MviN [Burkholderia pseudomallei 576]
 gi|217397535|gb|EEC37551.1| integral membrane protein MviN [Burkholderia pseudomallei 576]
          Length = 592

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|32266015|ref|NP_860047.1| hypothetical protein HH0516 [Helicobacter hepaticus ATCC 51449]
 gi|32262064|gb|AAP77113.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 460

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 4/128 (3%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAIL--LMLPKEIIQTLYERGAFT 60
           AL P ++ AI+  NKQ    L      +     + C  +L  +ML +EII  LY+ G F+
Sbjct: 266 ALFPLVAKAIK--NKQADVALNALKKSFWFLLIVLCVCVLGGIMLSEEIISLLYQWGKFS 323

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           A DT++V+   S Y   +V F LS++     Y+       AK   +S+  G + ++ L  
Sbjct: 324 ADDTLIVAQVFSAYMIGLVPFGLSKIFSLWLYSHQMQGKAAKISAISLGCGVIFSLVLMH 383

Query: 121 FIGGYGIA 128
             G  G+A
Sbjct: 384 PFGAMGLA 391


>gi|237740783|ref|ZP_04571264.1| virulence factor mviN [Fusobacterium sp. 2_1_31]
 gi|229422800|gb|EEO37847.1| virulence factor mviN [Fusobacterium sp. 2_1_31]
          Length = 489

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     AI ++ F  IP   +L    K++I+ ++  G F    
Sbjct: 281 LFPSISRAAANGDKEDTNRRLVSAINFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEDA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VKITSECLLYYSLGLIFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|153004349|ref|YP_001378674.1| integral membrane protein MviN [Anaeromyxobacter sp. Fw109-5]
 gi|152027922|gb|ABS25690.1| integral membrane protein MviN [Anaeromyxobacter sp. Fw109-5]
          Length = 541

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 1/128 (0%)

Query: 27  AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRV 86
           A+ +V F  +P    L +L   II  +YE G F  +DT   +  L  Y+  +  +   +V
Sbjct: 330 AMRHVAFLNVPSAVGLAVLAGPIISMIYEHGRFGPEDTAATAQALVFYAVGLYAYSGVKV 389

Query: 87  LLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVAL 146
               FYA ++ + P    +L +     + + L+P +G  G+A        VN + LA+ +
Sbjct: 390 FAPAFYALDEARVPVVGSVLGMASNVALNVTLWPVLGFRGVALGTSLAAGVNFLVLAL-V 448

Query: 147 LKRRQIDL 154
            +RR   L
Sbjct: 449 WRRRHGGL 456


>gi|294782067|ref|ZP_06747393.1| integral membrane protein MviN [Fusobacterium sp. 1_1_41FAA]
 gi|294480708|gb|EFG28483.1| integral membrane protein MviN [Fusobacterium sp. 1_1_41FAA]
          Length = 489

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     AI ++ F  IP   +L    K++I+ ++  G F    
Sbjct: 281 LFPSISRAAANGDKEDTNRRLVSAINFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEDA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VKITSECLLYYSLGLIFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|167945188|ref|ZP_02532262.1| Virulence factor MVIN-like protein [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 134

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 32  LFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEF 91
           +  G+P    L +L    + TL+   AFT QD ++ S  L  Y+  ++  +L ++L   F
Sbjct: 1   MLLGMPAAVGLFVLAGPTLATLFHSAAFTKQDVLMSSYSLMAYAPGLMAIMLIKILAPGF 60

Query: 92  YARNDVKTPAKFYILSI 108
           YAR D +TP +  IL++
Sbjct: 61  YARQDTRTPVRIGILAM 77


>gi|126454372|ref|YP_001065205.1| integral membrane protein MviN [Burkholderia pseudomallei 1106a]
 gi|242314844|ref|ZP_04813860.1| integral membrane protein MviN [Burkholderia pseudomallei 1106b]
 gi|126228014|gb|ABN91554.1| integral membrane protein MviN [Burkholderia pseudomallei 1106a]
 gi|242138083|gb|EES24485.1| integral membrane protein MviN [Burkholderia pseudomallei 1106b]
          Length = 592

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|257066761|ref|YP_003153017.1| integral membrane protein MviN [Anaerococcus prevotii DSM 20548]
 gi|256798641|gb|ACV29296.1| integral membrane protein MviN [Anaerococcus prevotii DSM 20548]
          Length = 507

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 2/144 (1%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           IP T  +++L   II+  +ER AFT  DT++V+S +  Y+  I+   + ++  + FYA  
Sbjct: 313 IPATLGMMVLSNPIIKLAFERNAFTTSDTVVVASLMRAYAPYIIFISVIKIFTNAFYAVG 372

Query: 96  DVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKR-RQIDL 154
           + K P    ++  ++ F++   L  F    G+A A      + +  L  A  KR  ++D 
Sbjct: 373 ESKLPVVIILIQQIVNFILNFILIRFWSLNGLAFATAISTAIGSAMLVCAFYKRFGRVDS 432

Query: 155 PFQTIYRILSIFISSGLMGMFIVF 178
             + I   L I ISS +M +   F
Sbjct: 433 K-ENIQSTLKILISSIIMAVIAYF 455


>gi|170698608|ref|ZP_02889676.1| integral membrane protein MviN [Burkholderia ambifaria IOP40-10]
 gi|170136461|gb|EDT04721.1| integral membrane protein MviN [Burkholderia ambifaria IOP40-10]
          Length = 516

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSSLLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQLSNYAFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|124385878|ref|YP_001028471.1| integral membrane protein MviN [Burkholderia mallei NCTC 10229]
 gi|126449291|ref|YP_001079706.1| integral membrane protein MviN [Burkholderia mallei NCTC 10247]
 gi|238561658|ref|ZP_00441619.2| integral membrane protein MviN [Burkholderia mallei GB8 horse 4]
 gi|254176817|ref|ZP_04883474.1| integral membrane protein MviN [Burkholderia mallei ATCC 10399]
 gi|254187498|ref|ZP_04894010.1| integral membrane protein MviN [Burkholderia pseudomallei Pasteur
           52237]
 gi|254203875|ref|ZP_04910235.1| integral membrane protein MviN [Burkholderia mallei FMH]
 gi|254208856|ref|ZP_04915204.1| integral membrane protein MviN [Burkholderia mallei JHU]
 gi|254360089|ref|ZP_04976359.1| integral membrane protein MviN [Burkholderia mallei 2002721280]
 gi|124293898|gb|ABN03167.1| integral membrane protein MviN [Burkholderia mallei NCTC 10229]
 gi|126242161|gb|ABO05254.1| integral membrane protein MviN [Burkholderia mallei NCTC 10247]
 gi|147745387|gb|EDK52467.1| integral membrane protein MviN [Burkholderia mallei FMH]
 gi|147750732|gb|EDK57801.1| integral membrane protein MviN [Burkholderia mallei JHU]
 gi|148029329|gb|EDK87234.1| integral membrane protein MviN [Burkholderia mallei 2002721280]
 gi|157935178|gb|EDO90848.1| integral membrane protein MviN [Burkholderia pseudomallei Pasteur
           52237]
 gi|160697858|gb|EDP87828.1| integral membrane protein MviN [Burkholderia mallei ATCC 10399]
 gi|238524075|gb|EEP87510.1| integral membrane protein MviN [Burkholderia mallei GB8 horse 4]
          Length = 592

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 367 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 426

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 427 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 486

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 487 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 517


>gi|297621785|ref|YP_003709922.1| Virulence factor mviN-like protein [Waddlia chondrophila WSU
           86-1044]
 gi|297377086|gb|ADI38916.1| Virulence factor mviN-like protein [Waddlia chondrophila WSU
           86-1044]
          Length = 449

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           +ALLP LS A++ +  ++  +     +   L+  IPCT  L+ L K  I  +Y  G FT 
Sbjct: 283 SALLPPLSRALENKEYEKYRKFLRYCLSRTLYLMIPCTLGLIFLGKWGISLVYGHGHFTQ 342

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           +     +  LS Y+  ++   L  +    FYA+N+   P+     S+VM   +   LF  
Sbjct: 343 ESINSTNLCLSGYAVGLIPMALVLIYAPAFYAKNNYFIPSATSTFSVVMNIALNT-LFVS 401

Query: 122 IGGYG---IATAEVSWVWVNTICLAV 144
             GYG   +A A     W N + LA+
Sbjct: 402 YLGYGPASVAYATSLSAWANFVLLAL 427


>gi|307543904|ref|YP_003896383.1| virulence factor [Halomonas elongata DSM 2581]
 gi|307215928|emb|CBV41198.1| K03980 virulence factor [Halomonas elongata DSM 2581]
          Length = 541

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 92/187 (49%), Gaps = 4/187 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS     ++++  +++ + AI  VL  G+P    L++L + ++ TL+  GA T  D
Sbjct: 318 ILPALSKRHAEQSREHFAQMLDWAIRAVLLLGLPAALALVVLAEPLLITLFHYGAMTDHD 377

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  Y+  +V F+L +VL   F+A+ D KTP    ++++    V  + L   + 
Sbjct: 378 IDMAAMSLRAYAVGLVAFMLIKVLAPGFFAQQDTKTPVTIGMIAMGANMVFNLILIWPLA 437

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSG--LMGMFIVFFKP 181
             G+A A     ++N   L   LL RR + L FQ  +   ++ +  G   MG+ +V+  P
Sbjct: 438 HAGLALATALSAFLNAGLLG-RLLHRRGV-LIFQAGWGRYAVQLLGGCMAMGLALVWLAP 495

Query: 182 CLFNQLS 188
                L 
Sbjct: 496 DWHQWLD 502


>gi|220936371|ref|YP_002515270.1| integral membrane protein MviN [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997681|gb|ACL74283.1| integral membrane protein MviN [Thioalkalivibrio sp. HL-EbGR7]
          Length = 518

 Score = 53.5 bits (127), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 58/115 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS        +  +   + A++  L   +P    L+ L   I+ +L +   FTA D
Sbjct: 289 ILPRLSREHAARTPEAFNNTLDWALKLTLVVAVPAMLGLIFLAGPILASLIQYREFTAFD 348

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
           T + +  L  Y+  +  F+L ++L   +Y+R D +TP K  I++++   V+ + +
Sbjct: 349 TTMAAMSLMAYAAGLPAFMLIKILAPGYYSRQDTRTPVKIGIIAMLANMVLNVAI 403


>gi|76810322|ref|YP_332488.1| integral membrane protein MviN [Burkholderia pseudomallei 1710b]
 gi|226192873|ref|ZP_03788486.1| integral membrane protein MviN [Burkholderia pseudomallei Pakistan
           9]
 gi|76579775|gb|ABA49250.1| integral membrane protein MviN [Burkholderia pseudomallei 1710b]
 gi|225935123|gb|EEH31097.1| integral membrane protein MviN [Burkholderia pseudomallei Pakistan
           9]
          Length = 606

 Score = 53.5 bits (127), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F A  
Sbjct: 381 LLPSLSKAHVDADSTEYSALLDWGLRVTFLLAAPSALALFFFAEPLTATLFNYGKFDAHT 440

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +V+  +      P IG
Sbjct: 441 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLVVTQLSNYVFVPIIG 500

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 501 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 531


>gi|262066747|ref|ZP_06026359.1| integral membrane protein MviN [Fusobacterium periodonticum ATCC
           33693]
 gi|291379550|gb|EFE87068.1| integral membrane protein MviN [Fusobacterium periodonticum ATCC
           33693]
          Length = 503

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +  L PKL+S I L+   +  E    +I Y+L   +P T + L+  KEI+  ++ RG F 
Sbjct: 277 ITVLFPKLASCIALKKNNELKEYIEISIGYILIVSLPITFMALIFSKEIVTIVFGRGEF- 335

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA 101
            +D  L ++ LS Y+   +   +  +++  FY+  D  TP 
Sbjct: 336 -KDIELTTTSLSFYTIAFLPIAVRELIVRVFYSFKDTVTPV 375


>gi|186475300|ref|YP_001856770.1| integral membrane protein MviN [Burkholderia phymatum STM815]
 gi|184191759|gb|ACC69724.1| integral membrane protein MviN [Burkholderia phymatum STM815]
          Length = 516

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 67/152 (44%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L    + +  TL+  G F    
Sbjct: 291 LLPSLSKAHVDADAHEYSSLLDWGLRVTFLLAAPSAVALFFFAEPLTATLFHYGKFDGNA 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
            ++V   L+ Y   ++G +L ++L   FYA+ D+KTP K  +  +V+  +      P   
Sbjct: 351 VVMVGRALAAYGVGLIGLILIKILAPGFYAKQDIKTPVKIGVFVLVVTQLSNYVFVPVFA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      VN +CL +  L+RR I +P
Sbjct: 411 HAGLTLSVGLGACVNALCLFIG-LRRRGIYMP 441


>gi|258546123|ref|ZP_05706357.1| integral membrane protein MviN [Cardiobacterium hominis ATCC 15826]
 gi|258518548|gb|EEV87407.1| integral membrane protein MviN [Cardiobacterium hominis ATCC 15826]
          Length = 512

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 96/209 (45%), Gaps = 2/209 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS+    +N  Q     + A+ +    G      L++L   II  L   G F A  
Sbjct: 291 ILPRLSALRAADNDAQFVRTLDWALRWGFLVGSAAAVGLIVLAPSIIAGLLYGGRFDAHY 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + +  L  Y    +  ++ +VL   FYAR+D KTP K  I ++++  V A+ L  +  
Sbjct: 351 VEMTTLSLRAYGIGALFHIMVKVLAPAFYARHDTKTPVKAGISAMLLNIVFALILSRYYA 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A       N + L +  L+R  + L   +++  L +  ++  +   +++ +   
Sbjct: 411 HVGLAAASSFAALAN-MSLLLYFLRREGVSLKTGSLWFFLRVLFANAALASILLYLQGDA 469

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLC 212
            + L A+TAF   ++L +++    + Y+ 
Sbjct: 470 ADWL-AKTAFMRLRDLLLLVGIGGMSYIA 497


>gi|255067276|ref|ZP_05319131.1| integral membrane protein MviN [Neisseria sicca ATCC 29256]
 gi|255048427|gb|EET43891.1| integral membrane protein MviN [Neisseria sicca ATCC 29256]
          Length = 512

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +N +Q S L +  +   +   +P T  + +L   ++ TL+    F+  D
Sbjct: 286 LLPTLSKHAVNQNTEQFSGLLDWGLRLCMLLALPATVGVAVLSFPLLATLFMSSKFSLFD 345

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L   S  I+G ++ +VL   FYAR ++KTP K  I +++
Sbjct: 346 AQMTQQALIANSVGILGSIMVKVLAPGFYARQNIKTPVKIAIFTLI 391


>gi|33519908|ref|NP_878740.1| virulence factor MviN [Candidatus Blochmannia floridanus]
 gi|33504253|emb|CAD83516.1| virulence factor MviN [Candidatus Blochmannia floridanus]
          Length = 518

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS  I   N  +   L N  I+    F +P   IL +L K +I TL++ G F+  D
Sbjct: 288 LLPCLSKFIARGNDTEYINLINWGIKLCCIFSLPSAFILGLLSKPLIITLFQYGKFSEWD 347

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARND 96
            ++    +  YS  + G +L ++L + FY+R D
Sbjct: 348 VLMTQYSVIAYSVGLPGLILVKILTAGFYSRYD 380


>gi|172036910|ref|YP_001803411.1| virulence factor MviN-like protein [Cyanothece sp. ATCC 51142]
 gi|171698364|gb|ACB51345.1| virulence factor MviN-like protein [Cyanothece sp. ATCC 51142]
          Length = 536

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   II+ +Y+RGAF 
Sbjct: 302 LVPFMPVFSRLTAPENWPELKVRIRQGLLLTALTMLPLTAIFIALAPVIIRVIYQRGAFK 361

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM-GFVIAIGLF 119
           + D  +V   L  Y   +  +L   VL+  FYA  D +TP +  I +I + GF+  +   
Sbjct: 362 SADADMVIPVLMAYGIGMFFYLARDVLVRVFYALGDGETPFRISIFNIFLNGFLDFVLYK 421

Query: 120 PF-IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
           PF   G  +AT  V+ V   ++ + +A+L +R   LP +
Sbjct: 422 PFKTPGLVLATIGVNLV---SLIIFIAILNKRLGGLPLK 457


>gi|303233723|ref|ZP_07320377.1| integral membrane protein MviN [Finegoldia magna BVS033A4]
 gi|302495157|gb|EFL54909.1| integral membrane protein MviN [Finegoldia magna BVS033A4]
          Length = 508

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 77/162 (47%), Gaps = 9/162 (5%)

Query: 16  NKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYS 75
           NK + S +++ ++  +L   IP T  LL+L   I + L+ RGAFT  D  + S  +  Y+
Sbjct: 295 NKMKDSIMKSMSMICILV--IPATIGLLVLSYPITKMLFFRGAFTMNDVDMTSVCMFFYA 352

Query: 76  TEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWV 135
             I+G  +  +L   FYA ND KTP     + + +  +  I L   +G  G+A A     
Sbjct: 353 LGIIGTAIRDILSKSFYAMNDTKTPTINSAIMVAINIIGNIILSRILGLVGLAVATSFAN 412

Query: 136 WVNTICLAVALLKR----RQIDLPFQTIYRILSIFISSGLMG 173
            +    + + L K+          F  I+++L   ISS +MG
Sbjct: 413 LIGAAMIIIRLHKKIGDFSSTKSSFVNIFKML---ISSLIMG 451


>gi|299143752|ref|ZP_07036832.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 386
           str. F0131]
 gi|298518237|gb|EFI41976.1| integral membrane protein MviN [Peptoniphilus sp. oral taxon 386
           str. F0131]
          Length = 498

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           +P +  L +  + I++ L+  GAF+ QD    +  LS+Y+  I+G     ++   FY   
Sbjct: 309 VPASVGLFLFSEPIVKILFVGGAFSKQDATSTAIILSLYAIGIIGIGFREIISRVFYTIM 368

Query: 96  DVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
           D KTP    ++ + +  V++  L   +G  G+A A         + + ++L KR      
Sbjct: 369 DAKTPVINSVVMVAINVVLSFILINNLGPRGLALATSISFMAGAVLILISLRKRMGRIFS 428

Query: 156 FQTIYRILSIFISSGLMGM 174
             T+  I+ I I++ +MG+
Sbjct: 429 ADTVREIIKIIIATAVMGI 447


>gi|282901421|ref|ZP_06309346.1| Virulence factor MVIN-like protein [Cylindrospermopsis raciborskii
           CS-505]
 gi|281193700|gb|EFA68672.1| Virulence factor MVIN-like protein [Cylindrospermopsis raciborskii
           CS-505]
          Length = 538

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           LLP L    +L   Q   +L+ R  + ++   +   P   +++ L   I+Q +Y+RGAF 
Sbjct: 301 LLPLLPMFAKLAEPQSWPDLKLRIRQGIILTAVTMLPLGGLMIGLSTPIVQVVYQRGAFN 360

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            + T LV+S L  Y   +  +L   VL+  FYA  D +TP K    +I +  V+   L  
Sbjct: 361 QEATELVASLLIAYGIGMFVYLGRDVLVRVFYALGDGQTPFKISTFNIFLNAVLDFVLVK 420

Query: 121 FIGGYGIATAEVS 133
             G  G+  A V 
Sbjct: 421 PFGAPGLVLATVG 433


>gi|85714193|ref|ZP_01045182.1| virulence factor MVIN-like [Nitrobacter sp. Nb-311A]
 gi|85699319|gb|EAQ37187.1| virulence factor MVIN-like [Nitrobacter sp. Nb-311A]
          Length = 519

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 94/207 (45%), Gaps = 1/207 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L+P+++ A+   ++       +R IE      +P    L++L + I++ L+E GAFTA D
Sbjct: 285 LVPEITRALTKGDRAAMVNAESRGIELAAALALPAAIGLIVLSEPIVRVLFEHGAFTAAD 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T   +  L      +  +++ + L   F+AR +  TP    +  I +  V+A+ L    G
Sbjct: 345 TRATALTLGCLGFGLPAYVVIKALSPAFFARGNTMTPLMATLKGIAVAMVLALVLERPFG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A     W + + L  ++       +  +   R+  I +++ +MG  +++    L
Sbjct: 405 VAGIAVAVALGAWSSAVSLIRSIAATFGFSIDAEARRRLPRIGLAAFVMG-GVLWLAVRL 463

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVY 210
              +S          LA++++  V +Y
Sbjct: 464 AGPVSGANGLLQAATLAVLIAAGVAIY 490


>gi|210622236|ref|ZP_03293026.1| hypothetical protein CLOHIR_00973 [Clostridium hiranonis DSM 13275]
 gi|210154370|gb|EEA85376.1| hypothetical protein CLOHIR_00973 [Clostridium hiranonis DSM 13275]
          Length = 514

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A + P+ S    L ++ +  +   ++I  V+   +P T   ++L + I++ L++RGAF A
Sbjct: 281 AVVYPQFSRLSALVDRTEFFDFIRKSINSVIIIIMPMTIGAMVLSEPIVRILFQRGAFDA 340

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T + +  L  YS  ++G  L  +L   FY+  D KTP     +++VM   + +    +
Sbjct: 341 RATQMTAVALIFYSIGLIGVGLRDILTKIFYSVQDTKTPMINATIAVVMNICMNLLFIRY 400

Query: 122 IGGYGIATA 130
           +   G+A A
Sbjct: 401 LKHAGLALA 409


>gi|187778259|ref|ZP_02994732.1| hypothetical protein CLOSPO_01851 [Clostridium sporogenes ATCC
           15579]
 gi|187771884|gb|EDU35686.1| hypothetical protein CLOSPO_01851 [Clostridium sporogenes ATCC
           15579]
          Length = 518

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 82/172 (47%), Gaps = 2/172 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNDKKQYKVELGRAINIILIIMVPAAVGIATLREPLINVIFKRGAFSEDAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L S  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI + L  ++G  
Sbjct: 348 LTSQVLLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINVLLIKYLGVR 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFI 176
           G+  A     +V TI + + L K+   ID+    I   L + +S+  MG+ +
Sbjct: 408 GLTLATSISAFVITIVMLLDLNKKLNGIDIK-NIIISFLKVILSALFMGIIV 458


>gi|302039592|ref|YP_003799914.1| virulence factor MviN-like protein [Candidatus Nitrospira defluvii]
 gi|300607656|emb|CBK43989.1| Virulence factor MviN homolog [Candidatus Nitrospira defluvii]
          Length = 542

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           A+LP LS+      +    ELR      +  + F  +P    L++L   I+  ++E G+F
Sbjct: 303 AILPTLSAQ---AARGALDELRTTIGFGLRMIFFIILPAMVGLILLRHPIVHLVFEHGSF 359

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA 101
           T  DT+  ++ L  Y+  +  F   R+++S FY+  D +TPA
Sbjct: 360 TKADTLATATALLCYAVGLWAFAGVRIIVSAFYSLQDTRTPA 401


>gi|81300850|ref|YP_401058.1| integral membrane protein MviN [Synechococcus elongatus PCC 7942]
 gi|81169731|gb|ABB58071.1| integral membrane protein MviN [Synechococcus elongatus PCC 7942]
          Length = 540

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 77/166 (46%), Gaps = 21/166 (12%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKE--------IIQT 52
           +  LLP LS   +L    Q  EL+ R I   LF     TA+L++            I+Q 
Sbjct: 303 LVPLLPVLS---RLAEPDQWPELKQR-IRQGLFL----TALLMLPLGALMAALALPIVQL 354

Query: 53  LYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF 112
           +YERGAF    T LV++ L  YS  +  +L   VL+  FYA  D +TP +  +++I +  
Sbjct: 355 VYERGAFQTDATDLVAALLVAYSIGMFVYLGRDVLVRVFYALGDGQTPFRISMINIFLNA 414

Query: 113 VIAIGLFPFIGGYGIATAEVSWVWVNTICLAVAL--LKRRQIDLPF 156
           +    L    G  G+  A VS   VN I L   L  L RR   LP 
Sbjct: 415 LFDWLLIGPFGATGLVLATVS---VNIISLIALLWILHRRLGGLPL 457


>gi|126658384|ref|ZP_01729533.1| hypothetical protein CY0110_27530 [Cyanothece sp. CCY0110]
 gi|126620316|gb|EAZ91036.1| hypothetical protein CY0110_27530 [Cyanothece sp. CCY0110]
          Length = 532

 Score = 53.1 bits (126), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   II+ +Y+RGAF 
Sbjct: 298 LVPFMPVFSRLTAPENWPELKVRIRQGLLLTALTMLPLTAIFIALADVIIRVIYQRGAFK 357

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM-GFVIAIGLF 119
           + D  +V   L  Y   +  +L   VL+  FYA  D +TP +  I +I + GF+  I   
Sbjct: 358 SADADMVIPVLMTYGIGMFFYLARDVLVRVFYALGDGETPFRISIFNIFLNGFLDFILYK 417

Query: 120 PF-IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
           PF   G  +AT  V+ V   ++ + + +L +R   LP +
Sbjct: 418 PFKTPGLVLATIGVNLV---SLIIFIGILNKRLGGLPLK 453


>gi|30250330|ref|NP_842400.1| virulence factor MVIN-like [Nitrosomonas europaea ATCC 19718]
 gi|30181125|emb|CAD86317.1| Virulence factor MVIN-like [Nitrosomonas europaea ATCC 19718]
          Length = 509

 Score = 52.8 bits (125), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      + ++ S L +  +       +P    L +L   +I TL+  GAFT +D
Sbjct: 287 ILPSLSRHYTQNSTEEFSRLLDWGLRLTFLLTLPAAVALALLATPLITTLFYYGAFTVED 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
             +    L  YS  ++G +L +VL   FYAR ++KTP K  IL++
Sbjct: 347 VWMTREALIAYSVGLLGLILVKVLAPGFYARQNIKTPVKVAILTL 391


>gi|226950525|ref|YP_002805616.1| integral membrane protein MviN [Clostridium botulinum A2 str.
           Kyoto]
 gi|226840985|gb|ACO83651.1| integral membrane protein MviN [Clostridium botulinum A2 str.
           Kyoto]
          Length = 518

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 2/187 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS  +   +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELVAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSENAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLINYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAET 191
             L  ET
Sbjct: 467 LSLGNET 473


>gi|124516139|gb|EAY57647.1| putative integral membrane protein MviN [Leptospirillum rubarum]
          Length = 544

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 1/121 (0%)

Query: 4   LLPKLS-SAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           LLP LS   ++    +QS +    A    LFF +P TA L+ L   +I+ L+E G+F A+
Sbjct: 310 LLPVLSRQRLESGGAEQSIQTLAEAYRLSLFFMLPATAGLVALGDPLIKLLFEHGSFAAR 369

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            T++    L  Y+  +  F   R+L+  +YA  D + P       ++    ++  L+  I
Sbjct: 370 STVMTREALWGYALGLWSFSGVRILVRVYYAHQDTRFPVWAAFWGLLTNLALSAALYRSI 429

Query: 123 G 123
           G
Sbjct: 430 G 430


>gi|148381046|ref|YP_001255587.1| integral membrane protein MviN [Clostridium botulinum A str. ATCC
           3502]
 gi|153934159|ref|YP_001385417.1| integral membrane protein MviN [Clostridium botulinum A str. ATCC
           19397]
 gi|153936791|ref|YP_001388824.1| integral membrane protein MviN [Clostridium botulinum A str. Hall]
 gi|148290530|emb|CAL84658.1| capsular polysaccharide biosynthesis protein [Clostridium botulinum
           A str. ATCC 3502]
 gi|152930203|gb|ABS35703.1| integral membrane protein MviN [Clostridium botulinum A str. ATCC
           19397]
 gi|152932705|gb|ABS38204.1| integral membrane protein MviN [Clostridium botulinum A str. Hall]
          Length = 518

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 96/213 (45%), Gaps = 3/213 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSENAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLIKYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
             L  ET  S    L  ++ G +  Y  SI LL
Sbjct: 467 LSLGNETKGSAISILICMIIGGI-SYTLSIYLL 498


>gi|294506391|ref|YP_003570449.1| integral membrane protein MviN [Salinibacter ruber M8]
 gi|294342719|emb|CBH23497.1| integral membrane protein MviN [Salinibacter ruber M8]
          Length = 565

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+ LP+LS   Q +    S+ LR R++  + F  +P     L     ++  L+  G F A
Sbjct: 327 ASELPELSRLTQEKVAAFSARLR-RSLRQIAFLTVPTVVGYLAFGVLLVGALFRTGQFQA 385

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
             T LV+  L  YS  I+    SR+L + FYA  D  TPA   +L + +  ++A+
Sbjct: 386 ASTWLVAIVLGGYSLGILATTFSRLLQNAFYAIGDTTTPAWIAVLRVTVSTLVAV 440


>gi|170759028|ref|YP_001788416.1| integral membrane protein MviN [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169406017|gb|ACA54428.1| integral membrane protein MviN [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 518

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 96/213 (45%), Gaps = 3/213 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSEDAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLIKYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
             L  ET  S    L  ++ G +  Y  SI LL
Sbjct: 467 LSLGNETKGSAISILICMIIGGI-SYTLSIYLL 498


>gi|195953867|ref|YP_002122157.1| integral membrane protein MviN [Hydrogenobaculum sp. Y04AAS1]
 gi|195933479|gb|ACG58179.1| integral membrane protein MviN [Hydrogenobaculum sp. Y04AAS1]
          Length = 497

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 106/235 (45%), Gaps = 28/235 (11%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALL  LS     E+K + +   + AI  +    IP +  L +L K+II TLY  G F  +
Sbjct: 280 ALLSSLSVG---EDKTKRT---SEAIAVISLLTIPASFGLFVLSKDIINTLYHHGLFNEK 333

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM----GFVIAIGL 118
           D +  +  L+I S  I  F   ++L S F+A  D  +P+   ++ +++    G+  A  L
Sbjct: 334 DALNTAHVLAILSLGITFFSWQKILSSAFFANKDTMSPSLSTLIGVLVEGISGYTFAFLL 393

Query: 119 -FPFIG-GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFI 176
            F FIG   G   + +S     +    +   K   IDL   T    L   + +  M +FI
Sbjct: 394 HFSFIGLAMGTVLSGLS-----SFLFLMWRSKGEFIDLKMLT-SSCLKALVGALFMCVFI 447

Query: 177 VFFKPCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASLKYSLK 231
           ++FK              P+  +AI +    LVYL S+  LL + F  S+  SLK
Sbjct: 448 LYFK---------RFVPYPWLKIAIFIPAGALVYLMSL-FLLREPFFISIFKSLK 492


>gi|170756177|ref|YP_001782730.1| integral membrane protein MviN [Clostridium botulinum B1 str. Okra]
 gi|169121389|gb|ACA45225.1| integral membrane protein MviN [Clostridium botulinum B1 str. Okra]
          Length = 518

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 96/213 (45%), Gaps = 3/213 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSEDAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLIKYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
             L  ET  S    L  ++ G +  Y  SI LL
Sbjct: 467 LSLGNETKGSAISILICMIIGGI-SYTLSIYLL 498


>gi|291326298|ref|ZP_06123975.2| integral membrane protein MviN [Providencia rettgeri DSM 1131]
 gi|291314909|gb|EFE55362.1| integral membrane protein MviN [Providencia rettgeri DSM 1131]
          Length = 498

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 58/107 (54%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+ +    N+ +   L +  +   L   +PC   L +L + +  +L++ G FTA D
Sbjct: 273 LLPSLAKSFTSGNQNEYRHLMDWGLRLCLLLALPCALGLAILSEALTVSLFQYGNFTAHD 332

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVM 110
           +++    L  Y   + G +L ++L   FY+R D++TP K  I+++++
Sbjct: 333 SLMTQYALIAYCVGLTGMILVKILAPGFYSRQDIRTPVKIAIVTLIL 379


>gi|83816605|ref|YP_444639.1| integral membrane protein MviN [Salinibacter ruber DSM 13855]
 gi|83757999|gb|ABC46112.1| integral membrane protein MviN [Salinibacter ruber DSM 13855]
          Length = 565

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           A+ LP+LS   Q +    S+ LR R++  + F  +P     L     ++  L+  G F A
Sbjct: 327 ASELPELSRLTQEKVAAFSARLR-RSLRQIAFLTVPTVVGYLAFGVLLVGALFRTGQFQA 385

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAI 116
             T LV+  L  YS  I+    SR+L + FYA  D  TPA   +L + +  ++A+
Sbjct: 386 ASTWLVAIVLGGYSLGILATTFSRLLQNAFYAIGDTTTPAWIAVLRVTVSTLVAV 440


>gi|325479864|gb|EGC82949.1| integral membrane protein MviN [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 508

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 68/144 (47%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+++   Q  N     +   RAI + +   +P T  ++     II+  +ER AFT  DT 
Sbjct: 283 PEIAKLGQENNINGMKKSTIRAIIFSMILVLPFTFGMMTFSNPIIKLAFERNAFTPDDTF 342

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           +V+  L  Y+  I+    +R+L + FY+  + KTP    ++   +   +   L    G Y
Sbjct: 343 IVAGLLVSYAPSIIFDAFNRILTNSFYSVGNSKTPVMIVVIQQSINIALNFILSKIFGLY 402

Query: 126 GIATAEVSWVWVNTICLAVALLKR 149
           G+A A      + T+ + ++ +++
Sbjct: 403 GLAYATSISSIIATLMMTLSFIRK 426


>gi|269958384|ref|YP_003328171.1| uncharacterized membrane protein, putative virulence factor
           [Anaplasma centrale str. Israel]
 gi|269848213|gb|ACZ48857.1| uncharacterized membrane protein, putative virulence factor
           [Anaplasma centrale str. Israel]
          Length = 501

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 86/180 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP +S      + Q+  E++N A++  +   +P  A L+ +P  ++  L   G F    
Sbjct: 281 LLPAISKLAVEGSTQRMIEMQNNALDLGMTLMVPAAAALIAIPDALLLALLNYGRFDYLA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                  +++ +T +  F++ ++LL  FYAR + K PA F  +S+V+  +++  L  F+G
Sbjct: 341 IGNTVPVVAVLATSLPSFIVIKILLLFFYARGEFKIPAFFSFISVVVNALLSYVLMQFLG 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             GIA A  +  W   I L V L       +  +   ++  IF+SS +M   I   K  L
Sbjct: 401 HVGIAIASSAGSWTYAILLLVYLKMHNLYGMSEELSRKLTYIFLSSAIMVTVICMMKTLL 460


>gi|148654317|ref|YP_001274522.1| integral membrane protein MviN [Roseiflexus sp. RS-1]
 gi|148566427|gb|ABQ88572.1| integral membrane protein MviN [Roseiflexus sp. RS-1]
          Length = 528

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 4/154 (2%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS    + ++          I  VL   +P TA L  L + ++  LY+RGAF ++
Sbjct: 290 AVLPTLSRQASVGDEAAFRSTLAMGINVVLLLILPATAGLAALAEPVVALLYQRGAFGSE 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           DT   +  L +Y   +    L +++L  FYAR    TP      +I++    A+ L  F+
Sbjct: 350 DTQATARALLLYLPGLPAAALDQMILFAFYARQRTLTPNLVQGAAILIYLATALPLL-FL 408

Query: 123 GGYGIATAEVSWV--WVNTICLAVALLKRRQIDL 154
              G+A   ++    W+    L + LL RR +DL
Sbjct: 409 TPLGVAALILANAAQWIGH-ALILYLLSRRLVDL 441


>gi|318042745|ref|ZP_07974701.1| integral membrane protein MviN [Synechococcus sp. CB0101]
          Length = 555

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 78/177 (44%), Gaps = 20/177 (11%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFG---IPCTAILLMLPKEIIQTLYERGA 58
           A L+P L    +L       EL +R  + ++      +P  A+++ L   I+  +YERGA
Sbjct: 304 ALLVPLLPVFARLTAPGDRPELISRIRQGLMLSNASMLPLGALMVALAGPIVALVYERGA 363

Query: 59  FTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYI----LSIVMGFVI 114
           F A    LV   L  Y   +  +L   VL+  FYA  D  TP +F +    L+ +  +V+
Sbjct: 364 FNASAAALVGGLLMAYGVGMPAYLGRDVLVRVFYALGDGTTPFRFSMAGIGLNALFDWVL 423

Query: 115 AIGLFPF--------IGGYGIATAEVSWVWVNTI-CLAVAL-LKRRQIDLPFQTIYR 161
             G  P+         G  G+  A V    VN I CL + L L+RR   LP     R
Sbjct: 424 VGGPTPWGLQLPALNFGAPGLVLATVG---VNLITCLGLLLALQRRLGGLPLAAWAR 477


>gi|118602565|ref|YP_903780.1| integral membrane protein MviN [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567504|gb|ABL02309.1| integral membrane protein MviN [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 495

 Score = 52.8 bits (125), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 104/216 (48%), Gaps = 7/216 (3%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           L KLS     +N ++ ++  N  +   L  G+P  A L++L + +I TL++   F A   
Sbjct: 277 LAKLSQHFADKNDEKFAQTINNTLTIGLLLGLPACAGLVLLAEPLIITLFQYDQFDAFAV 336

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGG 124
              SS L  Y + ++ F+  ++L   F +R D KTP K  +++++    + + L  +   
Sbjct: 337 FQSSSSLMAYGSGLMAFIFVKILAPIFLSRGDAKTPVKVGVIAMISNVFLNVILGFYFAH 396

Query: 125 YGIATAEVSWVWVNTICLAVALLKRRQIDLP---FQTIYRILSIFISSGLMGMFIVFFKP 181
            G+A A      +N   L   L K+   ++    +QT ++ L   ++S +M +FI+ F  
Sbjct: 397 VGLAIATSISALLNASLLYYYLNKQSIFNVSSNLYQTFFKAL---VASFIMTVFILIFGS 453

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
            +   L A+ + S    L   +  A+++Y  S+ LL
Sbjct: 454 EVELYLKADVS-SRITLLGTTIVLAIIIYFASLKLL 488


>gi|325475465|gb|EGC78646.1| integral membrane protein MviN [Treponema denticola F0402]
          Length = 534

 Score = 52.4 bits (124), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 77/154 (50%), Gaps = 6/154 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP++S+    ++ +   ++  +AI+ +    IP T   L+  + +I  +Y+   F   D
Sbjct: 302 ILPEMSALALRKDWETFQKVLLQAIKVIALITIPATFFSLLSGENLIILIYKSNKF---D 358

Query: 64  TILVSSYLSIYSTEIVGFLL---SRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
              V     I+   I+G      +R++   FYA++D KTP    I+   +  ++A+ L  
Sbjct: 359 DASVKLTFGIFKFHIIGLFAIAANRIIAPAFYAQSDSKTPTIAGIICFTVNILLALILVV 418

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDL 154
            +GG GIA A     ++NTI L + L K + +D+
Sbjct: 419 PMGGNGIALALTIASFINTIILLIFLKKNKALDI 452


>gi|168179590|ref|ZP_02614254.1| integral membrane protein MviN [Clostridium botulinum NCTC 2916]
 gi|182669786|gb|EDT81762.1| integral membrane protein MviN [Clostridium botulinum NCTC 2916]
          Length = 518

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 2/187 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS  +   +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PMLSELVAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSENAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLINYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAET 191
             L  ET
Sbjct: 467 LSLGNET 473


>gi|56478323|ref|YP_159912.1| virulence factor MVIN [Aromatoleum aromaticum EbN1]
 gi|56314366|emb|CAI09011.1| Virulence factor MVIN [Aromatoleum aromaticum EbN1]
          Length = 530

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     E  +  S L +  +   L   +P    L +L   +I TL++ GAF+A D
Sbjct: 306 LLPSLSKLHADEQPEAFSSLLDWGLRLTLMLTLPAALALALLAVPLISTLFQHGAFSAAD 365

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
            +     L  YS  + G +L ++L   FYAR D++TP K  +L++
Sbjct: 366 VMQTRLALIAYSIGLAGLILVKILAPGFYARQDIRTPVKIALLTL 410


>gi|188587137|ref|YP_001918682.1| integral membrane protein MviN [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179351824|gb|ACB86094.1| integral membrane protein MviN [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 515

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 76/173 (43%), Gaps = 6/173 (3%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P+LS +I  +N +  S    +A    +F   P    L++L  EI++ L++RGAF  Q   
Sbjct: 287 PRLSESIANKNMKSFSNYFTQAFNLAIFLLTPIMVGLIILRFEIVEVLFKRGAFDTQAVA 346

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L SS L  Y+  IV   L  +    F + N     +K   ++I +   +   L  F+   
Sbjct: 347 LTSSALLFYAPSIVSLGLKNLFERTFTSVNLTMKLSKISFVAITLNVFLNYVLISFMEHN 406

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQIDLPFQT--IYRILSIFISSGLMGMFI 176
           GIA A      ++       L K  Q ++   T     I  I I S +MG+F+
Sbjct: 407 GIALATT----ISNFIAVFLLFKTLQNNVSNITSNCKNIFKIVIMSSIMGVFV 455


>gi|289423596|ref|ZP_06425396.1| integral membrane protein MviN [Peptostreptococcus anaerobius
           653-L]
 gi|289155964|gb|EFD04629.1| integral membrane protein MviN [Peptostreptococcus anaerobius
           653-L]
          Length = 523

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 84/172 (48%), Gaps = 2/172 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           + P+LS     ++K   + L  R++  V    IP T + ++L K II  L+ RGAF  + 
Sbjct: 285 IFPQLSKMSFDKDKTGFNNLIKRSVNIVYIMIIPITFLCIVLAKPIIMALFMRGAFDMRA 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             L ++    Y   ++G  +  V++  FY+  D KTP     +S+++   ++I L   + 
Sbjct: 345 ANLTTNAFIFYLVGMIGLAMRTVVMKVFYSIGDTKTPMVNSTISVLLNIGLSIALVKPMQ 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGM 174
             G+A A  S  ++ ++ + +  LK+   D   + +   I  +F+ S +M +
Sbjct: 405 NGGLALAT-SLSYIISMIMLMNSLKKSIGDYGEKEVMSCIAKVFVGSIIMAL 455


>gi|163846076|ref|YP_001634120.1| integral membrane protein MviN [Chloroflexus aurantiacus J-10-fl]
 gi|222523810|ref|YP_002568280.1| integral membrane protein MviN [Chloroflexus sp. Y-400-fl]
 gi|163667365|gb|ABY33731.1| integral membrane protein MviN [Chloroflexus aurantiacus J-10-fl]
 gi|222447689|gb|ACM51955.1| integral membrane protein MviN [Chloroflexus sp. Y-400-fl]
          Length = 517

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 56/116 (48%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS      ++          ++ VL   +P TA L  L + I   L+ERGAF AQ
Sbjct: 289 AVLPTLSRQSAAGDEDAFRATLAMGLKVVLLLILPATAGLAALSQPITAALFERGAFQAQ 348

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGL 118
           DT + +  L  Y   +    + ++LL  FYAR +  TP      +I+   V+AI L
Sbjct: 349 DTAITALALLAYLPGLPAAAIDQMLLFAFYARKNTLTPNLIQGAAILCYLVVAIPL 404


>gi|225024546|ref|ZP_03713738.1| hypothetical protein EIKCOROL_01421 [Eikenella corrodens ATCC
           23834]
 gi|224942697|gb|EEG23906.1| hypothetical protein EIKCOROL_01421 [Eikenella corrodens ATCC
           23834]
          Length = 512

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS      +K++ S L +  +   L    P    + +L   ++ TL+        D
Sbjct: 287 LLPGLSKHAATGDKREFSALLDWGLRLCLLLTAPAAVGMAVLAFPLVATLFMYNKIGMHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
            ++    L  Y+  ++G +L +VL   FYA+ ++KTP K  I+++V
Sbjct: 347 ALMTQQALIAYAVGLLGLILIKVLAPGFYAQKNIKTPVKVAIVTLV 392


>gi|206602937|gb|EDZ39417.1| putative virulence factor, MVN-like [Leptospirillum sp. Group II
           '5-way CG']
          Length = 547

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEY--VLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
           LLP LS   +LE       +R  A  Y   LFF +P +A L+ L   +I+ L++ G+F A
Sbjct: 310 LLPVLSRQ-RLETGGTEQSIRTLADAYRLSLFFMLPASAGLVALGDPLIKLLFQHGSFAA 368

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           Q T++    L  Y+  +  F   R+L+  +YA  D + P
Sbjct: 369 QSTVMTREALWGYALGLWSFSGVRILVRVYYAHQDTRFP 407


>gi|169824556|ref|YP_001692167.1| putative virulence factor MviN [Finegoldia magna ATCC 29328]
 gi|167831361|dbj|BAG08277.1| putative virulence factor MviN [Finegoldia magna ATCC 29328]
          Length = 508

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 16  NKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYS 75
           NK + S +++ ++  +L   IP T  LL+L   I + L+ RGAFT  D  + S  +  Y+
Sbjct: 295 NKMKDSIMKSMSMICILV--IPATIGLLVLSYPITKMLFFRGAFTMNDVDMTSVCMFFYA 352

Query: 76  TEIVGFLLSRVLLSEFYARNDVKTPA 101
             I+G  +  +L   FYA ND KTP 
Sbjct: 353 LGIIGTAIRDILSKSFYAMNDTKTPT 378


>gi|196232006|ref|ZP_03130862.1| integral membrane protein MviN [Chthoniobacter flavus Ellin428]
 gi|196224128|gb|EDY18642.1| integral membrane protein MviN [Chthoniobacter flavus Ellin428]
          Length = 440

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP +S +    N  +   +  + +       IP T  L+ML + II  +YER  FTA DT
Sbjct: 308 LPVVSRSAAAGNTAEFRSILAKGMRLAFLLTIPSTIGLVMLARPIIGLIYERRTFTAADT 367

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF 112
              +  L +Y+  +  +   +VL   FYA     TP     LSI + +
Sbjct: 368 AHTAEALQLYAIGLCAYAGIKVLAPAFYAIGKRNTPMMVSFLSIAVNY 415


>gi|300867239|ref|ZP_07111900.1| integral membrane protein MviN [Oscillatoria sp. PCC 6506]
 gi|300334769|emb|CBN57066.1| integral membrane protein MviN [Oscillatoria sp. PCC 6506]
          Length = 538

 Score = 52.4 bits (124), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 79/165 (47%), Gaps = 15/165 (9%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P L    +L +     EL+ R  + ++  GI   P +A+++ L   I++ +YER AF 
Sbjct: 304 LVPFLPIFSRLADPNNWHELKQRIRQALILTGITMLPLSALMVTLALPIVRVVYERVAFK 363

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
              +  V+  L  Y+  +  +L   V++  FYA  D +TP +  IL+IV+  ++   L  
Sbjct: 364 QSASQFVAPVLMAYAIGMFVYLGRDVVVRVFYALGDGETPFRISILNIVLNALLDYFLVK 423

Query: 121 FIGGYGIATAEVSWVWVNTICLAVAL---------LKRRQIDLPF 156
           + G  G+  A V    VN I + + L         L  R+  LPF
Sbjct: 424 YFGTPGLVLATVG---VNIISMVMLLWLLNSKLNGLPWREWILPF 465


>gi|260494124|ref|ZP_05814255.1| integral membrane protein MviN [Fusobacterium sp. 3_1_33]
 gi|260198270|gb|EEW95786.1| integral membrane protein MviN [Fusobacterium sp. 3_1_33]
          Length = 489

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 1/153 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISRAAANGDKEDTNRRIVSALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+   L     
Sbjct: 341 VKITSECLFYYSLGLLFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVLNYLLIKNFQ 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-QIDLP 155
             G+A A      VN   L    +K   ++DL 
Sbjct: 401 HKGLALATSISSGVNFFLLLFVYIKNYVKLDLK 433


>gi|254426088|ref|ZP_05039805.1| integral membrane protein MviN [Synechococcus sp. PCC 7335]
 gi|196188511|gb|EDX83476.1| integral membrane protein MviN [Synechococcus sp. PCC 7335]
          Length = 533

 Score = 52.4 bits (124), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 68/140 (48%), Gaps = 5/140 (3%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           +P +A+++ L + I+   Y  GAF      +VSS L  Y   +  +L   V++  FYA  
Sbjct: 334 MPISALIITLARPIVTVAYRYGAFDEDSVEIVSSLLIAYGIGMFVYLARDVMVRVFYALG 393

Query: 96  DVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
           D +TP K  +++IV+ F +       +G  G+  A V    V+ I + + LL R+   LP
Sbjct: 394 DGQTPFKISLVNIVINFALDYVFLKLMGAPGLVIATVGVNLVSLIAMTI-LLARKIGGLP 452

Query: 156 F----QTIYRILSIFISSGL 171
                  I  + ++ + SGL
Sbjct: 453 LIEWTGAITTVFAVSMVSGL 472


>gi|256027963|ref|ZP_05441797.1| virulence factor mviN [Fusobacterium sp. D11]
 gi|289765909|ref|ZP_06525287.1| virulence factor mviN [Fusobacterium sp. D11]
 gi|289717464|gb|EFD81476.1| virulence factor mviN [Fusobacterium sp. D11]
          Length = 489

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 1/153 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISRAAANGDKEDTNRRIVSALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+   L     
Sbjct: 341 VKITSECLFYYSLGLLFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVLNYLLIKNFQ 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-QIDLP 155
             G+A A      VN   L    +K   ++DL 
Sbjct: 401 HKGLALATSISSGVNFFLLLFVYIKNYVKLDLK 433


>gi|320354417|ref|YP_004195756.1| integral membrane protein MviN [Desulfobulbus propionicus DSM 2032]
 gi|320122919|gb|ADW18465.1| integral membrane protein MviN [Desulfobulbus propionicus DSM 2032]
          Length = 535

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 4/100 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFG--IPCTAILLMLPKEIIQTLYERGAFT 60
           A++P L+   Q  +K  +S  +      VL F   +P TA L++L + II+ ++E GAFT
Sbjct: 303 AVMPVLAK--QAADKDLASLKQTFTSSLVLVFALAVPATAGLVLLAEPIIRLIFEHGAFT 360

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           A DT+  +  L+ Y+  +  +   +V++  FYA  + K P
Sbjct: 361 AMDTLQTADALTYYAIGLFAYAAIKVMVPVFYAIGNTKYP 400


>gi|257066762|ref|YP_003153018.1| integral membrane protein MviN [Anaerococcus prevotii DSM 20548]
 gi|256798642|gb|ACV29297.1| integral membrane protein MviN [Anaerococcus prevotii DSM 20548]
          Length = 506

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           IP T  ++ L + II  +YER AFTA D  LVSS L  Y+  I+     +++ + FYA  
Sbjct: 313 IPATFGMMTLARPIISLIYERNAFTAHDAALVSSLLVSYAPYIIFITFMKIISNSFYAVG 372

Query: 96  DVKTP 100
           D K+P
Sbjct: 373 DSKSP 377


>gi|325522462|gb|EGD01036.1| integral membrane protein MviN [Burkholderia sp. TJI49]
          Length = 516

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLIVTQISNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|218887541|ref|YP_002436862.1| integral membrane protein MviN [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758495|gb|ACL09394.1| integral membrane protein MviN [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 596

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 59/135 (43%), Gaps = 3/135 (2%)

Query: 27  AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRV 86
           A+   LF  +P    L  +   ++  L+  GAF  Q      + L  Y+  I  F ++R 
Sbjct: 390 ALRLSLFISLPSALGLAAVAVPLVALLFGHGAFDHQAVDATVAALLAYAPGIPAFAVTRP 449

Query: 87  LLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAVAL 146
           LL+   AR     P    ++S+V+   +   L   +G  G A A     WVNT CL +AL
Sbjct: 450 LLAACNARQATGAPVAAGLVSVVVTLALGALLLKPLGVAGPALAASCAAWVNTACLILAL 509

Query: 147 LKRRQIDLPFQTIYR 161
              R+  +P  T  R
Sbjct: 510 ---RRGGIPVDTYPR 521


>gi|34762576|ref|ZP_00143571.1| Virulence factor mviN [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|27887742|gb|EAA24816.1| Virulence factor mviN [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
          Length = 489

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 58/111 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISRAAANGDKEDTNRRIVSALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VKITSECLFYYSLGLLFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|308273590|emb|CBX30192.1| hypothetical protein N47_D30010 [uncultured Desulfobacterium sp.]
          Length = 532

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P LS      +     E  + +I  VLF   PC   L++L + +I  L++RG F  Q
Sbjct: 296 AIFPALSRQASENDMNALKETFDYSIRMVLFITFPCMIGLIVLREPVIILLFKRGEFDMQ 355

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
              L +  L  YS  +  F   ++ +  FYA  D KTP
Sbjct: 356 TVKLTAQALLCYSIGLWAFASVKITVPVFYALKDTKTP 393


>gi|171322128|ref|ZP_02910990.1| integral membrane protein MviN [Burkholderia ambifaria MEX-5]
 gi|171092568|gb|EDT37882.1| integral membrane protein MviN [Burkholderia ambifaria MEX-5]
          Length = 516

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSSLLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQLSNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|116690570|ref|YP_836193.1| integral membrane protein MviN [Burkholderia cenocepacia HI2424]
 gi|170733910|ref|YP_001765857.1| integral membrane protein MviN [Burkholderia cenocepacia MC0-3]
 gi|116648659|gb|ABK09300.1| integral membrane protein MviN [Burkholderia cenocepacia HI2424]
 gi|169817152|gb|ACA91735.1| integral membrane protein MviN [Burkholderia cenocepacia MC0-3]
          Length = 516

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQLSNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|206561101|ref|YP_002231866.1| MviN-like protein [Burkholderia cenocepacia J2315]
 gi|198037143|emb|CAR53064.1| MviN-like protein [Burkholderia cenocepacia J2315]
          Length = 516

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQLSNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|325981375|ref|YP_004293777.1| integral membrane protein MviN [Nitrosomonas sp. AL212]
 gi|325530894|gb|ADZ25615.1| integral membrane protein MviN [Nitrosomonas sp. AL212]
          Length = 512

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP L+      + ++ S L +  +   +   +P    L +L   +I TL+  G FT  D
Sbjct: 287 LLPSLARHYTNNSTEEYSRLLDWGLRMTILLTLPAALALALLATPLITTLFYHGVFTEHD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
             +    L  YS  ++G +L +VL   FYAR ++KTP K  I++++
Sbjct: 347 VWMTREALIAYSIGLLGLILVKVLAPGFYARQNIKTPVKIAIITLI 392


>gi|304438976|ref|ZP_07398899.1| integral membrane protein MviN [Peptoniphilus duerdenii ATCC
           BAA-1640]
 gi|304372642|gb|EFM26225.1| integral membrane protein MviN [Peptoniphilus duerdenii ATCC
           BAA-1640]
          Length = 500

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 64/130 (49%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           + A+ P+++    L N +   +     +  ++F  IP T  L +    I++ L+  G FT
Sbjct: 274 ITAVYPQMARHASLNNYEDLKKSTLMGLSTIMFLVIPATVGLFIFAGPIVEILFVGGKFT 333

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
            +D +     L++Y+  ++G  L  ++   FY  +D KTP    +L +V+  ++++ L  
Sbjct: 334 VEDAMKTKPVLALYAIGLIGIGLREIISRVFYTLDDSKTPVINSVLMVVINAILSLILVK 393

Query: 121 FIGGYGIATA 130
             G  G+A A
Sbjct: 394 SRGVEGLALA 403


>gi|75675271|ref|YP_317692.1| virulence factor MVIN-like [Nitrobacter winogradskyi Nb-255]
 gi|74420141|gb|ABA04340.1| virulence factor MVIN-like protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 508

 Score = 52.0 bits (123), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 71/135 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   + RA E+ L F IP  A  L +P  I++ ++ RGAF+A D
Sbjct: 283 LLPEMSRRITGGDLAGAMASQRRAFEFSLLFSIPFIAAFLTVPDVIMRAMFARGAFSAAD 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F+L R  ++ FYAR +  TP K  +  + +  V+ + L   + 
Sbjct: 343 AAAAGATLAAYAVGLIPFVLIRSAVAAFYARKNTATPVKASLAGLGVNLVLKVALMGSLA 402

Query: 124 GYGIATAEVSWVWVN 138
             G+A A  +  W+N
Sbjct: 403 QVGLALATAAGAWIN 417


>gi|296106707|ref|YP_003618407.1| putative membrane protein, putative virulence factor [Legionella
           pneumophila 2300/99 Alcoy]
 gi|295648608|gb|ADG24455.1| putative membrane protein, putative virulence factor [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 437

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP +S      N  Q      RAI   +F  +P    L      II  +YE G F A D+
Sbjct: 197 LPVVSRLAATNNHSQFGSTLARAIRLAVFLTMPAAVGLWFFANPIISLIYEHGKFHASDS 256

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA----KFYILSIVMGFVIAIGLFP 120
           +  +  L  Y+  +V +   +VL   FYA +   TP        IL+I++ + +   L  
Sbjct: 257 LQTAYALQFYALGLVAYSCIKVLSPAFYAIDKKWTPMIVSFATIILNIILNYFLIFKL-- 314

Query: 121 FIGGYGIATAEVSWVWVNTICLAVAL--LKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
            +G  G+A +      VN + L V +  L   Q    F TI R +   ++S ++G    F
Sbjct: 315 SMGHRGLALSTTVSATVNFLVLYVLMTRLHNLQNRYLFNTILRCV---LASAILG----F 367

Query: 179 FKPCLFNQLSAETAFSP-----FKNLAIILSGAVLVYL 211
               +F    A+  + P       +LAI +S AVLVYL
Sbjct: 368 MCQSIF-AYGADFLYHPSFWIRAVSLAISISFAVLVYL 404


>gi|326203614|ref|ZP_08193478.1| integral membrane protein MviN [Clostridium papyrosolvens DSM 2782]
 gi|325986434|gb|EGD47266.1| integral membrane protein MviN [Clostridium papyrosolvens DSM 2782]
          Length = 530

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 1/112 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  + L+   +  E+ N     +L+  IP +   ++L + ++  +Y+      +
Sbjct: 286 AILPTLSEKLALKKVGEFKEILNNGFRTILYLIIPSSVAFIVLSQPVVSVVYKWSQVIGK 345

Query: 63  DTILVS-SYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           D I+ + S L +++  ++   +  +L   FYA ND KTP     +SI + FV
Sbjct: 346 DRIITAGSILLLFTAAMIAQSMLALLNRAFYADNDTKTPLYIGTISIALNFV 397


>gi|297617704|ref|YP_003702863.1| integral membrane protein MviN [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145541|gb|ADI02298.1| integral membrane protein MviN [Syntrophothermus lipocalidus DSM
           12680]
          Length = 523

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 65/147 (44%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P L+S              N  +  V F  IP    L+ + +  I+ ++E   FTA+
Sbjct: 287 AVFPTLTSQAARGETDDFKRTLNLGLRQVFFITIPSALGLMAIGEPAIKLMFEWRRFTAE 346

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
            TI  +  L  YS  ++ +   +VL   FYA  D  TP    +++I    V++I L   +
Sbjct: 347 HTIATAQALFFYSLGLIPYSALQVLNRAFYAIKDTVTPVSAAVVTIFANIVLSIWLVKPL 406

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
              G+A A     ++N I L   L KR
Sbjct: 407 AHVGLALAYSMAGYINMIILMFMLRKR 433


>gi|183221666|ref|YP_001839662.1| putative virulence factor MviN-like [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911742|ref|YP_001963297.1| MviN-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167776418|gb|ABZ94719.1| mviN-related protein [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167780088|gb|ABZ98386.1| Putative virulence factor MviN-like; putative membrane protein
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 542

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 77/158 (48%), Gaps = 1/158 (0%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
             +LP L   ++   ++   +     + +  F  +P +  L +L + ++ ++Y  G +  
Sbjct: 297 TTILPSLLKDLREGREENIPKEIADVLSFAFFLTLPASIGLAVLGETVLDSIYYGGRWDH 356

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
             T+     L  YS  I  + +++VL+S +YA +D KTP +  ++S ++  +++IGL  F
Sbjct: 357 LATLTAFFPLVFYSLAIPFYSINKVLVSSYYAFSDTKTPLRIQLISFLLSVMVSIGLMVF 416

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI 159
           +  +       +   V T  L +  LK  Q+ +PF T+
Sbjct: 417 L-KHSAIALASALSAVVTSSLLLFYLKAHQVTIPFATV 453


>gi|307151793|ref|YP_003887177.1| integral membrane protein MviN [Cyanothece sp. PCC 7822]
 gi|306982021|gb|ADN13902.1| integral membrane protein MviN [Cyanothece sp. PCC 7822]
          Length = 541

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 3/108 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +     L + +   EL+ R  + +L   +   P TA+ + L   ++Q +YERGAF 
Sbjct: 302 LVPLMPVFSHLADPENWPELKQRIRQGLLLTALSMLPLTAMFIALAFPMVQVIYERGAFK 361

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
           A  +  V+  L  Y   +  +L   VL+  FYA  D +TP +  IL+I
Sbjct: 362 AAASGEVAPVLMAYGVGMFFYLGRDVLVRVFYALGDGETPFRVSILNI 409


>gi|119486150|ref|ZP_01620210.1| hypothetical protein L8106_17442 [Lyngbya sp. PCC 8106]
 gi|119456641|gb|EAW37770.1| hypothetical protein L8106_17442 [Lyngbya sp. PCC 8106]
          Length = 537

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 78/157 (49%), Gaps = 4/157 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P L    +L       EL+NR  + ++   +   P +AI++ L   I++ +YER AF 
Sbjct: 303 LVPFLPIFSRLREPADWPELKNRIRQALMLTALTMLPLSAIIVALALPIVRVVYERFAFD 362

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
              +  V+S L  Y   +  +L   VL+  FY   D +TP +  +++IV+  V+   L  
Sbjct: 363 LAASQFVASVLMAYGAGMFVYLGRDVLVRVFYGLGDGETPFRVSMVNIVLNGVLDFLLVK 422

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQ 157
             G  G+  A V  V + ++ + + LL R+   LP++
Sbjct: 423 AFGAPGLVLATVG-VNLVSMLMFLVLLDRKLNGLPWR 458


>gi|117618300|ref|YP_855222.1| integral membrane protein MviN [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559707|gb|ABK36655.1| integral membrane protein MviN [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 521

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 89/192 (46%), Gaps = 24/192 (12%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+      +    S   +  +  V+  G+P    + +L + I++ L+ RG F   +
Sbjct: 296 ILPALAKKHVDADPADFSRTMDWGVRMVMLLGLPAMVGIAVLREPILRVLFMRGEFGLHE 355

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIA-IGLFPFI 122
             + S+ L   +T ++  +L +VL   +YAR D +TP +  ++S+        I ++P +
Sbjct: 356 VSMSSASLLASTTGLLSLMLIKVLAPGYYARQDTRTPVRIGMMSMAANMACNLIFIYP-L 414

Query: 123 GGYGIATAEVSWVWVNTIC---LAVALLKRRQIDLPFQTIYR--------ILSIFISSGL 171
           G  G+A        ++T C   L  ALL +    L  Q +YR         L +  +S L
Sbjct: 415 GYVGLA--------LSTACSGTLNAALLFK---GLHQQNVYRPSRHTGVFCLKLLTASLL 463

Query: 172 MGMFIVFFKPCL 183
           MG  +++F P L
Sbjct: 464 MGSVLLYFSPDL 475


>gi|237744292|ref|ZP_04574773.1| virulence factor mviN [Fusobacterium sp. 7_1]
 gi|229431521|gb|EEO41733.1| virulence factor mviN [Fusobacterium sp. 7_1]
          Length = 489

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 1/153 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISRAAANGDKEDTNRRIVSALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+   L     
Sbjct: 341 VKITSECLFYYSLGLLFYVGVQLISKGYYAVGDNKRPAKFSIIAIIMNIVLNYLLIKNFQ 400

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRR-QIDLP 155
             G+A A      VN   L    +K   ++DL 
Sbjct: 401 HKGLALATSISSGVNFFLLLFVYIKNYVKLDLK 433


>gi|116328000|ref|YP_797720.1| mviN-related protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120744|gb|ABJ78787.1| mviN-related protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 535

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 73/157 (46%), Gaps = 7/157 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNR---AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF 59
           ++LP L   +Q   K   S LR     A+E+ LF  +P    ++ L   I+ ++Y  G +
Sbjct: 291 SILPAL---LQSLKKDGLSSLRRELAAALEFALFLTVPAAIGMVFLAGPILDSIYFGGKW 347

Query: 60  TAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF 119
               T   +  L  YS  I  F ++++L+S +YA  D KTP +   +S  +  ++ + L 
Sbjct: 348 DRLATDTATQPLIFYSLAIPFFSINKILISSYYAFQDTKTPLRIQSVSFTINIILNLSLV 407

Query: 120 PFIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPF 156
            F+    IA +      +    L +  LK+ +I  P+
Sbjct: 408 WFLKHSAIALSSAVSAMITFFLLGI-FLKKHKIGFPW 443


>gi|148360239|ref|YP_001251446.1| virulence factor MviN [Legionella pneumophila str. Corby]
 gi|148282012|gb|ABQ56100.1| virulence factor MviN [Legionella pneumophila str. Corby]
          Length = 535

 Score = 52.0 bits (123), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP +S      N  Q      RAI   +F  +P    L      II  +YE G F A D+
Sbjct: 295 LPVVSRLAATNNHSQFGSTLARAIRLAVFLTMPAAVGLWFFANPIISLIYEHGKFHASDS 354

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA----KFYILSIVMGFVIAIGLFP 120
           +  +  L  Y+  +V +   +VL   FYA +   TP        IL+I++ + +   L  
Sbjct: 355 LQTAYALQFYALGLVAYSCIKVLSPAFYAIDKKWTPMIVSFATIILNIILNYFLIFKL-- 412

Query: 121 FIGGYGIATAEVSWVWVNTICLAVAL--LKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
            +G  G+A +      VN + L V +  L   Q    F TI R +   ++S ++G    F
Sbjct: 413 SMGHRGLALSTTVSATVNFLVLYVLMTRLHNLQNRYLFNTILRCV---LASAILG----F 465

Query: 179 FKPCLFNQLSAETAFSP-----FKNLAIILSGAVLVYL 211
               +F    A+  + P       +LAI +S AVLVYL
Sbjct: 466 MCQSIF-AYGADFLYHPSFWIRAVSLAISISFAVLVYL 502


>gi|85715003|ref|ZP_01045988.1| virulence factor MVIN-like [Nitrobacter sp. Nb-311A]
 gi|85698200|gb|EAQ36072.1| virulence factor MVIN-like [Nitrobacter sp. Nb-311A]
          Length = 508

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 106/223 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  I   +   +   + RA E+ L F IP  A  L +P  I++ ++ RGAF+A D
Sbjct: 283 LLPEMSRRITGGDLAGAIASQRRAFEFSLLFSIPFIAAFLAVPDVIMRAMFARGAFSAAD 342

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
                + L+ Y+  ++ F+L R  ++ FYAR +  TP K  +  + +   + + L   + 
Sbjct: 343 AAAAGATLAAYAVGLIPFVLIRSAVATFYARKNTATPVKASLTGLAVNLALKVTLMGSLA 402

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCL 183
             G+A A  +  WVN + +    ++ + +++    +  +  + ++  ++G  + F     
Sbjct: 403 QVGLALATAAGAWVNLLLVLGFAVRAKLLEIDRPLLISLGKLLLAGAILGATLWFTARFT 462

Query: 184 FNQLSAETAFSPFKNLAIILSGAVLVYLCSISLLLGKGFLASL 226
             Q +  T       L +++    +VY   I LL G  +L SL
Sbjct: 463 SGQFTHWTTMRDEAALGLLVIVGAVVYAGVILLLFGARWLRSL 505


>gi|107023487|ref|YP_621814.1| integral membrane protein MviN [Burkholderia cenocepacia AU 1054]
 gi|105893676|gb|ABF76841.1| integral membrane protein MviN [Burkholderia cenocepacia AU 1054]
          Length = 546

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 321 LLPSLSKAHVDADSHEYSALLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 380

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  I  +++  +      P IG
Sbjct: 381 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAIGVLIVTQLSNYVFVPLIG 440

Query: 124 GYGI 127
             G+
Sbjct: 441 HAGL 444


>gi|304439419|ref|ZP_07399329.1| integral membrane protein MviN [Peptoniphilus duerdenii ATCC
           BAA-1640]
 gi|304372094|gb|EFM25690.1| integral membrane protein MviN [Peptoniphilus duerdenii ATCC
           BAA-1640]
          Length = 531

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 71/146 (48%), Gaps = 3/146 (2%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P ++ A    +  Q   + + +I+ VL+  +P +  LL+L + +I+  +  G FT ++ +
Sbjct: 289 PMMTKAFSKGDTLQGKRVMSTSIKSVLYLTVPASIGLLILARPLIEIAFVHGKFTYENGL 348

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
             +S L  Y+  ++   LS VL   FY+  D KTP  F I ++ +   +A+ +      +
Sbjct: 349 EATSTLRCYTLSLISMSLSNVLNRVFYSLEDTKTP--FVIGAVNVAINVALNIL-VAHKF 405

Query: 126 GIATAEVSWVWVNTICLAVALLKRRQ 151
           G+     S     TI + V+ +K  +
Sbjct: 406 GVQGLAASVSIATTIAVTVSYIKLHK 431


>gi|269837247|ref|YP_003319475.1| integral membrane protein MviN [Sphaerobacter thermophilus DSM
           20745]
 gi|269786510|gb|ACZ38653.1| integral membrane protein MviN [Sphaerobacter thermophilus DSM
           20745]
          Length = 549

 Score = 51.6 bits (122), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 54/102 (52%)

Query: 27  AIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRV 86
           A+  ++F   P +  L      I+Q L++ G+F+ + T LV+  L+ +S  +V F +   
Sbjct: 339 ALGPLIFLTFPASVGLFAFRTSIVQVLFQFGSFSDESTRLVAQALAYFSVGLVAFAVVEA 398

Query: 87  LLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIA 128
           +   FYA +D +TP    I++++    ++  L P +G  G+A
Sbjct: 399 VTRAFYAMHDTRTPVTVAIVTVIANIALSAYLAPRLGHGGLA 440


>gi|237741680|ref|ZP_04572161.1| virulence factor mviN [Fusobacterium sp. 4_1_13]
 gi|256845004|ref|ZP_05550462.1| integral membrane protein MviN [Fusobacterium sp. 3_1_36A2]
 gi|294785709|ref|ZP_06750997.1| integral membrane protein MviN [Fusobacterium sp. 3_1_27]
 gi|229429328|gb|EEO39540.1| virulence factor mviN [Fusobacterium sp. 4_1_13]
 gi|256718563|gb|EEU32118.1| integral membrane protein MviN [Fusobacterium sp. 3_1_36A2]
 gi|294487423|gb|EFG34785.1| integral membrane protein MviN [Fusobacterium sp. 3_1_27]
          Length = 489

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 58/111 (52%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISRAAANGDKEDTNRRIVLALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + S  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VKITSECLFYYSLGLLFYVGVQLVSKGYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|172061511|ref|YP_001809163.1| integral membrane protein MviN [Burkholderia ambifaria MC40-6]
 gi|171994028|gb|ACB64947.1| integral membrane protein MviN [Burkholderia ambifaria MC40-6]
          Length = 516

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSSLLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLIVTQLSNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|115352650|ref|YP_774489.1| integral membrane protein MviN [Burkholderia ambifaria AMMD]
 gi|115282638|gb|ABI88155.1| integral membrane protein MviN [Burkholderia ambifaria AMMD]
          Length = 516

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADTHEYSSLLDWGLRVTFLLAAPSALALFFFATPLTATLFNYGKFDAHT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +++  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLIVTQLSNYVFVPLIG 410

Query: 124 GYGI 127
             G+
Sbjct: 411 HAGL 414


>gi|54307794|ref|YP_128814.1| hypothetical protein PBPRA0589 [Photobacterium profundum SS9]
 gi|46912217|emb|CAG19012.1| hypothetical protein PBPRA0589 [Photobacterium profundum SS9]
          Length = 198

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%)

Query: 31  VLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSE 90
           VL  GIP    +L+L K ++  L+ RG F+  D    +  L   S  ++ F+L ++    
Sbjct: 2   VLLLGIPAMLGMLVLAKPMLMVLFMRGEFSLYDVNQAAMSLWALSAGLLNFMLIKIFAPG 61

Query: 91  FYARNDVKTPAKFYILSIV 109
           +YAR D KTP ++ I+++V
Sbjct: 62  YYARQDTKTPVRYGIIAMV 80


>gi|67922475|ref|ZP_00515984.1| Virulence factor MVIN-like [Crocosphaera watsonii WH 8501]
 gi|67855646|gb|EAM50896.1| Virulence factor MVIN-like [Crocosphaera watsonii WH 8501]
          Length = 536

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 73/159 (45%), Gaps = 8/159 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   II+ +Y+RGAF 
Sbjct: 302 LVPFMPVFSRLTAPENWPELKVRIRQGLLLTALTMLPLTAIFIALAPVIIRVVYQRGAFK 361

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           + D  LV   L  Y   +  +L   VL+  FYA  D +TP +  I +I +   +   L+ 
Sbjct: 362 SADADLVIPVLMAYGIGMFFYLARDVLVRVFYALGDGETPFRISIFNIFLNGFLDFLLYK 421

Query: 121 FIGGYGIATAEVSWVWVNTICLAV--ALLKRRQIDLPFQ 157
                G+  A +    VN + L +   +L  R   LP Q
Sbjct: 422 PFQTPGLVFATIG---VNIVSLVIFLGILNNRLGGLPLQ 457


>gi|52841321|ref|YP_095120.1| virulence factor MviN [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|52628432|gb|AAU27173.1| virulence factor MviN [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
          Length = 535

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP +S      N  Q      RAI   +F  +P    L      II  +YE G F A D+
Sbjct: 295 LPVVSRLAATNNHSQFGSTLARAIRLAVFLTMPAAVGLWFFATPIISLIYEHGKFHASDS 354

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA----KFYILSIVMGFVIAIGLFP 120
           +  +  L  Y+  +V +   +VL   FYA +   TP        IL+I++ + +   L  
Sbjct: 355 LQTAYALQFYALGLVAYSCIKVLSPAFYAIDKKWTPMIVSFATIILNIILNYFLIFKL-- 412

Query: 121 FIGGYGIATAEVSWVWVNTICLAVAL--LKRRQIDLPFQTIYRILSIFISSGLMGMFIVF 178
            +G  G+A +      VN + L V +  L   Q    F TI R +   ++S ++G    F
Sbjct: 413 SMGHRGLALSTTVSATVNFLVLYVLMTRLHNLQNRYLFNTILRCV---LASAILG----F 465

Query: 179 FKPCLFNQLSAETAFSP-----FKNLAIILSGAVLVYL 211
               +F    A+  + P       +LAI +S AVLVYL
Sbjct: 466 MCQSIF-AYGADFLYHPSFWIRAVSLAISISFAVLVYL 502


>gi|188996893|ref|YP_001931144.1| integral membrane protein MviN [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931960|gb|ACD66590.1| integral membrane protein MviN [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 501

 Score = 51.6 bits (122), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 94/187 (50%), Gaps = 9/187 (4%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           ALL  LS     ++ +   +    ++++ +F  +P T  ++ L KEII  L  RGAF  +
Sbjct: 281 ALLVSLSKNYANKDFETFRKDLTLSLKFSIFISMPATIGMIFLGKEIIDVLLVRGAFNEK 340

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
           D  L    L  Y   ++G+ L+R   S F+A  D KTP    ++ I MG +I+  +  FI
Sbjct: 341 DAQLTYYALIGYGLGLLGYSLTRPFKSAFFAMGDTKTPLYSTMIGI-MGSIISAIVLTFI 399

Query: 123 ---GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYR-ILSIFISSGLMGMFIVF 178
              G +G+A A     ++NTI     L K  ++ +  + I++  + + I+  +M +FI  
Sbjct: 400 LNFGVFGLAFASSLGGYINTIY----LYKHFKMKIDLKEIFKTFIKVSIAGFIMILFIEA 455

Query: 179 FKPCLFN 185
            K  +FN
Sbjct: 456 LKFFVFN 462


>gi|257092022|ref|YP_003165663.1| integral membrane protein MviN [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044546|gb|ACV33734.1| integral membrane protein MviN [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 512

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS         + S L +  +        P    L +L   +I TL+  GAFTA D
Sbjct: 287 LLPSLSRCHATGRADEYSRLLDWGLRLTFLLAAPAALALALLAVPLITTLFHHGAFTATD 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
                  L  YS  ++G +L +VL   FYAR +++TP +  +L++
Sbjct: 347 VFRTRDALVAYSLGLLGLILVKVLAPGFYARQNIRTPVRIALLTL 391


>gi|285017715|ref|YP_003375426.1| virulence factor mvin homolog transmembrane protein [Xanthomonas
           albilineans GPE PC73]
 gi|283472933|emb|CBA15438.1| probable virulence factor mvin homolog. transmembrane protein
           [Xanthomonas albilineans]
          Length = 535

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      +    S   +  +   L   +P    L++L + ++ TL++ G FTA D
Sbjct: 290 ILPALSRHHVKTDHAGFSNALDWGLRTTLLIAVPAMLGLMLLSQPLVATLFQYGKFTAFD 349

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIV 109
           T + +  +   S  +  F L +VLL  FY+R D +TP +  + ++V
Sbjct: 350 TRMAAMSVFGLSFGLPAFALLKVLLPAFYSRQDTRTPVRAGVAALV 395


>gi|254455975|ref|ZP_05069404.1| integral membrane protein MviN [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082977|gb|EDZ60403.1| integral membrane protein MviN [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 509

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP+LS  ++ + K + S ++N+A+E  L   +P  A LL+  +EII  L+  G+F    
Sbjct: 285 ILPQLSKHVKAKRKDKISLIQNKALELSLLLSLPAAAALLIGSEEIISALFGYGSFDELS 344

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
               S  L  ++  +  F L +V  S F+A +D K P    ++S+++  VI+I  F  IG
Sbjct: 345 VFNSSKALYYFALGLPAFSLIKVFSSFFFANHDTKIPFYISLISVLVNIVISISYFNEIG 404

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFIS--SGLMGMFIVF 178
              I  A     W+N   L +  LK + +   F  I+ I  I IS  S LM +F  F
Sbjct: 405 FIIIPIATTISSWLNAFLLFI-FLKNKNL-FSFNNIFLINLIKISGASILMALFFNF 459


>gi|168181787|ref|ZP_02616451.1| integral membrane protein MviN [Clostridium botulinum Bf]
 gi|237796551|ref|YP_002864103.1| integral membrane protein MviN [Clostridium botulinum Ba4 str. 657]
 gi|182675117|gb|EDT87078.1| integral membrane protein MviN [Clostridium botulinum Bf]
 gi|229262288|gb|ACQ53321.1| integral membrane protein MviN [Clostridium botulinum Ba4 str. 657]
          Length = 518

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 85/187 (45%), Gaps = 2/187 (1%)

Query: 6   PKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTI 65
           P LS      +K+Q      RAI  +L   +P    +  L + +I  +++RGAF+     
Sbjct: 288 PTLSELAAKNDKKQYKVELGRAINIILVIMVPAAVGIATLREPLINVIFKRGAFSENAAS 347

Query: 66  LVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGY 125
           L +  L +Y+  ++ + +  +L   FYA  D KTP     + I++  VI   L  ++G  
Sbjct: 348 LTARALLLYTPAMIAYGVRDILNKAFYAIKDTKTPMINSFIGIIINVVINSLLIKYLGVS 407

Query: 126 GIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFKPCLF 184
           G+  A     +V TI + + L K+   ID+    I   L + +S+ +MG+ +        
Sbjct: 408 GLTLATSISAFVITIIMLLDLNKKLNGIDIK-NIIISFLKVILSALIMGIIVAVINKFTL 466

Query: 185 NQLSAET 191
             L  ET
Sbjct: 467 LSLGNET 473


>gi|223937835|ref|ZP_03629735.1| integral membrane protein MviN [bacterium Ellin514]
 gi|223893441|gb|EEF59902.1| integral membrane protein MviN [bacterium Ellin514]
          Length = 520

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 72/160 (45%), Gaps = 1/160 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS     +   +     N+ +++++F  +     L  L + +I+ L+E G F  + 
Sbjct: 287 LLPTLSGLAAEKKYPEFKSTLNQGLDHLIFINLLAGIFLFFLAEPMIRLLFEHGKFGPES 346

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
           T  VS  L   +  +V F ++ ++   FYA  D+++P K  I  + +  + A+ L     
Sbjct: 347 TGRVSLALVCLAPGLVAFSMNNIMARAFYALGDIRSPMKISIFCLALNLIFAVVLIKSFK 406

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL 163
             G+  A       N   L  A L+R+   L   ++ +IL
Sbjct: 407 QAGLGLANTLSAGCNVFLLFYA-LRRKLGALELNSLRQIL 445


>gi|319936139|ref|ZP_08010559.1| hypothetical protein HMPREF9488_01390 [Coprobacillus sp. 29_1]
 gi|319808713|gb|EFW05246.1| hypothetical protein HMPREF9488_01390 [Coprobacillus sp. 29_1]
          Length = 397

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           ++ + P L+  +Q  + +QS +  + AI  ++   +PC   + +  ++II+T+Y RGAF 
Sbjct: 166 ISVVYPLLTKHLQNNDIEQSKKYISDAIGLMILILVPCMIGIFICGEDIIKTIYMRGAFD 225

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPA 101
                + ++ L  YS  I+   L +V +  FYA  + K P 
Sbjct: 226 ENSVKMSTTVLKAYSLGIIFVGLRQVFIRFFYAIQETKVPV 266


>gi|168187396|ref|ZP_02622031.1| integral membrane protein MviN [Clostridium botulinum C str.
           Eklund]
 gi|169294734|gb|EDS76867.1| integral membrane protein MviN [Clostridium botulinum C str.
           Eklund]
          Length = 515

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 100/217 (46%), Gaps = 11/217 (5%)

Query: 6   PKLSSAIQL-ENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF---TA 61
           P L+  I   E K+   +  ++AI  +     P T  +++L   II   ++RG F   + 
Sbjct: 286 PTLAKYINAGEIKEDFKKYLSKAINNINLIMFPATVGIIVLRTNIISVAFKRGVFDEKSV 345

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T +   +L+I  T ++G  +  +    FYA  D KTP K   + +V   V+ I L  F
Sbjct: 346 EATAIALLFLAI-GTGVLG--IRDIYNRAFYAIQDTKTPMKNSAIGVVTNVVLDIILVKF 402

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           +G  G+  A    ++V+T+ LA+ L K+   ID     +     I +SS +MG+ +    
Sbjct: 403 MGVGGLTLATTISIFVSTVLLALDLRKKIGNID-AVSVLRSGFKILVSSIVMGLIVYIIN 461

Query: 181 PCLFNQLSAETAFSPFKNLAIILSGAVLVYLCSISLL 217
             +   +S         +L I     ++VY  +I++L
Sbjct: 462 NNILKYVSGNKG--NMLSLMICACVGIIVYAITINML 496


>gi|254447414|ref|ZP_05060880.1| membrane protein, MviN family [gamma proteobacterium HTCC5015]
 gi|198262757|gb|EDY87036.1| membrane protein, MviN family [gamma proteobacterium HTCC5015]
          Length = 267

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS      N +  S   + A ++V+   +P    L++L   ++ TL++  AF  + 
Sbjct: 26  ILPALSQRHAANNPESFSHTLDWAWKWVVVISLPAMVGLMVLSGPMLSTLFQYDAFGERS 85

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFP 120
             + +  L  YS  +  F+L ++    F+AR D KTP +  + ++ +     +I +GL  
Sbjct: 86  VAMSTWSLMAYSLGLPAFILIKIFAPAFFARQDSKTPVRIGVQAMAVNMLFNLIFVGLMI 145

Query: 121 FIG------GYGIATAEVSWV 135
           +        G  +ATA   W+
Sbjct: 146 YWDFEAPHTGLALATAASGWL 166


>gi|166362913|ref|YP_001655186.1| virulence factor MviN-like protein [Microcystis aeruginosa
           NIES-843]
 gi|166085286|dbj|BAF99993.1| virulence factor MviN homolog [Microcystis aeruginosa NIES-843]
          Length = 601

 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 73/157 (46%), Gaps = 8/157 (5%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGI---PCTAILLMLPKEIIQTLYERGAFT 60
           L+P +    +L   +   EL+ R  + +L   +   P TAI + L   +++ +Y+RGAF 
Sbjct: 365 LVPFMPIFSRLTEPENWGELKQRIRQGLLLTALTMLPFTAIFIALAFPVVRVIYQRGAFN 424

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
              +  V   L  Y   +  +L   VL+  FYA  D  TP K  +++I +  V+   L+ 
Sbjct: 425 LAASEQVVPVLMAYGFGMFFYLGRDVLVRVFYALGDGDTPFKVSMVNIFLNGVLDFLLYK 484

Query: 121 FIGGYGIATAEVSWVWVNTICLAV--ALLKRRQIDLP 155
             G  GI  A V    VN I + +   +L RR   LP
Sbjct: 485 PFGTPGIVLATVG---VNIISMGIFTVILNRRLGGLP 518


>gi|254524967|ref|ZP_05137022.1| integral membrane protein MviN [Stenotrophomonas sp. SKA14]
 gi|219722558|gb|EED41083.1| integral membrane protein MviN [Stenotrophomonas sp. SKA14]
          Length = 539

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP L+      +++  S   +  +   L   +P    LL+L + +I T+++ G F+A D
Sbjct: 294 ILPALARHHVSTDREGFSRSLDWGLRMTLLISVPAMLGLLLLAEPLIATIFQHGQFSAFD 353

Query: 64  TILVSSYLSIY--STEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           T + +  LS+Y  S  +  F L +V+L  FYAR D KTP +  I ++V   V
Sbjct: 354 TRMTA--LSVYGLSFGLPAFALLKVVLPAFYARQDTKTPVRAGIAALVANMV 403


>gi|167629673|ref|YP_001680172.1| integral membrane protein mvin [Heliobacterium modesticaldum Ice1]
 gi|167592413|gb|ABZ84161.1| integral membrane protein mvin [Heliobacterium modesticaldum Ice1]
          Length = 530

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 8/175 (4%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           +LP LS+ + + +++   +   R + Y     +P  A+ ++L   IIQ L++R  F A  
Sbjct: 284 MLPALSALLAVGDREGFKKTLARGVSYYALILLPIMAVTVILSGPIIQVLFQREEFDATR 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRV---LLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
           T + +  L  Y    +GF  S V       FY+ +D  TP K   L++ +   +     P
Sbjct: 344 TAMTAFALVFYG---LGFFPSAVRDLYTRAFYSLHDTATPVKIGALTVFIHVAMNFLFIP 400

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRIL-SIFISSGLMGM 174
           ++   G+A A      +N + L   LL RR     F   +++     I+S LMG+
Sbjct: 401 WLSHGGLALATSISNALNMVILG-WLLYRRVGGWSFGNQWKVFYQALIASTLMGI 454


>gi|317968621|ref|ZP_07970011.1| integral membrane protein MviN [Synechococcus sp. CB0205]
          Length = 571

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 62/140 (44%), Gaps = 17/140 (12%)

Query: 36  IPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARN 95
           +P  A+++ L   I+  +YERGAF A    LV   L  Y   +  +L   VL+  FYA  
Sbjct: 361 LPLGALMVALAGPIVALVYERGAFNAGAAALVGGLLMAYGVGMPAYLGRDVLVRVFYALG 420

Query: 96  DVKTPAKFYILSIVMG----FVIAIGLFPF--------IGGYGIATAEVSWVWVNTI-CL 142
           D  TP +F +  I +     +V+  G  P+         G  G+  A V    VN I C 
Sbjct: 421 DGTTPFRFSMAGIALNALFDWVLVGGPTPWGLQLPALNFGAPGLVLATVG---VNLITCF 477

Query: 143 AVAL-LKRRQIDLPFQTIYR 161
            + L L+RR   +P     R
Sbjct: 478 GLLLALQRRVPGMPLANWAR 497


>gi|254303701|ref|ZP_04971059.1| MviN family protein [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148323893|gb|EDK89143.1| MviN family protein [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 489

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 57/111 (51%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ ++     A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPSISKAAANNDKEGTNRSLVSALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + +  L  YS  ++ ++  +++   +YA  D K PAKF I +IVM  V+
Sbjct: 341 VKITAECLLYYSLGLLFYVGVQLVSKAYYAMGDNKRPAKFSITAIVMNIVL 391


>gi|167038787|ref|YP_001661772.1| integral membrane protein MviN [Thermoanaerobacter sp. X514]
 gi|300913628|ref|ZP_07130945.1| integral membrane protein MviN [Thermoanaerobacter sp. X561]
 gi|307723357|ref|YP_003903108.1| integral membrane protein MviN [Thermoanaerobacter sp. X513]
 gi|166853027|gb|ABY91436.1| integral membrane protein MviN [Thermoanaerobacter sp. X514]
 gi|300890313|gb|EFK85458.1| integral membrane protein MviN [Thermoanaerobacter sp. X561]
 gi|307580418|gb|ADN53817.1| integral membrane protein MviN [Thermoanaerobacter sp. X513]
          Length = 521

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P LS     ++K+   +  N  +  +L+  IP +   ++L   II+ L+ERGAF  +
Sbjct: 285 AIYPVLSQHSVADDKEGFLKSLNFVVSGILYVLIPVSVGAMVLRVPIIKVLFERGAFDEK 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            T L S  L  Y+  +  + L  VL   FY+  D KTP
Sbjct: 345 STYLTSIALFYYAIGMTAYGLRDVLSRSFYSMKDTKTP 382


>gi|19704044|ref|NP_603606.1| virulence factor mviN [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|19714238|gb|AAL94905.1| Virulence factor mviN [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
          Length = 489

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 59/111 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ +++    A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPTISKAAANNDKEGTNKGIISALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + +  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VRITAECLFYYSLGLLFYVGVQLVSKAYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|296327888|ref|ZP_06870424.1| integral membrane protein MviN [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155022|gb|EFG95803.1| integral membrane protein MviN [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 489

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 59/111 (53%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           L P +S A    +K+ +++    A+ ++ F  IP   +L    K++I+ ++  G F  + 
Sbjct: 281 LFPTISKAAANNDKEGTNKGIISALNFLNFLTIPSLFVLTFFSKDVIRLIFSYGKFNEEA 340

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVI 114
             + +  L  YS  ++ ++  +++   +YA  D K PAKF I++I+M  V+
Sbjct: 341 VRITAECLFYYSLGLLFYVGVQLVSKAYYAMGDNKRPAKFSIIAIIMNIVL 391


>gi|167585664|ref|ZP_02378052.1| integral membrane protein MviN [Burkholderia ubonensis Bu]
          Length = 516

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 68/152 (44%), Gaps = 1/152 (0%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP LS A    +  + S L +  +        P    L      +  TL+  G F A  
Sbjct: 291 LLPSLSKAHVDADATEYSALLDWGLRVTFLLAAPSALALFFFAAPLTATLFNYGKFDAFT 350

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIG 123
             +V+  L+ Y   +VG +L ++L   FYA+ D+KTP K  +  +V+  +      P IG
Sbjct: 351 VTMVARALATYGIGLVGIILIKILAPGFYAKQDIKTPVKIAVGVLVVTQLSNYVFVPLIG 410

Query: 124 GYGIATAEVSWVWVNTICLAVALLKRRQIDLP 155
             G+  +      +N++ L +  L+RR I  P
Sbjct: 411 HAGLTLSIGVGACLNSLLLFIG-LRRRGIYQP 441


>gi|167038469|ref|YP_001666047.1| integral membrane protein MviN [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|256751334|ref|ZP_05492213.1| integral membrane protein MviN [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|320116863|ref|YP_004187022.1| integral membrane protein MviN [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166857303|gb|ABY95711.1| integral membrane protein MviN [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|256749716|gb|EEU62741.1| integral membrane protein MviN [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|319929954|gb|ADV80639.1| integral membrane protein MviN [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 521

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+ P LS     ++K+   +  N  +  +L+  IP +   ++L   II+ L+ERGAF  +
Sbjct: 285 AIYPVLSQHSVADDKEGFLKSLNFVVSGILYVLIPVSVGAMVLRVPIIKVLFERGAFDEK 344

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            T L S  L  Y+  +  + L  VL   FY+  D KTP
Sbjct: 345 STYLTSIALFYYAIGMTAYGLRDVLSRSFYSMKDTKTP 382


>gi|220928126|ref|YP_002505035.1| integral membrane protein MviN [Clostridium cellulolyticum H10]
 gi|219998454|gb|ACL75055.1| integral membrane protein MviN [Clostridium cellulolyticum H10]
          Length = 549

 Score = 50.8 bits (120), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS  + L+   +  E+ N   + +L+  IP +   ++L + ++  +Y+      +
Sbjct: 305 AILPTLSEKLALKKVDEFKEILNNGFKTILYLIIPSSVAFIVLSQPVVSVVYKWSQVIGK 364

Query: 63  DTILVS-SYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFV 113
           + I+ + S L +++  ++   +  +L   FYA ND KTP     +SI + FV
Sbjct: 365 ERIVTAGSILLLFTAAMIAQSMLALLNRAFYANNDTKTPLYIGTVSIALNFV 416


>gi|119898482|ref|YP_933695.1| virulence factor [Azoarcus sp. BH72]
 gi|119670895|emb|CAL94808.1| probable virulence factor [Azoarcus sp. BH72]
          Length = 512

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%)

Query: 50  IQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSI 108
           + TL+  GAF+A D +     L  YS  + G +L +VL   FYAR D++TP K  ++++
Sbjct: 333 VTTLFHYGAFSATDVLHTRDALVAYSVGLTGLILVKVLAPGFYARQDIRTPVKIALITL 391


>gi|46445978|ref|YP_007343.1| hypothetical protein pc0344 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46399619|emb|CAF23068.1| hypothetical protein pc0344 [Candidatus Protochlamydia amoebophila
           UWE25]
          Length = 535

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 71/159 (44%), Gaps = 2/159 (1%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
            ALLP L+ A++ +N     +  N A+ Y     IP TA L +L    +  ++  G F A
Sbjct: 292 GALLPPLTRALKAQNWALYYQFLNDAVLYTCTIMIPFTAALFVLGYSSVNLIFGHGNFHA 351

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
              I  +  L  Y   ++   L  +L    YA+N+ + PA   IL++++ F +      F
Sbjct: 352 SSVIGTTKCLWGYGIGLLPSTLILLLAPACYAQNNYRLPAIASILNMILNFSLNYMFIIF 411

Query: 122 I--GGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQT 158
              G   +A A     WVN   L + L  + +  L F+T
Sbjct: 412 FGWGATSVAVATSLSAWVNVFFLGIFLNNKEKSWLIFKT 450


>gi|217976563|ref|YP_002360710.1| integral membrane protein MviN [Methylocella silvestris BL2]
 gi|217501939|gb|ACK49348.1| integral membrane protein MviN [Methylocella silvestris BL2]
          Length = 519

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 66/147 (44%), Gaps = 2/147 (1%)

Query: 4   LLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQD 63
           LLP++S  +       +   +NR +   L    P     +M+P  I++ ++ RGAFT + 
Sbjct: 284 LLPQMSRLLAAGRPAGALHAQNRTMAISLVLTAPFFVAFIMIPDFIMKGIFLRGAFTLEA 343

Query: 64  TILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLF-PFI 122
               +  LS Y   ++  +L R  ++ F A  D KTP    + ++ +   + + LF P+ 
Sbjct: 344 AYASADVLSAYGFGLIAIVLLRSAVASFQAHGDTKTPMLISLAAVAVNIGLKLILFEPWG 403

Query: 123 GGYGIATAEVSWVWVNTICLAVALLKR 149
                    V   WVN + LA   ++R
Sbjct: 404 AAGLATATAVG-AWVNLLLLAFFAIRR 429


>gi|118444529|ref|YP_877863.1| integral membrane protein MviN [Clostridium novyi NT]
 gi|118134985|gb|ABK62029.1| integral membrane protein MviN [Clostridium novyi NT]
          Length = 515

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 9/190 (4%)

Query: 6   PKLSSAIQL-ENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAF---TA 61
           P L+  I   E K+   +  ++AI  +     P T  +++L   II   ++RG F   + 
Sbjct: 286 PTLAKYINAGEIKEDFKKYLSKAINNINLIMFPATVGIIVLRTNIISVAFKRGVFDEKSV 345

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
           + T +   +L+I  T ++G  +  +    FYA  D KTP K   + ++   V+ I L  F
Sbjct: 346 EATAIALLFLAI-GTGVLG--IRDIYNRAFYAIQDTKTPMKNSAIGVLTNVVLDITLVKF 402

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKR-RQIDLPFQTIYRILSIFISSGLMGMFIVFFK 180
           +G  G+  A    ++V+T+ LA+ L K+   ID     +     I +SS +MG+ +    
Sbjct: 403 MGVGGLTLATTISIFVSTVLLALDLRKKIGNID-AVSVLKSGFKILVSSVMMGLVVYIIN 461

Query: 181 PCLFNQLSAE 190
             +   +S  
Sbjct: 462 TNILKYVSGN 471


>gi|282890090|ref|ZP_06298622.1| hypothetical protein pah_c012o017 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500018|gb|EFB42305.1| hypothetical protein pah_c012o017 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 545

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 2   AALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTA 61
            ALLP L+ AI+    Q  ++    ++E      IP +  LL+L    I  +Y RG F+ 
Sbjct: 294 GALLPPLTRAIKENQPQLFAQFLRFSLEKAFALMIPLSFALLLLAGPSINFIYGRGQFSD 353

Query: 62  QDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPF 121
             T   +  L  Y   ++   L  +L S FYA+ + + P        ++  +IA+GL  F
Sbjct: 354 HSTYQTALCLWGYGCGLLPMALVLILASVFYAQKNYRIP--------MIASMIAMGLNGF 405

Query: 122 IG-------GYGIATAEVSW---VWVNTICLAVALLKRR 150
           +        G+G A+  ++     WVN   L +AL K+ 
Sbjct: 406 LNTVLVGMLGWGAASVALATSISAWVNVFYLLIALPKKE 444


>gi|189219901|ref|YP_001940542.1| Uncharacterized membrane protein, putative virulence factor
           [Methylacidiphilum infernorum V4]
 gi|189186759|gb|ACD83944.1| Uncharacterized membrane protein, putative virulence factor
           [Methylacidiphilum infernorum V4]
          Length = 582

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 99/210 (47%), Gaps = 5/210 (2%)

Query: 5   LPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDT 64
           LP +S      + Q   +    ++    FF +P    L+ L  +II  +Y+ G F++ DT
Sbjct: 346 LPSVSRQDARRDHQAFGQTLESSLRLAFFFTLPSAVGLVFLSDQIIALIYQHGRFSSFDT 405

Query: 65  ILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGF---VIAIGLFPF 121
           +  +  L  Y+  + G+   +VL   F A N  + P +  ++ I +     +I + +F  
Sbjct: 406 LQTAYALKAYAVGLCGYAGIKVLTPCFSALNKPQVPLRVTLIGIAINLLSNIILVKIFS- 464

Query: 122 IGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTIYRILSIFISSGLMGMFIVFFKP 181
           +G  G+A        +N   L ++++K  ++    + ++ +L I  SS L     +FF  
Sbjct: 465 LGHVGLAATTSLVSLLNFTQLYLSIIKSIKVGELKKGLFFLLKIIFSSVLCASSALFFSL 524

Query: 182 CLFNQLSAETAFSPFKNLAIILSGAVLVYL 211
            +  +L  ++ FS F +  + ++ AV++YL
Sbjct: 525 WI-GKLLGQSFFSLFFSTLLGIALAVVIYL 553


>gi|310657684|ref|YP_003935405.1| integral membrane protein mvin [Clostridium sticklandii DSM 519]
 gi|308824462|emb|CBH20500.1| Integral membrane protein MviN [Clostridium sticklandii]
          Length = 505

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           + ++ P +S+   + N +   E    AI  +    IP T   +   KEII  L+ RGAF 
Sbjct: 276 VTSMYPIISNYASINNIKGIKETIMEAISIISLVVIPITVGAIFFSKEIITLLFGRGAFN 335

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
            Q  ++ S  L  YS  + G+ L  +L   FY+  D KTP
Sbjct: 336 EQAIVMTSLALFYYSFGMWGYGLREILSRGFYSIQDTKTP 375


>gi|125975118|ref|YP_001039028.1| integral membrane protein MviN [Clostridium thermocellum ATCC
           27405]
 gi|256003226|ref|ZP_05428218.1| integral membrane protein MviN [Clostridium thermocellum DSM 2360]
 gi|281418461|ref|ZP_06249480.1| integral membrane protein MviN [Clostridium thermocellum JW20]
 gi|125715343|gb|ABN53835.1| integral membrane protein MviN [Clostridium thermocellum ATCC
           27405]
 gi|255992917|gb|EEU03007.1| integral membrane protein MviN [Clostridium thermocellum DSM 2360]
 gi|281407545|gb|EFB37804.1| integral membrane protein MviN [Clostridium thermocellum JW20]
 gi|316939285|gb|ADU73319.1| integral membrane protein MviN [Clostridium thermocellum DSM 1313]
          Length = 512

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 83/175 (47%), Gaps = 2/175 (1%)

Query: 1   MAALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFT 60
           +A + P +S      N ++  ++ + +I  V    +P +   ++  KEI+  L+ RGAF 
Sbjct: 276 IAVMYPAISKLAAENNMKELKKVLSESIIGVTLLLVPLSVGAMIFSKEIVALLFGRGAFD 335

Query: 61  AQDTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFP 120
                + S  L  YS  ++ F +  VL   FY+  D KTP     + + +  V+ I L  
Sbjct: 336 KTAVDMTSVSLFYYSIGMLAFGIRDVLSRVFYSVKDTKTPTINAGIGMALNIVLNIILSR 395

Query: 121 FIGGYGIATAEVSWVWVNTICLAVALLKRRQIDLPFQTI-YRILSIFISSGLMGM 174
           ++G  G+A A  S V +    L    L+++   L  + + ++   I +SS LMG+
Sbjct: 396 YMGIGGLALAT-SIVGIFITILMFVTLRKKIGPLGMKAMSFKFFKILVSSLLMGV 449


>gi|219850086|ref|YP_002464519.1| integral membrane protein MviN [Chloroflexus aggregans DSM 9485]
 gi|219544345|gb|ACL26083.1| integral membrane protein MviN [Chloroflexus aggregans DSM 9485]
          Length = 517

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 48/98 (48%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS      ++          ++ VL   +P TA L  L   I  TL+ERGAF A+
Sbjct: 290 AVLPTLSRQSATGDEAAFRSTLAMGLKIVLLLILPATAGLAALSLPITATLFERGAFGAE 349

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTP 100
           DT + +  L  Y   +    + ++LL  FYAR +  TP
Sbjct: 350 DTAITALALLYYLPGLPAAAIDQILLFAFYARKNTLTP 387


>gi|116748475|ref|YP_845162.1| integral membrane protein MviN [Syntrophobacter fumaroxidans MPOB]
 gi|116697539|gb|ABK16727.1| integral membrane protein MviN [Syntrophobacter fumaroxidans MPOB]
          Length = 522

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 65/125 (52%)

Query: 25  NRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQDTILVSSYLSIYSTEIVGFLLS 84
           N A++  +   +P TA ++++ +  I+ ++++G FTAQDT+  +  L I    +  +   
Sbjct: 309 NTALQNTMTLLVPLTAWMMIVAEPTIRLIFQQGHFTAQDTVHTARLLQIMLAVVFCWGYQ 368

Query: 85  RVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFIGGYGIATAEVSWVWVNTICLAV 144
           ++L   FYA  D  TPA    L+ ++   +   L   +G  G+A A  + +++ +  L+ 
Sbjct: 369 QILGRAFYATRDTLTPALLGTLTTLVSIPVFYFLTESLGATGVAVASAAGIFLYSAVLSW 428

Query: 145 ALLKR 149
           +  +R
Sbjct: 429 SWRRR 433


>gi|302342849|ref|YP_003807378.1| integral membrane protein MviN [Desulfarculus baarsii DSM 2075]
 gi|301639462|gb|ADK84784.1| integral membrane protein MviN [Desulfarculus baarsii DSM 2075]
          Length = 522

 Score = 50.4 bits (119), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%)

Query: 3   ALLPKLSSAIQLENKQQSSELRNRAIEYVLFFGIPCTAILLMLPKEIIQTLYERGAFTAQ 62
           A+LP LS      ++Q   E     +   LF  +P    L++L + +++ L+ RG F  +
Sbjct: 293 AILPSLSRQAADADRQGLVETMGYGLRLTLFITVPSMVGLVVLARPLVELLFMRGEFGVE 352

Query: 63  DTILVSSYLSIYSTEIVGFLLSRVLLSEFYARNDVKTPAKFYILSIVMGFVIAIGLFPFI 122
                ++ L  Y   +  F   R ++  FYA  D KTP K     +V+    ++ L   +
Sbjct: 353 SAAATANALVGYGLGLWAFAGLRAVVQTFYALKDTKTPVKVAAGCLVVNVAASLLLMWPL 412

Query: 123 GGYGIATA 130
           G  G+A A
Sbjct: 413 G