Query 537021.9.peg.509_1 Match_columns 45 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 23:23:45 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_509.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00269 TIGR00269 conserved 43.7 5.1 0.00013 21.2 -0.6 38 7-44 49-86 (106) 2 COG1339 Transcriptional regula 28.9 32 0.00082 17.1 1.6 31 10-41 3-33 (214) 3 pfam11073 NSs Rift valley feve 12.9 1.4E+02 0.0035 13.9 2.1 31 13-43 150-191 (238) 4 pfam02792 Mago_nashi Mago nash 12.4 67 0.0017 15.5 0.2 14 15-28 130-143 (143) 5 pfam08279 HTH_11 HTH domain. T 12.0 88 0.0023 14.9 0.8 15 28-42 16-30 (55) 6 COG5395 Predicted membrane pro 9.2 1.4E+02 0.0035 14.0 0.9 13 17-29 94-106 (131) 7 KOG2799 consensus 8.9 1.6E+02 0.004 13.7 1.1 21 11-31 327-347 (434) 8 TIGR02607 antidote_HigA addict 8.1 1.4E+02 0.0035 14.0 0.5 18 24-41 17-34 (81) 9 pfam03333 PapB Adhesin biosynt 7.6 2E+02 0.005 13.1 1.2 29 11-39 29-65 (91) 10 pfam10952 DUF2753 Protein of u 7.1 1.8E+02 0.0047 13.3 0.8 14 9-22 102-115 (140) No 1 >TIGR00269 TIGR00269 conserved hypothetical protein TIGR00269; InterPro: IPR000541 The following uncharacterised proteins have been shown to share regions of similarities, yeast chromosome VII hypothetical protein YGL211w; Dictyostelium discoideum (Slime mold) protein veg136; and Methanococcus jannaschii hypothetical proteins MJ1157 and MJ1478.. Probab=43.68 E-value=5.1 Score=21.21 Aligned_cols=38 Identities=34% Similarity=0.520 Sum_probs=33.6 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 23666666467665334677651998875321776315 Q 537021.9.peg.5 7 ISLKKALIDFSLISAHKKIMAITAKELSKRISISRCIN 44 (45) Q Consensus 7 islkkalidfslisahkkimaitakelskrisisrcin 44 (45) ++-+|.-+-||..+...||..++-|+|+..+.+.||.. T Consensus 49 le~~~pG~kfsvl~sf~ki~~~~~~~L~~~~~~~~C~~ 86 (106) T TIGR00269 49 LEEKKPGVKFSVLRSFEKIKIILLKELSEKEELRRCER 86 (106) T ss_pred HHHCCCCCEEEECCCHHHHHHHHHHHCCCCCCCCCCCC T ss_conf 63038970231000046677776321143355650001 No 2 >COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Probab=28.87 E-value=32 Score=17.14 Aligned_cols=31 Identities=29% Similarity=0.489 Sum_probs=25.9 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 66666467665334677651998875321776 Q 537021.9.peg.5 10 KKALIDFSLISAHKKIMAITAKELSKRISISR 41 (45) Q Consensus 10 kkalidfslisahkkimaitakelskrisisr 41 (45) +.+|.+..+.+|+.+ |.++..|++++...|. T Consensus 3 ~~~lk~l~~~~a~~~-~~~t~~ela~~l~~S~ 33 (214) T COG1339 3 QRLLKKLALRGAVRG-VKVTSSELAKRLGVSS 33 (214) T ss_pred HHHHHHHHHHHHHCC-CCCCHHHHHHHHCCCC T ss_conf 789999987210037-6020899998857470 No 3 >pfam11073 NSs Rift valley fever virus non structural protein (NSs) like. This family contains several Phlebovirus non structural proteins which act as a major determinant of virulence by antagonising interferon beta gene expression. Probab=12.89 E-value=1.4e+02 Score=13.93 Aligned_cols=31 Identities=35% Similarity=0.550 Sum_probs=18.8 Q ss_pred HHHHHHHHHHHHHHHH-----------HHHHHHHHHHHHHHC Q ss_conf 6646766533467765-----------199887532177631 Q 537021.9.peg.5 13 LIDFSLISAHKKIMAI-----------TAKELSKRISISRCI 43 (45) Q Consensus 13 lidfslisahkkimai-----------takelskrisisrci 43 (45) -+|=++.-+||||+.- +.-.|.|.|.+-.|+ T Consensus 150 ~lDd~~Ve~Hkkil~E~~~rgl~~e~l~G~Dl~kEIa~vQ~v 191 (238) T pfam11073 150 GLDDSIVEAHKKILLEASLRGLSDEDLPGYDLIKEIAYVQCV 191 (238) T ss_pred CHHHHHHHHHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHH T ss_conf 788999999999999999839985436861278889999999 No 4 >pfam02792 Mago_nashi Mago nashi protein. This family was originally identified in Drosophila and called mago nashi, it is a strict maternal effect, grandchildless-like, gene. The human homologue has been shown to interact with an RNA binding protein. An RNAi knockout of the C. elegans homologue causes masculinization of the germ line (Mog phenotype) hermaphrodites, suggesting it is involved in hermaphrodite germ-line sex determination. Mago nashi has been found to be part of the exon-exon junction complex that binds 20 nucleotides upstream of exon-exon junctions. Probab=12.38 E-value=67 Score=15.51 Aligned_cols=14 Identities=64% Similarity=0.669 Sum_probs=10.6 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 46766533467765 Q 537021.9.peg.5 15 DFSLISAHKKIMAI 28 (45) Q Consensus 15 dfslisahkkimai 28 (45) -||||+.|-||-.| T Consensus 130 vfsLi~lHfkIkPi 143 (143) T pfam02792 130 VFSLISLHFKIKPI 143 (143) T ss_pred HHHHHHHHCCCCCC T ss_conf 99997640012369 No 5 >pfam08279 HTH_11 HTH domain. This family includes helix-turn-helix domains in a wide variety of proteins. Probab=12.04 E-value=88 Score=14.92 Aligned_cols=15 Identities=33% Similarity=0.691 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHHHH Q ss_conf 519988753217763 Q 537021.9.peg.5 28 ITAKELSKRISISRC 42 (45) Q Consensus 28 itakelskrisisrc 42 (45) +|+++|+++..+||- T Consensus 16 vt~~~La~~l~VSr~ 30 (55) T pfam08279 16 ISGQELAEKLGVSRR 30 (55) T ss_pred CCHHHHHHHHCCCHH T ss_conf 189999999698899 No 6 >COG5395 Predicted membrane protein [Function unknown] Probab=9.23 E-value=1.4e+02 Score=13.97 Aligned_cols=13 Identities=46% Similarity=0.562 Sum_probs=8.6 Q ss_pred HHHHHHHHHHHHH Q ss_conf 7665334677651 Q 537021.9.peg.5 17 SLISAHKKIMAIT 29 (45) Q Consensus 17 slisahkkimait 29 (45) .-|++|.|||.-+ T Consensus 94 G~i~~HRr~mq~~ 106 (131) T COG5395 94 GKISAHRRIMQGV 106 (131) T ss_pred CCHHHHHHHHHHH T ss_conf 6478999998763 No 7 >KOG2799 consensus Probab=8.93 E-value=1.6e+02 Score=13.66 Aligned_cols=21 Identities=43% Similarity=0.578 Sum_probs=16.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 666646766533467765199 Q 537021.9.peg.5 11 KALIDFSLISAHKKIMAITAK 31 (45) Q Consensus 11 kalidfslisahkkimaitak 31 (45) ..--+||+|...+|.|||-.. T Consensus 327 ~v~eaf~litsd~kv~ailvn 347 (434) T KOG2799 327 QVREAFSLITSDKKVMAILVN 347 (434) T ss_pred HHHHHHHHHHCCHHHHHHHHH T ss_conf 898888887258049999999 No 8 >TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids. They include the characterised member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is encoded by the upstream member of the gene pair.; GO: 0003677 DNA binding. Probab=8.12 E-value=1.4e+02 Score=13.96 Aligned_cols=18 Identities=22% Similarity=0.554 Sum_probs=11.8 Q ss_pred HHHHHHHHHHHHHHHHHH Q ss_conf 677651998875321776 Q 537021.9.peg.5 24 KIMAITAKELSKRISISR 41 (45) Q Consensus 24 kimaitakelskrisisr 41 (45) .-|.||+.+|.|.+.+|| T Consensus 17 ~PLg~s~~~LA~~LgVsr 34 (81) T TIGR02607 17 EPLGLSVRALAKALGVSR 34 (81) T ss_pred HCCCHHHHHHHHHCCCCH T ss_conf 104706899998709997 No 9 >pfam03333 PapB Adhesin biosynthesis transcription regulatory protein. This family includes PapB, DaaA, FanA, FanB, and AfaA. Probab=7.63 E-value=2e+02 Score=13.15 Aligned_cols=29 Identities=34% Similarity=0.418 Sum_probs=20.5 Q ss_pred HHHHHHHHHHHHHHHHHHH--------HHHHHHHHHH Q ss_conf 6666467665334677651--------9988753217 Q 537021.9.peg.5 11 KALIDFSLISAHKKIMAIT--------AKELSKRISI 39 (45) Q Consensus 11 kalidfslisahkkimait--------akelskrisi 39 (45) .-||++|-|...|.|+|.- .||...|..+ T Consensus 29 ~LLieiS~IrS~kvI~AL~dylV~G~srkevCe~~~V 65 (91) T pfam03333 29 WLLIEISPIHSEKVINALRDYLVDGYSRKEVCERHNV 65 (91) T ss_pred HHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCC T ss_conf 9999872436389999999998768649999987297 No 10 >pfam10952 DUF2753 Protein of unknown function (DUF2753). This bacterial family of proteins has no known function. Probab=7.14 E-value=1.8e+02 Score=13.30 Aligned_cols=14 Identities=36% Similarity=0.403 Sum_probs=7.2 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 66666646766533 Q 537021.9.peg.5 9 LKKALIDFSLISAH 22 (45) Q Consensus 9 lkkalidfslisah 22 (45) -|+|||||---... T Consensus 102 Ck~ALi~FmKRHPN 115 (140) T pfam10952 102 CQSALIDFLKRHPN 115 (140) T ss_pred HHHHHHHHHHHCCC T ss_conf 89999999984999 Done!