Query 537021.9.peg.493_1 Match_columns 64 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 23:08:21 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_493.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR02627 rhamnulo_kin rhamnul 57.4 5.5 0.00014 20.7 1.4 15 42-56 345-359 (460) 2 KOG0080 consensus 39.4 17 0.00044 18.0 1.6 22 38-59 101-122 (209) 3 KOG0854 consensus 33.5 32 0.00081 16.6 2.2 23 33-55 74-96 (224) 4 KOG0083 consensus 18.8 69 0.0018 14.7 1.7 20 41-60 91-110 (192) 5 COG0025 NhaP NhaP-type Na+/H+ 18.1 76 0.0019 14.5 1.7 29 1-29 279-307 (429) 6 PRK01018 50S ribosomal protein 17.6 62 0.0016 15.0 1.2 15 42-56 46-60 (99) 7 pfam01779 Ribosomal_L29e Ribos 15.5 45 0.0011 15.7 0.1 11 25-35 11-21 (40) 8 COG3821 Predicted membrane pro 14.1 84 0.0021 14.2 1.1 15 5-19 69-83 (234) 9 pfam05961 Chordopox_A13L Chord 13.6 1E+02 0.0026 13.8 1.4 23 16-42 1-23 (68) 10 pfam08771 Rapamycin_bind Rapam 13.4 1.2E+02 0.003 13.4 3.2 29 33-61 3-36 (100) No 1 >TIGR02627 rhamnulo_kin rhamnulokinase; InterPro: IPR013449 Rhamnulokinase (2.7.1.5 from EC) is an enzyme that catalyzes the second step in rhamnose catabolism.; GO: 0008993 rhamnulokinase activity, 0019301 rhamnose catabolic process. Probab=57.42 E-value=5.5 Score=20.72 Aligned_cols=15 Identities=47% Similarity=0.864 Sum_probs=12.1 Q ss_pred HHHHHHHHHHHCCHH Q ss_conf 999999996214234 Q 537021.9.peg.4 42 WIEEIKYYCKEANIV 56 (64) Q Consensus 42 wieeikyyckeaniv 56 (64) -++||+-||||.+-+ T Consensus 345 M~~eI~~yCREt~Q~ 359 (460) T TIGR02627 345 MVEEIQAYCRETNQP 359 (460) T ss_pred HHHHHHHHHHHCCCC T ss_conf 799999975423788 No 2 >KOG0080 consensus Probab=39.44 E-value=17 Score=18.01 Aligned_cols=22 Identities=27% Similarity=0.752 Sum_probs=19.0 Q ss_pred HHHHHHHHHHHHHHHCCHHHHH Q ss_conf 9999999999996214234334 Q 537021.9.peg.4 38 SWIIWIEEIKYYCKEANIVSMF 59 (64) Q Consensus 38 swiiwieeikyyckeanivsmf 59 (64) .--+|..|+.-||...||+.|. T Consensus 101 kLd~W~~Eld~Ystn~diikml 122 (209) T KOG0080 101 KLDIWLKELDLYSTNPDIIKML 122 (209) T ss_pred HHHHHHHHHHHHCCCCCHHHHH T ss_conf 5999999887644881376765 No 3 >KOG0854 consensus Probab=33.50 E-value=32 Score=16.57 Aligned_cols=23 Identities=35% Similarity=0.537 Sum_probs=19.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHCCH Q ss_conf 99999999999999999621423 Q 537021.9.peg.4 33 IRGIISWIIWIEEIKYYCKEANI 55 (64) Q Consensus 33 irgiiswiiwieeikyyckeani 55 (64) +...-|-.-||+.||-||++.|- T Consensus 74 ~d~vesH~~Wi~DIks~~~~~~~ 96 (224) T KOG0854 74 VDDVESHKDWIKDIKSYAKVKNH 96 (224) T ss_pred HHHHHHHHHHHHHHHHHHHCCCC T ss_conf 31677788999999998742677 No 4 >KOG0083 consensus Probab=18.81 E-value=69 Score=14.71 Aligned_cols=20 Identities=40% Similarity=0.803 Sum_probs=16.3 Q ss_pred HHHHHHHHHHHHCCHHHHHH Q ss_conf 99999999962142343343 Q 537021.9.peg.4 41 IWIEEIKYYCKEANIVSMFG 60 (64) Q Consensus 41 iwieeikyyckeanivsmfg 60 (64) -|..||+-|.||+--+...| T Consensus 91 ~wlsei~ey~k~~v~l~llg 110 (192) T KOG0083 91 AWLSEIHEYAKEAVALMLLG 110 (192) T ss_pred HHHHHHHHHHHHHHHHHHHC T ss_conf 99999999988667675442 No 5 >COG0025 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism] Probab=18.11 E-value=76 Score=14.49 Aligned_cols=29 Identities=17% Similarity=0.669 Sum_probs=24.0 Q ss_pred CCCHHHHHHCCCHHHHHHHHHHHHHHHHH Q ss_conf 94003333204089999999999999987 Q 537021.9.peg.4 1 LWDKIDYFASSNIFIMIGMIISMAICKAH 29 (64) Q Consensus 1 lwdkidyfassnifimigmiismaickah 29 (64) .|+.+|++..+-+|+.+|..++...-... T Consensus 279 fwe~l~~~ln~~iFiLlG~~i~~~~~~~~ 307 (429) T COG0025 279 FWEVLDFLLNGLLFVLLGAQLPLSLLLAL 307 (429) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999988458897775 No 6 >PRK01018 50S ribosomal protein L30e; Reviewed Probab=17.64 E-value=62 Score=14.95 Aligned_cols=15 Identities=40% Similarity=0.600 Sum_probs=11.9 Q ss_pred HHHHHHHHHHHCCHH Q ss_conf 999999996214234 Q 537021.9.peg.4 42 WIEEIKYYCKEANIV 56 (64) Q Consensus 42 wieeikyyckeaniv 56 (64) -.++|.|||+.+++- T Consensus 46 ~k~~ie~ya~l~~vp 60 (99) T PRK01018 46 IKEDIMYYAKLSDIP 60 (99) T ss_pred HHHHHHHHHHCCCCC T ss_conf 999999988636998 No 7 >pfam01779 Ribosomal_L29e Ribosomal L29e protein family. Probab=15.54 E-value=45 Score=15.74 Aligned_cols=11 Identities=55% Similarity=0.567 Sum_probs=8.4 Q ss_pred HHHHHHHHHHH Q ss_conf 99987689999 Q 537021.9.peg.4 25 ICKAHRNCIRG 35 (64) Q Consensus 25 ickahrncirg 35 (64) -+|+|||-|.. T Consensus 11 s~K~HRNGIkK 21 (40) T pfam01779 11 NRKAHRNGIKK 21 (40) T ss_pred HHHHHHCCCCC T ss_conf 27878654667 No 8 >COG3821 Predicted membrane protein [Function unknown] Probab=14.09 E-value=84 Score=14.25 Aligned_cols=15 Identities=33% Similarity=0.567 Sum_probs=11.0 Q ss_pred HHHHHCCCHHHHHHH Q ss_conf 333320408999999 Q 537021.9.peg.4 5 IDYFASSNIFIMIGM 19 (64) Q Consensus 5 idyfassnifimigm 19 (64) -.+||||++++.-|- T Consensus 69 taFFASstlialgg~ 83 (234) T COG3821 69 TAFFASSTLIALGGC 83 (234) T ss_pred CHHHHHHHHHHHHHH T ss_conf 358877119999999 No 9 >pfam05961 Chordopox_A13L Chordopoxvirus A13L protein. This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus. Probab=13.55 E-value=1e+02 Score=13.83 Aligned_cols=23 Identities=48% Similarity=0.801 Sum_probs=15.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 999999999999876899999999999 Q 537021.9.peg.4 16 MIGMIISMAICKAHRNCIRGIISWIIW 42 (64) Q Consensus 16 migmiismaickahrncirgiiswiiw 42 (64) |||-++-+.||-| +-|.|-+-|+ T Consensus 1 MI~~llLi~ICVa----vi~lIvYgiY 23 (68) T pfam05961 1 MIGDLILVIICVA----IIGLIVYGIY 23 (68) T ss_pred CHHHHHHHHHHHH----HHHHHHHHHH T ss_conf 9178999999999----9999999885 No 10 >pfam08771 Rapamycin_bind Rapamycin binding domain. This domain forms an alpha helical structure and binds to rapamycin. Probab=13.35 E-value=1.2e+02 Score=13.44 Aligned_cols=29 Identities=34% Similarity=0.777 Sum_probs=17.5 Q ss_pred HHHHHHHH-HHHHHH----HHHHHHCCHHHHHHH Q ss_conf 99999999-999999----999621423433430 Q 537021.9.peg.4 33 IRGIISWI-IWIEEI----KYYCKEANIVSMFGL 61 (64) Q Consensus 33 irgiiswi-iwieei----kyyckeanivsmfgl 61 (64) ||--|+|- .|.|.+ +-|+.+-|+..||.. T Consensus 3 iRvAiLW~E~W~e~LeeAsr~yf~~~n~~~m~~~ 36 (100) T pfam08771 3 IRVAILWHELWYEGLEEASRAYFGDRNVEGMFEI 36 (100) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHH T ss_conf 6999869999999999999998125889999999 Done!